F400061
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 309 | 171 | 304 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100249614|Ga0070671_1002496142 |
| Length | 366 |
| Sequence | LHIKKGFELAADARLFAPGGNAEGFTEMPVSAAIGNVSFYFDATFAELEQITSKEKTIILTDENIYELHQEKFAGYPVIQIAAGEQNKNQQTVDHIIGELIKLEAGKDSFLVGVGGGVVTDITGYVAAVYMRGVSFGLVPTSILCMVDAVIGGKNGIDVGMYKNMVGTIRQPEFIFYDYSFLKTLPVEEWVNGFAEIIKHACIKDAVMFATLERYSLHDFQADETLIAELIEKNVIIKASIVARDEFEKGERKLLNFGHTVGHAVENLHQLPHGHAISIGMAAACNLSEQIAGLHFDDAKKLVLLLSKYHLPVDLETDHEKVFAILRMDKKRTGDSVNFILINKIGNAFIHPIALTELHQHLKQIL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2818991444 | Filimonas endophytica 3197 | Isolate | Unclassified |
| 3 | 2881955468 | Edaphocola flava HME-24 | Isolate | Rhizosphere |
| 4 | 2914759650 | Rhizosphaericola mali | Isolate | Rhizosphere |
| 5 | 2929154850 | Filimonas sp. R-72421 Hybrid assembly | Isolate | Unclassified |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 52 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 120 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 121 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 122 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 123 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 124 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 125 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 128 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 129 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 130 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 131 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 132 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 133 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 134 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 135 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 138 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 153 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 154 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 155 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 156 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 157 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 158 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 159 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 162 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 163 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 164 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 165 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 166 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 167 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 168 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 169 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 170 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 171 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.38 |
| Metatranscriptomes | 0 |
| Isolates | 1.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.53 |
| Nodule | 0 |
| Rhizoplane | 0.65 |
| Rhizosphere | 90.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.88 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10017000 | 3300001979 | Bacteria | 2612 |
| 2 | JGI25406J46586_10006981 | 3300003203 | Bacteria | 5183 |
| 3 | rootL2_10040257 | 3300003322 | Bacteria | 5357 |
| 4 | rootL2_10178143 | 3300003322 | Bacteria | 7160 |
| 5 | rootH1_10148467 | 3300003323 | Unclassified | 3072 |
| 6 | JGI25160J50197_1000745 | 3300003354 | Bacteria | 17705 |
| 7 | Ga0070658_10000095 | 3300005327 | Bacteria | 77839 |
| 8 | Ga0070658_10044049 | 3300005327 | Bacteria | 3605 |
| 9 | Ga0070658_10065296 | 3300005327 | Bacteria | 2970 |
| 10 | Ga0070683_100058804 | 3300005329 | Bacteria | 3571 |
| 11 | Ga0070670_100110100 | 3300005331 | Unclassified | 2373 |
| 12 | Ga0070670_100130473 | 3300005331 | Unclassified | 2170 |
| 13 | Ga0070666_10003710 | 3300005335 | Bacteria | 9255 |
| 14 | Ga0070666_10005940 | 3300005335 | Bacteria | 7494 |
| 15 | Ga0070680_100154434 | 3300005336 | Unclassified | 1928 |
| 16 | Ga0070682_100000173 | 3300005337 | Bacteria | 47981 |
| 17 | Ga0070682_100006926 | 3300005337 | Bacteria | 6371 |
| 18 | Ga0070682_100085816 | 3300005337 | Bacteria | 2049 |
| 19 | Ga0068868_100112206 | 3300005338 | Bacteria | 2216 |
| 20 | Ga0070660_100012793 | 3300005339 | Bacteria | 6000 |
| 21 | Ga0070660_100039915 | 3300005339 | Bacteria | 3569 |
| 22 | Ga0070660_100305899 | 3300005339 | Bacteria | 1304 |
| 23 | Ga0070691_10024793 | 3300005341 | Bacteria | 2790 |
| 24 | Ga0070661_100003273 | 3300005344 | Bacteria | 11185 |
| 25 | Ga0070668_100000043 | 3300005347 | Bacteria | 78564 |
| 26 | Ga0070675_100021470 | 3300005354 | Bacteria | 5160 |
| 27 | Ga0070675_100111266 | 3300005354 | Bacteria | 2317 |
| 28 | Ga0070671_100053386 | 3300005355 | Bacteria | 3360 |
| 29 | Ga0070671_100067864 | 3300005355 | Bacteria | 2974 |
| 30 | Ga0070671_100249614 | 3300005355 | Bacteria | 1507 |
| 31 | Ga0070673_100003480 | 3300005364 | Bacteria | 9802 |
| 32 | Ga0070673_100019594 | 3300005364 | Bacteria | 4860 |
| 33 | Ga0070673_100161929 | 3300005364 | Unclassified | 1903 |
| 34 | Ga0070667_100000254 | 3300005367 | Bacteria | 60664 |
| 35 | Ga0070667_100213179 | 3300005367 | Bacteria | 1717 |
| 36 | Ga0070663_100070734 | 3300005455 | Bacteria | 2538 |
| 37 | Ga0070678_100121924 | 3300005456 | Bacteria | 2057 |
| 38 | Ga0070681_10006155 | 3300005458 | Bacteria | 11657 |
| 39 | Ga0070681_10075464 | 3300005458 | Bacteria | 3331 |
| 40 | Ga0070681_10163415 | 3300005458 | Bacteria | 2150 |
| 41 | Ga0070681_10182064 | 3300005458 | Unclassified | 2022 |
| 42 | Ga0068867_100351485 | 3300005459 | Bacteria | 1230 |
| 43 | Ga0070679_100008640 | 3300005530 | Bacteria | 9598 |
| 44 | Ga0070679_100040914 | 3300005530 | Bacteria | 4612 |
| 45 | Ga0070684_100003498 | 3300005535 | Bacteria | 11793 |
| 46 | Ga0070684_100046261 | 3300005535 | Bacteria | 3770 |
| 47 | Ga0068853_100015815 | 3300005539 | Bacteria | 6196 |
| 48 | Ga0068853_100025782 | 3300005539 | Bacteria | 4935 |
| 49 | Ga0068853_100051908 | 3300005539 | Unclassified | 3531 |
| 50 | Ga0068853_100069921 | 3300005539 | Unclassified | 3055 |
| 51 | Ga0068853_100163082 | 3300005539 | Unclassified | 2012 |
| 52 | Ga0070672_100004549 | 3300005543 | Bacteria | 9081 |
| 53 | Ga0070693_100113665 | 3300005547 | Bacteria | 1669 |
| 54 | Ga0070665_100000350 | 3300005548 | Bacteria | 69455 |
| 55 | Ga0068855_100000089 | 3300005563 | Bacteria | 110845 |
| 56 | Ga0068855_100003857 | 3300005563 | Bacteria | 18329 |
| 57 | Ga0068855_100014782 | 3300005563 | Bacteria | 9401 |
| 58 | Ga0068855_100033470 | 3300005563 | Bacteria | 6133 |
| 59 | Ga0068855_100036145 | 3300005563 | Bacteria | 5881 |
| 60 | Ga0068855_100057611 | 3300005563 | Bacteria | 4553 |
| 61 | Ga0068855_100106056 | 3300005563 | Bacteria | 3230 |
| 62 | Ga0068855_100225300 | 3300005563 | Bacteria | 2101 |
| 63 | Ga0070664_100005960 | 3300005564 | Bacteria | 9850 |
| 64 | Ga0068857_100032899 | 3300005577 | Bacteria | 4584 |
| 65 | Ga0068856_100010342 | 3300005614 | Bacteria | 9064 |
| 66 | Ga0068856_100057817 | 3300005614 | Bacteria | 3829 |
| 67 | Ga0068852_100007216 | 3300005616 | Bacteria | 8104 |
| 68 | Ga0068852_100009959 | 3300005616 | Bacteria | 7072 |
| 69 | Ga0068852_100096249 | 3300005616 | Bacteria | 2660 |
| 70 | Ga0068852_100289410 | 3300005616 | Unclassified | 1582 |
| 71 | Ga0068859_100001471 | 3300005617 | Bacteria | 24005 |
| 72 | Ga0068864_100001192 | 3300005618 | Bacteria | 21573 |
| 73 | Ga0068851_10012344 | 3300005834 | Bacteria | 4025 |
| 74 | Ga0068863_100003656 | 3300005841 | Bacteria | 15182 |
| 75 | Ga0068863_100236173 | 3300005841 | Unclassified | 1764 |
| 76 | Ga0068858_100000199 | 3300005842 | Bacteria | 64607 |
| 77 | Ga0068860_100003203 | 3300005843 | Bacteria | 16892 |
| 78 | Ga0068860_100008577 | 3300005843 | Bacteria | 10189 |
| 79 | Ga0068860_100070685 | 3300005843 | Bacteria | 3318 |
| 80 | Ga0068862_100008092 | 3300005844 | Bacteria | 8701 |
| 81 | Ga0081539_10000037 | 3300005985 | Bacteria | 296160 |
| 82 | Ga0097621_100000063 | 3300006237 | Bacteria | 55571 |
| 83 | Ga0097621_100003359 | 3300006237 | Bacteria | 11008 |
| 84 | Ga0097621_100016337 | 3300006237 | Bacteria | 5609 |
| 85 | Ga0068871_100000952 | 3300006358 | Bacteria | 19348 |
| 86 | Ga0068871_100002768 | 3300006358 | Bacteria | 11972 |
| 87 | Ga0068871_100007723 | 3300006358 | Bacteria | 7699 |
| 88 | Ga0068871_100021180 | 3300006358 | Bacteria | 4993 |
| 89 | Ga0075431_100134086 | 3300006847 | Bacteria | 2553 |
| 90 | Ga0097620_100001471 | 3300006931 | Bacteria | 24005 |
| 91 | Ga0105240_10004146 | 3300009093 | Bacteria | 22202 |
| 92 | Ga0105240_10013673 | 3300009093 | Bacteria | 11131 |
| 93 | Ga0105240_10014151 | 3300009093 | Bacteria | 10899 |
| 94 | Ga0105240_10017976 | 3300009093 | Bacteria | 9512 |
| 95 | Ga0105240_10032774 | 3300009093 | Bacteria | 6721 |
| 96 | Ga0111539_10227763 | 3300009094 | Bacteria | 2171 |
| 97 | Ga0111539_10329600 | 3300009094 | Bacteria | 1777 |
| 98 | Ga0105245_10015578 | 3300009098 | Bacteria | 6630 |
| 99 | Ga0105245_10322476 | 3300009098 | Bacteria | 1522 |
| 100 | Ga0105247_10127848 | 3300009101 | Bacteria | 1653 |
| 101 | Ga0114129_10229365 | 3300009147 | Bacteria | 2502 |
| 102 | Ga0105241_10027376 | 3300009174 | Bacteria | 4245 |
| 103 | Ga0105241_10063567 | 3300009174 | Bacteria | 2848 |
| 104 | Ga0105241_10134229 | 3300009174 | Bacteria | 2007 |
| 105 | Ga0105242_10316227 | 3300009176 | Bacteria | 1430 |
| 106 | Ga0105248_10019350 | 3300009177 | Bacteria | 7533 |
| 107 | Ga0105237_10005745 | 3300009545 | Bacteria | 13938 |
| 108 | Ga0105237_10094008 | 3300009545 | Bacteria | 2987 |
| 109 | Ga0105238_10033928 | 3300009551 | Bacteria | 5193 |
| 110 | Ga0105249_10024983 | 3300009553 | Bacteria | 5375 |
| 111 | Ga0105249_10605706 | 3300009553 | Bacteria | 1150 |
| 112 | Ga0105239_10000314 | 3300010375 | Bacteria | 71313 |
| 113 | Ga0105239_10022435 | 3300010375 | Bacteria | 6959 |
| 114 | Ga0105239_10079537 | 3300010375 | Bacteria | 3607 |
| 115 | Ga0105239_10226745 | 3300010375 | Bacteria | 2096 |
| 116 | Ga0157373_10016644 | 3300013100 | Bacteria | 5359 |
| 117 | Ga0157373_10056705 | 3300013100 | Bacteria | 2781 |
| 118 | Ga0157373_10180080 | 3300013100 | Unclassified | 1488 |
| 119 | Ga0157371_10008867 | 3300013102 | Bacteria | 7964 |
| 120 | Ga0157371_10016690 | 3300013102 | Bacteria | 5471 |
| 121 | Ga0157371_10086315 | 3300013102 | Bacteria | 2223 |
| 122 | Ga0157370_10004101 | 3300013104 | Bacteria | 16888 |
| 123 | Ga0157370_10004869 | 3300013104 | Bacteria | 15242 |
| 124 | Ga0157370_10058913 | 3300013104 | Bacteria | 3650 |
| 125 | Ga0157370_10175109 | 3300013104 | Bacteria | 1994 |
| 126 | Ga0157370_10179403 | 3300013104 | Bacteria | 1968 |
| 127 | Ga0157369_10039596 | 3300013105 | Bacteria | 5150 |
| 128 | Ga0157369_10052961 | 3300013105 | Bacteria | 4388 |
| 129 | Ga0157369_10103758 | 3300013105 | Unclassified | 3029 |
| 130 | Ga0157374_10000001 | 3300013296 | Bacteria | 1077351 |
| 131 | Ga0157374_10000084 | 3300013296 | Bacteria | 94138 |
| 132 | Ga0157378_10005892 | 3300013297 | Bacteria | 10736 |
| 133 | Ga0157378_10008288 | 3300013297 | Bacteria | 9058 |
| 134 | Ga0157378_10024961 | 3300013297 | Bacteria | 5264 |
| 135 | Ga0157378_10043377 | 3300013297 | Bacteria | 3993 |
| 136 | Ga0163162_10000113 | 3300013306 | Bacteria | 71491 |
| 137 | Ga0163162_10000158 | 3300013306 | Bacteria | 62514 |
| 138 | Ga0163162_10000524 | 3300013306 | Bacteria | 35554 |
| 139 | Ga0163162_10001883 | 3300013306 | Bacteria | 19750 |
| 140 | Ga0163162_10153960 | 3300013306 | Unclassified | 2418 |
| 141 | Ga0163162_10450686 | 3300013306 | Bacteria | 1419 |
| 142 | Ga0157372_10029138 | 3300013307 | Bacteria | 6025 |
| 143 | Ga0157372_10029638 | 3300013307 | Bacteria | 5978 |
| 144 | Ga0157372_10056101 | 3300013307 | Bacteria | 4402 |
| 145 | Ga0157372_10063274 | 3300013307 | Bacteria | 4148 |
| 146 | Ga0157372_10130495 | 3300013307 | Unclassified | 2891 |
| 147 | Ga0157372_10355060 | 3300013307 | Bacteria | 1708 |
| 148 | Ga0157372_10593447 | 3300013307 | Bacteria | 1291 |
| 149 | Ga0157375_10000228 | 3300013308 | Bacteria | 52278 |
| 150 | Ga0157375_10000565 | 3300013308 | Bacteria | 33320 |
| 151 | Ga0157375_10220246 | 3300013308 | Bacteria | 2056 |
| 152 | Ga0163163_10000332 | 3300014325 | Bacteria | 45415 |
| 153 | Ga0163163_10178023 | 3300014325 | Unclassified | 2174 |
| 154 | Ga0163163_10303270 | 3300014325 | Bacteria | 1650 |
| 155 | Ga0157379_10000245 | 3300014968 | Bacteria | 42570 |
| 156 | Ga0157379_10049824 | 3300014968 | Bacteria | 3739 |
| 157 | Ga0157379_10056817 | 3300014968 | Bacteria | 3497 |
| 158 | Ga0157376_10000439 | 3300014969 | Bacteria | 26775 |
| 159 | Ga0157376_10031731 | 3300014969 | Bacteria | 4235 |
| 160 | Ga0157376_10180706 | 3300014969 | Bacteria | 1928 |
| 161 | Ga0157376_10236303 | 3300014969 | Bacteria | 1700 |
| 162 | Ga0157376_10245881 | 3300014969 | Unclassified | 1669 |
| 163 | Ga0163161_10240942 | 3300017792 | Bacteria | 1406 |
| 164 | Ga0207426_1000002 | 3300025302 | Bacteria | 1249660 |
| 165 | Ga0207656_10011356 | 3300025321 | Bacteria | 3364 |
| 166 | Ga0207710_10109529 | 3300025900 | Bacteria | 1310 |
| 167 | Ga0207680_10000939 | 3300025903 | Bacteria | 13760 |
| 168 | Ga0207647_10202477 | 3300025904 | Bacteria | 1148 |
| 169 | Ga0207645_10000378 | 3300025907 | Bacteria | 36697 |
| 170 | Ga0207705_10000717 | 3300025909 | Bacteria | 27323 |
| 171 | Ga0207705_10064458 | 3300025909 | Bacteria | 2648 |
| 172 | Ga0207705_10138879 | 3300025909 | Bacteria | 1813 |
| 173 | Ga0207705_10189749 | 3300025909 | Bacteria | 1553 |
| 174 | Ga0207654_10019431 | 3300025911 | Bacteria | 3586 |
| 175 | Ga0207654_10103050 | 3300025911 | Bacteria | 1761 |
| 176 | Ga0207707_10020416 | 3300025912 | Bacteria | 5786 |
| 177 | Ga0207707_10042937 | 3300025912 | Bacteria | 3945 |
| 178 | Ga0207695_10000071 | 3300025913 | Bacteria | 315568 |
| 179 | Ga0207695_10000084 | 3300025913 | Bacteria | 282392 |
| 180 | Ga0207695_10000323 | 3300025913 | Bacteria | 114265 |
| 181 | Ga0207695_10028091 | 3300025913 | Bacteria | 6247 |
| 182 | Ga0207695_10035293 | 3300025913 | Bacteria | 5426 |
| 183 | Ga0207671_10039174 | 3300025914 | Bacteria | 3510 |
| 184 | Ga0207660_10012932 | 3300025917 | Bacteria | 5467 |
| 185 | Ga0207660_10064981 | 3300025917 | Bacteria | 2635 |
| 186 | Ga0207657_10006443 | 3300025919 | Bacteria | 12164 |
| 187 | Ga0207649_10083721 | 3300025920 | Bacteria | 2071 |
| 188 | Ga0207652_10000310 | 3300025921 | Bacteria | 50166 |
| 189 | Ga0207652_10000663 | 3300025921 | Bacteria | 33730 |
| 190 | Ga0207652_10000986 | 3300025921 | Bacteria | 26359 |
| 191 | Ga0207694_10045444 | 3300025924 | Bacteria | 3392 |
| 192 | Ga0207650_10112003 | 3300025925 | Unclassified | 2114 |
| 193 | Ga0207650_10271420 | 3300025925 | Unclassified | 1378 |
| 194 | Ga0207644_10018411 | 3300025931 | Bacteria | 4725 |
| 195 | Ga0207690_10029876 | 3300025932 | Bacteria | 3469 |
| 196 | Ga0207706_10010506 | 3300025933 | Bacteria | 8461 |
| 197 | Ga0207691_10000227 | 3300025940 | Bacteria | 54652 |
| 198 | Ga0207711_10037821 | 3300025941 | Bacteria | 4102 |
| 199 | Ga0207689_10034261 | 3300025942 | Bacteria | 4217 |
| 200 | Ga0207661_10014444 | 3300025944 | Bacteria | 5789 |
| 201 | Ga0207661_10037017 | 3300025944 | Unclassified | 3813 |
| 202 | Ga0207679_10379138 | 3300025945 | Unclassified | 1239 |
| 203 | Ga0207667_10000177 | 3300025949 | Bacteria | 92852 |
| 204 | Ga0207667_10000961 | 3300025949 | Bacteria | 36674 |
| 205 | Ga0207667_10023082 | 3300025949 | Bacteria | 6855 |
| 206 | Ga0207667_10029451 | 3300025949 | Bacteria | 5954 |
| 207 | Ga0207667_10270155 | 3300025949 | Bacteria | 1738 |
| 208 | Ga0207651_10001541 | 3300025960 | Bacteria | 10518 |
| 209 | Ga0207651_10033699 | 3300025960 | Bacteria | 3307 |
| 210 | Ga0207668_10000679 | 3300025972 | Bacteria | 20879 |
| 211 | Ga0207658_10000176 | 3300025986 | Bacteria | 68501 |
| 212 | Ga0207658_10038964 | 3300025986 | Bacteria | 3427 |
| 213 | Ga0207677_10044416 | 3300026023 | Bacteria | 2961 |
| 214 | Ga0207639_10017745 | 3300026041 | Bacteria | 5047 |
| 215 | Ga0207639_10022784 | 3300026041 | Bacteria | 4515 |
| 216 | Ga0207639_10037716 | 3300026041 | Unclassified | 3591 |
| 217 | Ga0207639_10040467 | 3300026041 | Bacteria | 3479 |
| 218 | Ga0207639_10103718 | 3300026041 | Unclassified | 2305 |
| 219 | Ga0207639_10129651 | 3300026041 | Bacteria | 2086 |
| 220 | Ga0207702_10056125 | 3300026078 | Bacteria | 3343 |
| 221 | Ga0207641_10002208 | 3300026088 | Bacteria | 18318 |
| 222 | Ga0207648_10068362 | 3300026089 | Bacteria | 3095 |
| 223 | Ga0207676_10001240 | 3300026095 | Bacteria | 18994 |
| 224 | Ga0207674_10029005 | 3300026116 | Bacteria | 5833 |
| 225 | Ga0207683_10190779 | 3300026121 | Bacteria | 1861 |
| 226 | Ga0207683_10247384 | 3300026121 | Bacteria | 1627 |
| 227 | Ga0207698_10040845 | 3300026142 | Bacteria | 3452 |
| 228 | Ga0207698_10114873 | 3300026142 | Bacteria | 2266 |
| 229 | Ga0268266_10003258 | 3300028379 | Bacteria | 16362 |
| 230 | Ga0268265_10134620 | 3300028380 | Bacteria | 2059 |
| 231 | Ga0268264_10002823 | 3300028381 | Bacteria | 15162 |
| 232 | Ga0268264_10003379 | 3300028381 | Bacteria | 13782 |
| 233 | Ga0307517_10002048 | 3300028786 | Bacteria | 32795 |
| 234 | Ga0307515_10000002 | 3300028794 | Bacteria | 1231751 |
| 235 | Ga0265324_10039644 | 3300029957 | Bacteria | 1633 |
| 236 | Ga0265327_10000168 | 3300031251 | Bacteria | 141392 |
| 237 | Ga0265327_10000531 | 3300031251 | Bacteria | 65562 |
| 238 | Ga0307509_10129941 | 3300031507 | Bacteria | 2476 |
| 239 | Ga0307510_10000091 | 3300033180 | Bacteria | 68694 |
| 240 | Ga0373955_0025758 | 3300035172 | Unclassified | 3024 |
| 241 | Ga0373937_0089974 | 3300036401 | Unclassified | 2843 |
| 242 | Ga0395899_0043717 | 3300037312 | Unclassified | 3340 |
| 243 | Ga0395899_0060713 | 3300037312 | Unclassified | 2785 |
| 244 | Ga0395899_0146339 | 3300037312 | Bacteria | 1677 |
| 245 | Ga0395900_0068663 | 3300037418 | Bacteria | 3642 |
| 246 | Ga0395900_0322939 | 3300037418 | Bacteria | 1523 |
| 247 | Ga0395900_0560242 | 3300037418 | Bacteria | 1086 |
| 248 | Ga0395898_0003075 | 3300037466 | Bacteria | 18917 |
| 249 | Ga0395898_0017027 | 3300037466 | Bacteria | 7422 |
| 250 | Ga0395898_0018423 | 3300037466 | Bacteria | 7119 |
| 251 | Ga0395905_0031389 | 3300037471 | Bacteria | 5001 |
| 252 | Ga0395905_0307627 | 3300037471 | Bacteria | 1473 |
| 253 | Ga0395901_0017067 | 3300038443 | Bacteria | 7400 |
| 254 | Ga0395901_0023200 | 3300038443 | Bacteria | 6360 |
| 255 | Ga0395901_0042564 | 3300038443 | Bacteria | 4709 |
| 256 | Ga0395901_0071643 | 3300038443 | Bacteria | 3612 |
| 257 | Ga0395901_0395889 | 3300038443 | Bacteria | 1419 |
| 258 | Ga0395901_0528323 | 3300038443 | Unclassified | 1198 |
| 259 | Ga0451841_0278047 | 3300041498 | Bacteria | 1517 |
| 260 | Ga0451853_3186503 | 3300041512 | Bacteria | 2368 |
| 261 | Ga0466972_0000003 | 3300044658 | Bacteria | 391452 |
| 262 | Ga0466970_0000561 | 3300044765 | Bacteria | 18151 |
| 263 | Ga0466957_0000070 | 3300044842 | Bacteria | 39824 |
| 264 | Ga0466960_0021765 | 3300044901 | Bacteria | 2859 |
| 265 | Ga0495580_0009622 | 3300046472 | Bacteria | 7590 |
| 266 | Ga0495582_0073752 | 3300046473 | Bacteria | 1889 |
| 267 | Ga0495606_0004249 | 3300046507 | Bacteria | 14482 |
| 268 | Ga0495630_0024597 | 3300046517 | Bacteria | 4451 |
| 269 | Ga0495668_0000562 | 3300046616 | Bacteria | 45637 |
| 270 | Ga0495668_0003561 | 3300046616 | Bacteria | 11572 |
| 271 | Ga0495611_0001562 | 3300046648 | Bacteria | 11215 |
| 272 | Ga0495670_0033006 | 3300046691 | Bacteria | 2575 |
| 273 | Ga0495674_0085779 | 3300047319 | Unclassified | 2697 |
| 274 | Ga0495674_0124150 | 3300047319 | Unclassified | 2179 |
| 275 | Ga0495672_0092573 | 3300047320 | Bacteria | 1657 |
| 276 | Ga0495686_0000004 | 3300047472 | Bacteria | 869019 |
| 277 | Ga0495686_0000616 | 3300047472 | Bacteria | 49206 |
| 278 | Ga0496101_0083838 | 3300048904 | Bacteria | 2360 |
| 279 | Ga0496109_0038819 | 3300048912 | Bacteria | 4307 |
| 280 | Ga0501033_0049182 | 3300049570 | Bacteria | 3130 |
| 281 | Ga0501034_0000225 | 3300049571 | Bacteria | 107163 |
| 282 | Ga0501034_0023947 | 3300049571 | Bacteria | 6213 |
| 283 | Ga0501034_0060159 | 3300049571 | Bacteria | 3816 |
| 284 | Ga0501219_000027 | 3300049703 | Bacteria | 23249 |
| 285 | Ga0501080_0236191 | 3300049742 | Bacteria | 1670 |
| 286 | Ga0501241_012647 | 3300049758 | Bacteria | 1534 |
| 287 | Ga0501269_007412 | 3300049766 | Bacteria | 1326 |
| 288 | Ga0501044_0019717 | 3300049823 | Bacteria | 7206 |
| 289 | Ga0501284_00021 | 3300050005 | Bacteria | 89729 |
| 290 | Ga0501284_00455 | 3300050005 | Bacteria | 2113 |
| 291 | nmdc:mga07m45_120762_c1 | 3300050496 | Bacteria | 1513 |
| 292 | nmdc:mga05p37_360908_c1 | 3300050507 | Bacteria | 1708 |
| 293 | nmdc:mga08y16_346230_c1 | 3300050511 | Bacteria | 1527 |
| 294 | Ga0500578_0244053 | 3300053086 | Bacteria | 1084 |
| 295 | Ga0500646_0012649 | 3300053090 | Bacteria | 2179 |
| 296 | Ga0500583_0114873 | 3300053092 | Bacteria | 1328 |
| 297 | Ga0500651_0140533 | 3300053093 | Bacteria | 1456 |
| 298 | Ga0500562_000138 | 3300053108 | Bacteria | 21490 |
| 299 | Ga0500642_0001877 | 3300053130 | Bacteria | 6071 |
| 300 | Ga0500652_066887 | 3300053131 | Bacteria | 1486 |
| 301 | Ga0500589_031388 | 3300053147 | Bacteria | 2475 |
| 302 | Ga0500604_0000265 | 3300053151 | Bacteria | 14657 |
| 303 | Ga0500616_0000314 | 3300053153 | Bacteria | 69589 |
| 304 | Ga0500622_0002452 | 3300053156 | Bacteria | 13375 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035172 | Ga0373955_0025758 | Ga0373955_0025758_2028_2981 | 315 |
| 2 | 3300037418 | Ga0395900_0560242 | Ga0395900_0560242_114_1076 | 318 |
| 3 | 3300050005 | Ga0501284_00455 | Ga0501284_00455_504_1493 | 323 |
| 4 | 3300013307 | Ga0157372_10130495 | Ga0157372_101304952 | 328 |
| 5 | 3300005337 | Ga0070682_100006926 | Ga0070682_1000069263 | 331 |
| 6 | 3300005341 | Ga0070691_10024793 | Ga0070691_100247932 | 331 |
| 7 | 3300005458 | Ga0070681_10075464 | Ga0070681_100754642 | 331 |
| 8 | 3300005539 | Ga0068853_100163082 | Ga0068853_1001630822 | 331 |
| 9 | 3300005563 | Ga0068855_100106056 | Ga0068855_1001060562 | 331 |
| 10 | 3300009093 | Ga0105240_10032774 | Ga0105240_100327745 | 331 |
| 11 | 3300009174 | Ga0105241_10027376 | Ga0105241_100273763 | 331 |
| 12 | 3300013104 | Ga0157370_10058913 | Ga0157370_100589132 | 331 |
| 13 | 3300025911 | Ga0207654_10019431 | Ga0207654_100194312 | 331 |
| 14 | 3300025912 | Ga0207707_10042937 | Ga0207707_100429372 | 331 |
| 15 | 3300025913 | Ga0207695_10035293 | Ga0207695_100352933 | 331 |
| 16 | 3300025917 | Ga0207660_10012932 | Ga0207660_100129322 | 331 |
| 17 | 3300025921 | Ga0207652_10000986 | Ga0207652_100009867 | 331 |
| 18 | 3300026041 | Ga0207639_10129651 | Ga0207639_101296512 | 331 |
| 19 | 3300046691 | Ga0495670_0033006 | Ga0495670_0033006_680_1684 | 332 |
| 20 | iso_pu_bacteria | 2881955468 | 2881956028 | 332 |
| 21 | 3300005327 | Ga0070658_10065296 | Ga0070658_100652962 | 335 |
| 22 | 3300025909 | Ga0207705_10189749 | Ga0207705_101897492 | 335 |
| 23 | iso_pu_bacteria | 2738541278 | 2738726363 | 335 |
| 24 | 3300006237 | Ga0097621_100003359 | Ga0097621_1000033592 | 336 |
| 25 | 3300006358 | Ga0068871_100002768 | Ga0068871_10000276810 | 336 |
| 26 | 3300013306 | Ga0163162_10001883 | Ga0163162_100018833 | 336 |
| 27 | 3300014969 | Ga0157376_10031731 | Ga0157376_100317314 | 336 |
| 28 | 3300014969 | Ga0157376_10236303 | Ga0157376_102363031 | 336 |
| 29 | 3300014969 | Ga0157376_10245881 | Ga0157376_102458812 | 336 |
| 30 | iso_pu_bacteria | 2914759650 | 2914762054 | 336 |
| 31 | 3300046616 | Ga0495668_0000562 | Ga0495668_0000562_3614_4627 | 337 |
| 32 | 3300049766 | Ga0501269_007412 | Ga0501269_007412_71_1084 | 337 |
| 33 | 3300053130 | Ga0500642_0001877 | Ga0500642_0001877_1163_2176 | 337 |
| 34 | 3300053153 | Ga0500616_0000314 | Ga0500616_0000314_60405_61418 | 337 |
| 35 | iso_pu_bacteria | 2818991444 | 2819590760 | 337 |
| 36 | iso_pu_bacteria | 2929154850 | 2929157783 | 337 |
| 37 | 3300005327 | Ga0070658_10044049 | Ga0070658_100440493 | 338 |
| 38 | 3300005530 | Ga0070679_100008640 | Ga0070679_1000086402 | 338 |
| 39 | 3300005616 | Ga0068852_100007216 | Ga0068852_1000072162 | 338 |
| 40 | 3300013102 | Ga0157371_10086315 | Ga0157371_100863152 | 338 |
| 41 | 3300049571 | Ga0501034_0000225 | Ga0501034_0000225_78560_79585 | 338 |
| 42 | 3300003322 | rootL2_10040257 | rootL2_100402576 | 339 |
| 43 | 3300003322 | rootL2_10178143 | rootL2_101781434 | 339 |
| 44 | 3300005331 | Ga0070670_100130473 | Ga0070670_1001304732 | 339 |
| 45 | 3300005354 | Ga0070675_100111266 | Ga0070675_1001112662 | 339 |
| 46 | 3300005355 | Ga0070671_100053386 | Ga0070671_1000533862 | 339 |
| 47 | 3300005364 | Ga0070673_100161929 | Ga0070673_1001619292 | 339 |
| 48 | 3300005367 | Ga0070667_100213179 | Ga0070667_1002131792 | 339 |
| 49 | 3300005456 | Ga0070678_100121924 | Ga0070678_1001219242 | 339 |
| 50 | 3300005563 | Ga0068855_100057611 | Ga0068855_1000576113 | 339 |
| 51 | 3300005616 | Ga0068852_100096249 | Ga0068852_1000962493 | 339 |
| 52 | 3300005843 | Ga0068860_100008577 | Ga0068860_1000085771 | 339 |
| 53 | 3300005844 | Ga0068862_100008092 | Ga0068862_1000080921 | 339 |
| 54 | 3300006237 | Ga0097621_100000063 | Ga0097621_10000006330 | 339 |
| 55 | 3300006358 | Ga0068871_100000952 | Ga0068871_1000009529 | 339 |
| 56 | 3300006847 | Ga0075431_100134086 | Ga0075431_1001340862 | 339 |
| 57 | 3300009094 | Ga0111539_10329600 | Ga0111539_103296002 | 339 |
| 58 | 3300009147 | Ga0114129_10229365 | Ga0114129_102293652 | 339 |
| 59 | 3300009174 | Ga0105241_10063567 | Ga0105241_100635672 | 339 |
| 60 | 3300009545 | Ga0105237_10094008 | Ga0105237_100940082 | 339 |
| 61 | 3300009553 | Ga0105249_10605706 | Ga0105249_106057062 | 339 |
| 62 | 3300013100 | Ga0157373_10016644 | Ga0157373_100166444 | 339 |
| 63 | 3300013297 | Ga0157378_10024961 | Ga0157378_100249612 | 339 |
| 64 | 3300013306 | Ga0163162_10000158 | Ga0163162_1000015824 | 339 |
| 65 | 3300013307 | Ga0157372_10355060 | Ga0157372_103550602 | 339 |
| 66 | 3300013307 | Ga0157372_10593447 | Ga0157372_105934472 | 339 |
| 67 | 3300013308 | Ga0157375_10000228 | Ga0157375_1000022824 | 339 |
| 68 | 3300014325 | Ga0163163_10303270 | Ga0163163_103032701 | 339 |
| 69 | 3300014968 | Ga0157379_10056817 | Ga0157379_100568173 | 339 |
| 70 | 3300014969 | Ga0157376_10000439 | Ga0157376_100004395 | 339 |
| 71 | 3300025909 | Ga0207705_10064458 | Ga0207705_100644582 | 339 |
| 72 | 3300025925 | Ga0207650_10112003 | Ga0207650_101120032 | 339 |
| 73 | 3300025931 | Ga0207644_10018411 | Ga0207644_100184114 | 339 |
| 74 | 3300025949 | Ga0207667_10023082 | Ga0207667_100230823 | 339 |
| 75 | 3300025986 | Ga0207658_10038964 | Ga0207658_100389643 | 339 |
| 76 | 3300026041 | Ga0207639_10040467 | Ga0207639_100404672 | 339 |
| 77 | 3300026121 | Ga0207683_10190779 | Ga0207683_101907792 | 339 |
| 78 | 3300026142 | Ga0207698_10040845 | Ga0207698_100408452 | 339 |
| 79 | 3300028380 | Ga0268265_10134620 | Ga0268265_101346201 | 339 |
| 80 | 3300041498 | Ga0451841_0278047 | Ga0451841_0278047_464_1483 | 339 |
| 81 | 3300041512 | Ga0451853_3186503 | Ga0451853_3186503_898_1917 | 339 |
| 82 | 3300044842 | Ga0466957_0000070 | Ga0466957_0000070_30774_31793 | 339 |
| 83 | 3300046616 | Ga0495668_0003561 | Ga0495668_0003561_1510_2529 | 339 |
| 84 | 3300048904 | Ga0496101_0083838 | Ga0496101_0083838_1061_2080 | 339 |
| 85 | 3300050507 | nmdc:mga05p37_360908_c1 | nmdc:mga05p37_360908_c1_19_1038 | 339 |
| 86 | 3300053086 | Ga0500578_0244053 | Ga0500578_0244053_17_1036 | 339 |
| 87 | 3300053090 | Ga0500646_0012649 | Ga0500646_0012649_446_1465 | 339 |
| 88 | 3300053092 | Ga0500583_0114873 | Ga0500583_0114873_129_1148 | 339 |
| 89 | 3300053093 | Ga0500651_0140533 | Ga0500651_0140533_55_1074 | 339 |
| 90 | 3300053131 | Ga0500652_066887 | Ga0500652_066887_293_1312 | 339 |
| 91 | 3300053147 | Ga0500589_031388 | Ga0500589_031388_1188_2207 | 339 |
| 92 | 3300053151 | Ga0500604_0000265 | Ga0500604_0000265_772_1791 | 339 |
| 93 | 3300005331 | Ga0070670_100110100 | Ga0070670_1001101001 | 340 |
| 94 | 3300005337 | Ga0070682_100000173 | Ga0070682_10000017340 | 340 |
| 95 | 3300005338 | Ga0068868_100112206 | Ga0068868_1001122061 | 340 |
| 96 | 3300005339 | Ga0070660_100039915 | Ga0070660_1000399152 | 340 |
| 97 | 3300005339 | Ga0070660_100305899 | Ga0070660_1003058991 | 340 |
| 98 | 3300005355 | Ga0070671_100249614 | Ga0070671_1002496142 | 340 |
| 99 | 3300005530 | Ga0070679_100040914 | Ga0070679_1000409143 | 340 |
| 100 | 3300005539 | Ga0068853_100025782 | Ga0068853_1000257822 | 340 |
| 101 | 3300005539 | Ga0068853_100051908 | Ga0068853_1000519082 | 340 |
| 102 | 3300005563 | Ga0068855_100036145 | Ga0068855_1000361452 | 340 |
| 103 | 3300005617 | Ga0068859_100001471 | Ga0068859_1000014719 | 340 |
| 104 | 3300005841 | Ga0068863_100236173 | Ga0068863_1002361732 | 340 |
| 105 | 3300006931 | Ga0097620_100001471 | Ga0097620_1000014719 | 340 |
| 106 | 3300009098 | Ga0105245_10322476 | Ga0105245_103224762 | 340 |
| 107 | 3300013100 | Ga0157373_10180080 | Ga0157373_101800802 | 340 |
| 108 | 3300013102 | Ga0157371_10008867 | Ga0157371_100088676 | 340 |
| 109 | 3300013102 | Ga0157371_10016690 | Ga0157371_100166903 | 340 |
| 110 | 3300013104 | Ga0157370_10004101 | Ga0157370_1000410111 | 340 |
| 111 | 3300013104 | Ga0157370_10004869 | Ga0157370_1000486913 | 340 |
| 112 | 3300013104 | Ga0157370_10175109 | Ga0157370_101751091 | 340 |
| 113 | 3300013105 | Ga0157369_10052961 | Ga0157369_100529613 | 340 |
| 114 | 3300013307 | Ga0157372_10029138 | Ga0157372_100291387 | 340 |
| 115 | 3300013307 | Ga0157372_10056101 | Ga0157372_100561014 | 340 |
| 116 | 3300025921 | Ga0207652_10000310 | Ga0207652_1000031021 | 340 |
| 117 | 3300025925 | Ga0207650_10271420 | Ga0207650_102714201 | 340 |
| 118 | 3300025949 | Ga0207667_10029451 | Ga0207667_100294514 | 340 |
| 119 | 3300026041 | Ga0207639_10022784 | Ga0207639_100227844 | 340 |
| 120 | 3300026041 | Ga0207639_10103718 | Ga0207639_101037182 | 340 |
| 121 | 3300028794 | Ga0307515_10000002 | Ga0307515_10000002501 | 340 |
| 122 | 3300031251 | Ga0265327_10000531 | Ga0265327_1000053146 | 340 |
| 123 | 3300037312 | Ga0395899_0060713 | Ga0395899_0060713_856_1899 | 340 |
| 124 | 3300037312 | Ga0395899_0146339 | Ga0395899_0146339_474_1517 | 340 |
| 125 | 3300037418 | Ga0395900_0322939 | Ga0395900_0322939_16_1059 | 340 |
| 126 | 3300037466 | Ga0395898_0003075 | Ga0395898_0003075_8725_9768 | 340 |
| 127 | 3300037466 | Ga0395898_0017027 | Ga0395898_0017027_1162_2205 | 340 |
| 128 | 3300037471 | Ga0395905_0307627 | Ga0395905_0307627_376_1419 | 340 |
| 129 | 3300038443 | Ga0395901_0023200 | Ga0395901_0023200_3640_4683 | 340 |
| 130 | 3300038443 | Ga0395901_0071643 | Ga0395901_0071643_1128_2171 | 340 |
| 131 | 3300038443 | Ga0395901_0395889 | Ga0395901_0395889_70_1113 | 340 |
| 132 | 3300038443 | Ga0395901_0528323 | Ga0395901_0528323_84_1127 | 340 |
| 133 | 3300047319 | Ga0495674_0085779 | Ga0495674_0085779_1385_2407 | 340 |
| 134 | 3300047320 | Ga0495672_0092573 | Ga0495672_0092573_222_1250 | 340 |
| 135 | 3300047472 | Ga0495686_0000616 | Ga0495686_0000616_20564_21586 | 340 |
| 136 | 3300049570 | Ga0501033_0049182 | Ga0501033_0049182_2029_3051 | 340 |
| 137 | 3300049571 | Ga0501034_0023947 | Ga0501034_0023947_3900_4922 | 340 |
| 138 | 3300049571 | Ga0501034_0060159 | Ga0501034_0060159_67_1089 | 340 |
| 139 | 3300049742 | Ga0501080_0236191 | Ga0501080_0236191_26_1048 | 340 |
| 140 | 3300049823 | Ga0501044_0019717 | Ga0501044_0019717_5104_6126 | 340 |
| 141 | 3300003323 | rootH1_10148467 | rootH1_101484673 | 341 |
| 142 | 3300003354 | JGI25160J50197_1000745 | JGI25160J50197_100074516 | 341 |
| 143 | 3300005327 | Ga0070658_10000095 | Ga0070658_1000009567 | 341 |
| 144 | 3300005329 | Ga0070683_100058804 | Ga0070683_1000588042 | 341 |
| 145 | 3300005335 | Ga0070666_10003710 | Ga0070666_100037104 | 341 |
| 146 | 3300005335 | Ga0070666_10005940 | Ga0070666_100059402 | 341 |
| 147 | 3300005336 | Ga0070680_100154434 | Ga0070680_1001544342 | 341 |
| 148 | 3300005337 | Ga0070682_100085816 | Ga0070682_1000858162 | 341 |
| 149 | 3300005339 | Ga0070660_100012793 | Ga0070660_1000127935 | 341 |
| 150 | 3300005344 | Ga0070661_100003273 | Ga0070661_10000327310 | 341 |
| 151 | 3300005347 | Ga0070668_100000043 | Ga0070668_10000004336 | 341 |
| 152 | 3300005354 | Ga0070675_100021470 | Ga0070675_1000214702 | 341 |
| 153 | 3300005355 | Ga0070671_100067864 | Ga0070671_1000678642 | 341 |
| 154 | 3300005364 | Ga0070673_100003480 | Ga0070673_1000034804 | 341 |
| 155 | 3300005364 | Ga0070673_100019594 | Ga0070673_1000195943 | 341 |
| 156 | 3300005367 | Ga0070667_100000254 | Ga0070667_10000025429 | 341 |
| 157 | 3300005455 | Ga0070663_100070734 | Ga0070663_1000707342 | 341 |
| 158 | 3300005458 | Ga0070681_10006155 | Ga0070681_100061552 | 341 |
| 159 | 3300005458 | Ga0070681_10163415 | Ga0070681_101634152 | 341 |
| 160 | 3300005458 | Ga0070681_10182064 | Ga0070681_101820641 | 341 |
| 161 | 3300005459 | Ga0068867_100351485 | Ga0068867_1003514852 | 341 |
| 162 | 3300005535 | Ga0070684_100003498 | Ga0070684_1000034983 | 341 |
| 163 | 3300005535 | Ga0070684_100046261 | Ga0070684_1000462612 | 341 |
| 164 | 3300005539 | Ga0068853_100015815 | Ga0068853_1000158152 | 341 |
| 165 | 3300005539 | Ga0068853_100069921 | Ga0068853_1000699212 | 341 |
| 166 | 3300005543 | Ga0070672_100004549 | Ga0070672_1000045496 | 341 |
| 167 | 3300005547 | Ga0070693_100113665 | Ga0070693_1001136652 | 341 |
| 168 | 3300005548 | Ga0070665_100000350 | Ga0070665_1000003504 | 341 |
| 169 | 3300005563 | Ga0068855_100000089 | Ga0068855_10000008929 | 341 |
| 170 | 3300005563 | Ga0068855_100003857 | Ga0068855_10000385719 | 341 |
| 171 | 3300005563 | Ga0068855_100014782 | Ga0068855_1000147825 | 341 |
| 172 | 3300005563 | Ga0068855_100033470 | Ga0068855_1000334705 | 341 |
| 173 | 3300005563 | Ga0068855_100225300 | Ga0068855_1002253002 | 341 |
| 174 | 3300005564 | Ga0070664_100005960 | Ga0070664_1000059603 | 341 |
| 175 | 3300005577 | Ga0068857_100032899 | Ga0068857_1000328993 | 341 |
| 176 | 3300005614 | Ga0068856_100010342 | Ga0068856_1000103428 | 341 |
| 177 | 3300005614 | Ga0068856_100057817 | Ga0068856_1000578174 | 341 |
| 178 | 3300005616 | Ga0068852_100009959 | Ga0068852_1000099596 | 341 |
| 179 | 3300005616 | Ga0068852_100289410 | Ga0068852_1002894102 | 341 |
| 180 | 3300005618 | Ga0068864_100001192 | Ga0068864_10000119216 | 341 |
| 181 | 3300005834 | Ga0068851_10012344 | Ga0068851_100123442 | 341 |
| 182 | 3300005841 | Ga0068863_100003656 | Ga0068863_10000365613 | 341 |
| 183 | 3300005842 | Ga0068858_100000199 | Ga0068858_10000019940 | 341 |
| 184 | 3300005843 | Ga0068860_100003203 | Ga0068860_10000320311 | 341 |
| 185 | 3300005843 | Ga0068860_100070685 | Ga0068860_1000706852 | 341 |
| 186 | 3300006237 | Ga0097621_100016337 | Ga0097621_1000163373 | 341 |
| 187 | 3300006358 | Ga0068871_100007723 | Ga0068871_1000077233 | 341 |
| 188 | 3300006358 | Ga0068871_100021180 | Ga0068871_1000211802 | 341 |
| 189 | 3300009093 | Ga0105240_10004146 | Ga0105240_1000414616 | 341 |
| 190 | 3300009093 | Ga0105240_10013673 | Ga0105240_100136739 | 341 |
| 191 | 3300009093 | Ga0105240_10014151 | Ga0105240_100141516 | 341 |
| 192 | 3300009093 | Ga0105240_10017976 | Ga0105240_100179763 | 341 |
| 193 | 3300009094 | Ga0111539_10227763 | Ga0111539_102277632 | 341 |
| 194 | 3300009098 | Ga0105245_10015578 | Ga0105245_100155786 | 341 |
| 195 | 3300009101 | Ga0105247_10127848 | Ga0105247_101278482 | 341 |
| 196 | 3300009174 | Ga0105241_10134229 | Ga0105241_101342292 | 341 |
| 197 | 3300009176 | Ga0105242_10316227 | Ga0105242_103162272 | 341 |
| 198 | 3300009177 | Ga0105248_10019350 | Ga0105248_100193504 | 341 |
| 199 | 3300009551 | Ga0105238_10033928 | Ga0105238_100339284 | 341 |
| 200 | 3300009553 | Ga0105249_10024983 | Ga0105249_100249833 | 341 |
| 201 | 3300010375 | Ga0105239_10000314 | Ga0105239_1000031455 | 341 |
| 202 | 3300010375 | Ga0105239_10079537 | Ga0105239_100795372 | 341 |
| 203 | 3300010375 | Ga0105239_10226745 | Ga0105239_102267452 | 341 |
| 204 | 3300013100 | Ga0157373_10056705 | Ga0157373_100567052 | 341 |
| 205 | 3300013104 | Ga0157370_10179403 | Ga0157370_101794032 | 341 |
| 206 | 3300013105 | Ga0157369_10039596 | Ga0157369_100395965 | 341 |
| 207 | 3300013105 | Ga0157369_10103758 | Ga0157369_101037583 | 341 |
| 208 | 3300013296 | Ga0157374_10000001 | Ga0157374_10000001248 | 341 |
| 209 | 3300013296 | Ga0157374_10000084 | Ga0157374_100000844 | 341 |
| 210 | 3300013297 | Ga0157378_10005892 | Ga0157378_100058923 | 341 |
| 211 | 3300013297 | Ga0157378_10008288 | Ga0157378_100082886 | 341 |
| 212 | 3300013306 | Ga0163162_10000113 | Ga0163162_1000011362 | 341 |
| 213 | 3300013306 | Ga0163162_10000524 | Ga0163162_100005243 | 341 |
| 214 | 3300013306 | Ga0163162_10153960 | Ga0163162_101539602 | 341 |
| 215 | 3300013306 | Ga0163162_10450686 | Ga0163162_104506862 | 341 |
| 216 | 3300013307 | Ga0157372_10029638 | Ga0157372_100296384 | 341 |
| 217 | 3300013307 | Ga0157372_10063274 | Ga0157372_100632743 | 341 |
| 218 | 3300013308 | Ga0157375_10000565 | Ga0157375_1000056529 | 341 |
| 219 | 3300013308 | Ga0157375_10220246 | Ga0157375_102202462 | 341 |
| 220 | 3300014325 | Ga0163163_10000332 | Ga0163163_1000033234 | 341 |
| 221 | 3300014325 | Ga0163163_10178023 | Ga0163163_101780232 | 341 |
| 222 | 3300014968 | Ga0157379_10000245 | Ga0157379_100002453 | 341 |
| 223 | 3300014968 | Ga0157379_10049824 | Ga0157379_100498243 | 341 |
| 224 | 3300014969 | Ga0157376_10180706 | Ga0157376_101807062 | 341 |
| 225 | 3300017792 | Ga0163161_10240942 | Ga0163161_102409422 | 341 |
| 226 | 3300025302 | Ga0207426_1000002 | Ga0207426_1000002793 | 341 |
| 227 | 3300025321 | Ga0207656_10011356 | Ga0207656_100113562 | 341 |
| 228 | 3300025900 | Ga0207710_10109529 | Ga0207710_101095291 | 341 |
| 229 | 3300025903 | Ga0207680_10000939 | Ga0207680_100009397 | 341 |
| 230 | 3300025904 | Ga0207647_10202477 | Ga0207647_102024771 | 341 |
| 231 | 3300025907 | Ga0207645_10000378 | Ga0207645_1000037824 | 341 |
| 232 | 3300025909 | Ga0207705_10000717 | Ga0207705_1000071714 | 341 |
| 233 | 3300025909 | Ga0207705_10138879 | Ga0207705_101388792 | 341 |
| 234 | 3300025911 | Ga0207654_10103050 | Ga0207654_101030503 | 341 |
| 235 | 3300025912 | Ga0207707_10020416 | Ga0207707_100204163 | 341 |
| 236 | 3300025913 | Ga0207695_10000071 | Ga0207695_10000071209 | 341 |
| 237 | 3300025913 | Ga0207695_10000084 | Ga0207695_10000084184 | 341 |
| 238 | 3300025913 | Ga0207695_10000323 | Ga0207695_1000032334 | 341 |
| 239 | 3300025913 | Ga0207695_10028091 | Ga0207695_100280916 | 341 |
| 240 | 3300025917 | Ga0207660_10064981 | Ga0207660_100649812 | 341 |
| 241 | 3300025919 | Ga0207657_10006443 | Ga0207657_100064433 | 341 |
| 242 | 3300025920 | Ga0207649_10083721 | Ga0207649_100837212 | 341 |
| 243 | 3300025921 | Ga0207652_10000663 | Ga0207652_1000066321 | 341 |
| 244 | 3300025924 | Ga0207694_10045444 | Ga0207694_100454444 | 341 |
| 245 | 3300025932 | Ga0207690_10029876 | Ga0207690_100298763 | 341 |
| 246 | 3300025933 | Ga0207706_10010506 | Ga0207706_100105062 | 341 |
| 247 | 3300025940 | Ga0207691_10000227 | Ga0207691_1000022729 | 341 |
| 248 | 3300025941 | Ga0207711_10037821 | Ga0207711_100378212 | 341 |
| 249 | 3300025942 | Ga0207689_10034261 | Ga0207689_100342612 | 341 |
| 250 | 3300025944 | Ga0207661_10014444 | Ga0207661_100144442 | 341 |
| 251 | 3300025944 | Ga0207661_10037017 | Ga0207661_100370172 | 341 |
| 252 | 3300025945 | Ga0207679_10379138 | Ga0207679_103791381 | 341 |
| 253 | 3300025949 | Ga0207667_10000177 | Ga0207667_1000017744 | 341 |
| 254 | 3300025949 | Ga0207667_10000961 | Ga0207667_1000096115 | 341 |
| 255 | 3300025949 | Ga0207667_10270155 | Ga0207667_102701552 | 341 |
| 256 | 3300025960 | Ga0207651_10001541 | Ga0207651_100015415 | 341 |
| 257 | 3300025960 | Ga0207651_10033699 | Ga0207651_100336991 | 341 |
| 258 | 3300025972 | Ga0207668_10000679 | Ga0207668_100006798 | 341 |
| 259 | 3300025986 | Ga0207658_10000176 | Ga0207658_1000017636 | 341 |
| 260 | 3300026023 | Ga0207677_10044416 | Ga0207677_100444162 | 341 |
| 261 | 3300026041 | Ga0207639_10017745 | Ga0207639_100177452 | 341 |
| 262 | 3300026041 | Ga0207639_10037716 | Ga0207639_100377163 | 341 |
| 263 | 3300026078 | Ga0207702_10056125 | Ga0207702_100561254 | 341 |
| 264 | 3300026088 | Ga0207641_10002208 | Ga0207641_1000220815 | 341 |
| 265 | 3300026089 | Ga0207648_10068362 | Ga0207648_100683623 | 341 |
| 266 | 3300026095 | Ga0207676_10001240 | Ga0207676_100012406 | 341 |
| 267 | 3300026116 | Ga0207674_10029005 | Ga0207674_100290052 | 341 |
| 268 | 3300026121 | Ga0207683_10247384 | Ga0207683_102473842 | 341 |
| 269 | 3300026142 | Ga0207698_10114873 | Ga0207698_101148732 | 341 |
| 270 | 3300028379 | Ga0268266_10003258 | Ga0268266_1000325814 | 341 |
| 271 | 3300028381 | Ga0268264_10002823 | Ga0268264_1000282314 | 341 |
| 272 | 3300028381 | Ga0268264_10003379 | Ga0268264_100033792 | 341 |
| 273 | 3300028786 | Ga0307517_10002048 | Ga0307517_1000204831 | 341 |
| 274 | 3300031251 | Ga0265327_10000168 | Ga0265327_10000168123 | 341 |
| 275 | 3300031507 | Ga0307509_10129941 | Ga0307509_101299412 | 341 |
| 276 | 3300033180 | Ga0307510_10000091 | Ga0307510_1000009157 | 341 |
| 277 | 3300036401 | Ga0373937_0089974 | Ga0373937_0089974_1365_2396 | 341 |
| 278 | 3300037312 | Ga0395899_0043717 | Ga0395899_0043717_1739_2800 | 341 |
| 279 | 3300037418 | Ga0395900_0068663 | Ga0395900_0068663_2489_3550 | 341 |
| 280 | 3300037466 | Ga0395898_0018423 | Ga0395898_0018423_1899_2960 | 341 |
| 281 | 3300037471 | Ga0395905_0031389 | Ga0395905_0031389_1397_2446 | 341 |
| 282 | 3300038443 | Ga0395901_0017067 | Ga0395901_0017067_2711_3772 | 341 |
| 283 | 3300038443 | Ga0395901_0042564 | Ga0395901_0042564_672_1721 | 341 |
| 284 | 3300044658 | Ga0466972_0000003 | Ga0466972_0000003_166737_167762 | 341 |
| 285 | 3300044765 | Ga0466970_0000561 | Ga0466970_0000561_4198_5223 | 341 |
| 286 | 3300044901 | Ga0466960_0021765 | Ga0466960_0021765_1254_2279 | 341 |
| 287 | 3300046472 | Ga0495580_0009622 | Ga0495580_0009622_4723_5754 | 341 |
| 288 | 3300046473 | Ga0495582_0073752 | Ga0495582_0073752_262_1293 | 341 |
| 289 | 3300046507 | Ga0495606_0004249 | Ga0495606_0004249_2007_3038 | 341 |
| 290 | 3300046517 | Ga0495630_0024597 | Ga0495630_0024597_2366_3397 | 341 |
| 291 | 3300046648 | Ga0495611_0001562 | Ga0495611_0001562_6231_7262 | 341 |
| 292 | 3300047319 | Ga0495674_0124150 | Ga0495674_0124150_685_1716 | 341 |
| 293 | 3300047472 | Ga0495686_0000004 | Ga0495686_0000004_385590_386621 | 341 |
| 294 | 3300048912 | Ga0496109_0038819 | Ga0496109_0038819_2440_3471 | 341 |
| 295 | 3300049703 | Ga0501219_000027 | Ga0501219_000027_12452_13477 | 341 |
| 296 | 3300049758 | Ga0501241_012647 | Ga0501241_012647_93_1118 | 341 |
| 297 | 3300050005 | Ga0501284_00021 | Ga0501284_00021_52196_53221 | 341 |
| 298 | 3300050511 | nmdc:mga08y16_346230_c1 | nmdc:mga08y16_346230_c1_47_1072 | 341 |
| 299 | 3300053108 | Ga0500562_000138 | Ga0500562_000138_8576_9601 | 341 |
| 300 | 3300053156 | Ga0500622_0002452 | Ga0500622_0002452_3745_4770 | 341 |
| 301 | 3300013297 | Ga0157378_10043377 | Ga0157378_100433773 | 342 |
| 302 | 3300050496 | nmdc:mga07m45_120762_c1 | nmdc:mga07m45_120762_c1_314_1354 | 346 |
| 303 | 3300029957 | Ga0265324_10039644 | Ga0265324_100396441 | 350 |
| 304 | 3300005985 | Ga0081539_10000037 | Ga0081539_1000003735 | 355 |
| 305 | 3300003203 | JGI25406J46586_10006981 | JGI25406J46586_100069814 | 356 |
| 306 | 3300001979 | JGI24740J21852_10017000 | JGI24740J21852_100170002 | 359 |
| 307 | 3300009545 | Ga0105237_10005745 | Ga0105237_100057459 | 359 |
| 308 | 3300010375 | Ga0105239_10022435 | Ga0105239_100224358 | 359 |
| 309 | 3300025914 | Ga0207671_10039174 | Ga0207671_100391745 | 359 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lk2-assembly2.cif.gz_B | crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid | 0.9271 | 18 | 355 |
| 3zok-assembly2.cif.gz_C | structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad | 0.9224 | 20 | 359 |
| 6lk2-assembly1.cif.gz_A | crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid | 0.9202 | 18 | 356 |
| 6lla-assembly1.cif.gz_A | crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and nad | 0.9129 | 19 | 359 |
| 1nvd-assembly1.cif.gz_B | crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate | 0.9116 | 38 | 354 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3clhB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9445 | 51 | 177 | 3.40.50.1970 |
| 1xahB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9065 | 20 | 177 | 3.40.50.1970 |
| 3qbdA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9039 | 18 | 177 | 3.40.50.1970 |
| 1nvaB02 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.8955 | 179 | 354 | 1.20.1090.10 |
| 3okfB02 | Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain | 0.8918 | 179 | 358 | 1.20.1090.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3D2XH27-F1-model_v4 | 3-dehydroquinate synthase | 0.9928 | 19 | 148 |
GO:0003856
|
| AF-A0A2W5F8Z3-F1-model_v4 | 3-dehydroquinate synthase (EC 4.2.3.4) | 0.9891 | 20 | 359 |
GO:0000166
GO:0003856 GO:0005737 GO:0008652 GO:0009073 GO:0009423 GO:0046872 |
| AF-A0A3D2XH27-F1-model_v4 | 3-dehydroquinate synthase | 0.9852 | 19 | 148 |
GO:0003856
|
| AF-A0A2W5F8Z3-F1-model_v4 | 3-dehydroquinate synthase (EC 4.2.3.4) | 0.9805 | 20 | 359 |
GO:0000166
GO:0003856 GO:0005737 GO:0008652 GO:0009073 GO:0009423 GO:0046872 |
| AF-A0A327QAN2-F1-model_v4 | 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4) | 0.9764 | 19 | 357 |
GO:0000166
GO:0003856 GO:0005737 GO:0008652 GO:0009073 GO:0009423 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar