F400061

General Info

Members Datasets Scaffolds Average Seq Length
309 171 304 343

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100249614|Ga0070671_1002496142
Length 366
Sequence LHIKKGFELAADARLFAPGGNAEGFTEMPVSAAIGNVSFYFDATFAELEQITSKEKTIILTDENIYELHQEKFAGYPVIQIAAGEQNKNQQTVDHIIGELIKLEAGKDSFLVGVGGGVVTDITGYVAAVYMRGVSFGLVPTSILCMVDAVIGGKNGIDVGMYKNMVGTIRQPEFIFYDYSFLKTLPVEEWVNGFAEIIKHACIKDAVMFATLERYSLHDFQADETLIAELIEKNVIIKASIVARDEFEKGERKLLNFGHTVGHAVENLHQLPHGHAISIGMAAACNLSEQIAGLHFDDAKKLVLLLSKYHLPVDLETDHEKVFAILRMDKKRTGDSVNFILINKIGNAFIHPIALTELHQHLKQIL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2818991444 Filimonas endophytica 3197 Isolate Unclassified
3 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
4 2914759650 Rhizosphaericola mali Isolate Rhizosphere
5 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
79 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
122 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
133 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
147 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
155 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
158 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
159 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
162 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
163 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
168 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
169 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
170 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
171 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 0
Isolates 1.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.53
Nodule 0
Rhizoplane 0.65
Rhizosphere 90.94
Stem 0
Stem Tuber 0
Unclassified 3.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017000 3300001979 Bacteria 2612
2 JGI25406J46586_10006981 3300003203 Bacteria 5183
3 rootL2_10040257 3300003322 Bacteria 5357
4 rootL2_10178143 3300003322 Bacteria 7160
5 rootH1_10148467 3300003323 Unclassified 3072
6 JGI25160J50197_1000745 3300003354 Bacteria 17705
7 Ga0070658_10000095 3300005327 Bacteria 77839
8 Ga0070658_10044049 3300005327 Bacteria 3605
9 Ga0070658_10065296 3300005327 Bacteria 2970
10 Ga0070683_100058804 3300005329 Bacteria 3571
11 Ga0070670_100110100 3300005331 Unclassified 2373
12 Ga0070670_100130473 3300005331 Unclassified 2170
13 Ga0070666_10003710 3300005335 Bacteria 9255
14 Ga0070666_10005940 3300005335 Bacteria 7494
15 Ga0070680_100154434 3300005336 Unclassified 1928
16 Ga0070682_100000173 3300005337 Bacteria 47981
17 Ga0070682_100006926 3300005337 Bacteria 6371
18 Ga0070682_100085816 3300005337 Bacteria 2049
19 Ga0068868_100112206 3300005338 Bacteria 2216
20 Ga0070660_100012793 3300005339 Bacteria 6000
21 Ga0070660_100039915 3300005339 Bacteria 3569
22 Ga0070660_100305899 3300005339 Bacteria 1304
23 Ga0070691_10024793 3300005341 Bacteria 2790
24 Ga0070661_100003273 3300005344 Bacteria 11185
25 Ga0070668_100000043 3300005347 Bacteria 78564
26 Ga0070675_100021470 3300005354 Bacteria 5160
27 Ga0070675_100111266 3300005354 Bacteria 2317
28 Ga0070671_100053386 3300005355 Bacteria 3360
29 Ga0070671_100067864 3300005355 Bacteria 2974
30 Ga0070671_100249614 3300005355 Bacteria 1507
31 Ga0070673_100003480 3300005364 Bacteria 9802
32 Ga0070673_100019594 3300005364 Bacteria 4860
33 Ga0070673_100161929 3300005364 Unclassified 1903
34 Ga0070667_100000254 3300005367 Bacteria 60664
35 Ga0070667_100213179 3300005367 Bacteria 1717
36 Ga0070663_100070734 3300005455 Bacteria 2538
37 Ga0070678_100121924 3300005456 Bacteria 2057
38 Ga0070681_10006155 3300005458 Bacteria 11657
39 Ga0070681_10075464 3300005458 Bacteria 3331
40 Ga0070681_10163415 3300005458 Bacteria 2150
41 Ga0070681_10182064 3300005458 Unclassified 2022
42 Ga0068867_100351485 3300005459 Bacteria 1230
43 Ga0070679_100008640 3300005530 Bacteria 9598
44 Ga0070679_100040914 3300005530 Bacteria 4612
45 Ga0070684_100003498 3300005535 Bacteria 11793
46 Ga0070684_100046261 3300005535 Bacteria 3770
47 Ga0068853_100015815 3300005539 Bacteria 6196
48 Ga0068853_100025782 3300005539 Bacteria 4935
49 Ga0068853_100051908 3300005539 Unclassified 3531
50 Ga0068853_100069921 3300005539 Unclassified 3055
51 Ga0068853_100163082 3300005539 Unclassified 2012
52 Ga0070672_100004549 3300005543 Bacteria 9081
53 Ga0070693_100113665 3300005547 Bacteria 1669
54 Ga0070665_100000350 3300005548 Bacteria 69455
55 Ga0068855_100000089 3300005563 Bacteria 110845
56 Ga0068855_100003857 3300005563 Bacteria 18329
57 Ga0068855_100014782 3300005563 Bacteria 9401
58 Ga0068855_100033470 3300005563 Bacteria 6133
59 Ga0068855_100036145 3300005563 Bacteria 5881
60 Ga0068855_100057611 3300005563 Bacteria 4553
61 Ga0068855_100106056 3300005563 Bacteria 3230
62 Ga0068855_100225300 3300005563 Bacteria 2101
63 Ga0070664_100005960 3300005564 Bacteria 9850
64 Ga0068857_100032899 3300005577 Bacteria 4584
65 Ga0068856_100010342 3300005614 Bacteria 9064
66 Ga0068856_100057817 3300005614 Bacteria 3829
67 Ga0068852_100007216 3300005616 Bacteria 8104
68 Ga0068852_100009959 3300005616 Bacteria 7072
69 Ga0068852_100096249 3300005616 Bacteria 2660
70 Ga0068852_100289410 3300005616 Unclassified 1582
71 Ga0068859_100001471 3300005617 Bacteria 24005
72 Ga0068864_100001192 3300005618 Bacteria 21573
73 Ga0068851_10012344 3300005834 Bacteria 4025
74 Ga0068863_100003656 3300005841 Bacteria 15182
75 Ga0068863_100236173 3300005841 Unclassified 1764
76 Ga0068858_100000199 3300005842 Bacteria 64607
77 Ga0068860_100003203 3300005843 Bacteria 16892
78 Ga0068860_100008577 3300005843 Bacteria 10189
79 Ga0068860_100070685 3300005843 Bacteria 3318
80 Ga0068862_100008092 3300005844 Bacteria 8701
81 Ga0081539_10000037 3300005985 Bacteria 296160
82 Ga0097621_100000063 3300006237 Bacteria 55571
83 Ga0097621_100003359 3300006237 Bacteria 11008
84 Ga0097621_100016337 3300006237 Bacteria 5609
85 Ga0068871_100000952 3300006358 Bacteria 19348
86 Ga0068871_100002768 3300006358 Bacteria 11972
87 Ga0068871_100007723 3300006358 Bacteria 7699
88 Ga0068871_100021180 3300006358 Bacteria 4993
89 Ga0075431_100134086 3300006847 Bacteria 2553
90 Ga0097620_100001471 3300006931 Bacteria 24005
91 Ga0105240_10004146 3300009093 Bacteria 22202
92 Ga0105240_10013673 3300009093 Bacteria 11131
93 Ga0105240_10014151 3300009093 Bacteria 10899
94 Ga0105240_10017976 3300009093 Bacteria 9512
95 Ga0105240_10032774 3300009093 Bacteria 6721
96 Ga0111539_10227763 3300009094 Bacteria 2171
97 Ga0111539_10329600 3300009094 Bacteria 1777
98 Ga0105245_10015578 3300009098 Bacteria 6630
99 Ga0105245_10322476 3300009098 Bacteria 1522
100 Ga0105247_10127848 3300009101 Bacteria 1653
101 Ga0114129_10229365 3300009147 Bacteria 2502
102 Ga0105241_10027376 3300009174 Bacteria 4245
103 Ga0105241_10063567 3300009174 Bacteria 2848
104 Ga0105241_10134229 3300009174 Bacteria 2007
105 Ga0105242_10316227 3300009176 Bacteria 1430
106 Ga0105248_10019350 3300009177 Bacteria 7533
107 Ga0105237_10005745 3300009545 Bacteria 13938
108 Ga0105237_10094008 3300009545 Bacteria 2987
109 Ga0105238_10033928 3300009551 Bacteria 5193
110 Ga0105249_10024983 3300009553 Bacteria 5375
111 Ga0105249_10605706 3300009553 Bacteria 1150
112 Ga0105239_10000314 3300010375 Bacteria 71313
113 Ga0105239_10022435 3300010375 Bacteria 6959
114 Ga0105239_10079537 3300010375 Bacteria 3607
115 Ga0105239_10226745 3300010375 Bacteria 2096
116 Ga0157373_10016644 3300013100 Bacteria 5359
117 Ga0157373_10056705 3300013100 Bacteria 2781
118 Ga0157373_10180080 3300013100 Unclassified 1488
119 Ga0157371_10008867 3300013102 Bacteria 7964
120 Ga0157371_10016690 3300013102 Bacteria 5471
121 Ga0157371_10086315 3300013102 Bacteria 2223
122 Ga0157370_10004101 3300013104 Bacteria 16888
123 Ga0157370_10004869 3300013104 Bacteria 15242
124 Ga0157370_10058913 3300013104 Bacteria 3650
125 Ga0157370_10175109 3300013104 Bacteria 1994
126 Ga0157370_10179403 3300013104 Bacteria 1968
127 Ga0157369_10039596 3300013105 Bacteria 5150
128 Ga0157369_10052961 3300013105 Bacteria 4388
129 Ga0157369_10103758 3300013105 Unclassified 3029
130 Ga0157374_10000001 3300013296 Bacteria 1077351
131 Ga0157374_10000084 3300013296 Bacteria 94138
132 Ga0157378_10005892 3300013297 Bacteria 10736
133 Ga0157378_10008288 3300013297 Bacteria 9058
134 Ga0157378_10024961 3300013297 Bacteria 5264
135 Ga0157378_10043377 3300013297 Bacteria 3993
136 Ga0163162_10000113 3300013306 Bacteria 71491
137 Ga0163162_10000158 3300013306 Bacteria 62514
138 Ga0163162_10000524 3300013306 Bacteria 35554
139 Ga0163162_10001883 3300013306 Bacteria 19750
140 Ga0163162_10153960 3300013306 Unclassified 2418
141 Ga0163162_10450686 3300013306 Bacteria 1419
142 Ga0157372_10029138 3300013307 Bacteria 6025
143 Ga0157372_10029638 3300013307 Bacteria 5978
144 Ga0157372_10056101 3300013307 Bacteria 4402
145 Ga0157372_10063274 3300013307 Bacteria 4148
146 Ga0157372_10130495 3300013307 Unclassified 2891
147 Ga0157372_10355060 3300013307 Bacteria 1708
148 Ga0157372_10593447 3300013307 Bacteria 1291
149 Ga0157375_10000228 3300013308 Bacteria 52278
150 Ga0157375_10000565 3300013308 Bacteria 33320
151 Ga0157375_10220246 3300013308 Bacteria 2056
152 Ga0163163_10000332 3300014325 Bacteria 45415
153 Ga0163163_10178023 3300014325 Unclassified 2174
154 Ga0163163_10303270 3300014325 Bacteria 1650
155 Ga0157379_10000245 3300014968 Bacteria 42570
156 Ga0157379_10049824 3300014968 Bacteria 3739
157 Ga0157379_10056817 3300014968 Bacteria 3497
158 Ga0157376_10000439 3300014969 Bacteria 26775
159 Ga0157376_10031731 3300014969 Bacteria 4235
160 Ga0157376_10180706 3300014969 Bacteria 1928
161 Ga0157376_10236303 3300014969 Bacteria 1700
162 Ga0157376_10245881 3300014969 Unclassified 1669
163 Ga0163161_10240942 3300017792 Bacteria 1406
164 Ga0207426_1000002 3300025302 Bacteria 1249660
165 Ga0207656_10011356 3300025321 Bacteria 3364
166 Ga0207710_10109529 3300025900 Bacteria 1310
167 Ga0207680_10000939 3300025903 Bacteria 13760
168 Ga0207647_10202477 3300025904 Bacteria 1148
169 Ga0207645_10000378 3300025907 Bacteria 36697
170 Ga0207705_10000717 3300025909 Bacteria 27323
171 Ga0207705_10064458 3300025909 Bacteria 2648
172 Ga0207705_10138879 3300025909 Bacteria 1813
173 Ga0207705_10189749 3300025909 Bacteria 1553
174 Ga0207654_10019431 3300025911 Bacteria 3586
175 Ga0207654_10103050 3300025911 Bacteria 1761
176 Ga0207707_10020416 3300025912 Bacteria 5786
177 Ga0207707_10042937 3300025912 Bacteria 3945
178 Ga0207695_10000071 3300025913 Bacteria 315568
179 Ga0207695_10000084 3300025913 Bacteria 282392
180 Ga0207695_10000323 3300025913 Bacteria 114265
181 Ga0207695_10028091 3300025913 Bacteria 6247
182 Ga0207695_10035293 3300025913 Bacteria 5426
183 Ga0207671_10039174 3300025914 Bacteria 3510
184 Ga0207660_10012932 3300025917 Bacteria 5467
185 Ga0207660_10064981 3300025917 Bacteria 2635
186 Ga0207657_10006443 3300025919 Bacteria 12164
187 Ga0207649_10083721 3300025920 Bacteria 2071
188 Ga0207652_10000310 3300025921 Bacteria 50166
189 Ga0207652_10000663 3300025921 Bacteria 33730
190 Ga0207652_10000986 3300025921 Bacteria 26359
191 Ga0207694_10045444 3300025924 Bacteria 3392
192 Ga0207650_10112003 3300025925 Unclassified 2114
193 Ga0207650_10271420 3300025925 Unclassified 1378
194 Ga0207644_10018411 3300025931 Bacteria 4725
195 Ga0207690_10029876 3300025932 Bacteria 3469
196 Ga0207706_10010506 3300025933 Bacteria 8461
197 Ga0207691_10000227 3300025940 Bacteria 54652
198 Ga0207711_10037821 3300025941 Bacteria 4102
199 Ga0207689_10034261 3300025942 Bacteria 4217
200 Ga0207661_10014444 3300025944 Bacteria 5789
201 Ga0207661_10037017 3300025944 Unclassified 3813
202 Ga0207679_10379138 3300025945 Unclassified 1239
203 Ga0207667_10000177 3300025949 Bacteria 92852
204 Ga0207667_10000961 3300025949 Bacteria 36674
205 Ga0207667_10023082 3300025949 Bacteria 6855
206 Ga0207667_10029451 3300025949 Bacteria 5954
207 Ga0207667_10270155 3300025949 Bacteria 1738
208 Ga0207651_10001541 3300025960 Bacteria 10518
209 Ga0207651_10033699 3300025960 Bacteria 3307
210 Ga0207668_10000679 3300025972 Bacteria 20879
211 Ga0207658_10000176 3300025986 Bacteria 68501
212 Ga0207658_10038964 3300025986 Bacteria 3427
213 Ga0207677_10044416 3300026023 Bacteria 2961
214 Ga0207639_10017745 3300026041 Bacteria 5047
215 Ga0207639_10022784 3300026041 Bacteria 4515
216 Ga0207639_10037716 3300026041 Unclassified 3591
217 Ga0207639_10040467 3300026041 Bacteria 3479
218 Ga0207639_10103718 3300026041 Unclassified 2305
219 Ga0207639_10129651 3300026041 Bacteria 2086
220 Ga0207702_10056125 3300026078 Bacteria 3343
221 Ga0207641_10002208 3300026088 Bacteria 18318
222 Ga0207648_10068362 3300026089 Bacteria 3095
223 Ga0207676_10001240 3300026095 Bacteria 18994
224 Ga0207674_10029005 3300026116 Bacteria 5833
225 Ga0207683_10190779 3300026121 Bacteria 1861
226 Ga0207683_10247384 3300026121 Bacteria 1627
227 Ga0207698_10040845 3300026142 Bacteria 3452
228 Ga0207698_10114873 3300026142 Bacteria 2266
229 Ga0268266_10003258 3300028379 Bacteria 16362
230 Ga0268265_10134620 3300028380 Bacteria 2059
231 Ga0268264_10002823 3300028381 Bacteria 15162
232 Ga0268264_10003379 3300028381 Bacteria 13782
233 Ga0307517_10002048 3300028786 Bacteria 32795
234 Ga0307515_10000002 3300028794 Bacteria 1231751
235 Ga0265324_10039644 3300029957 Bacteria 1633
236 Ga0265327_10000168 3300031251 Bacteria 141392
237 Ga0265327_10000531 3300031251 Bacteria 65562
238 Ga0307509_10129941 3300031507 Bacteria 2476
239 Ga0307510_10000091 3300033180 Bacteria 68694
240 Ga0373955_0025758 3300035172 Unclassified 3024
241 Ga0373937_0089974 3300036401 Unclassified 2843
242 Ga0395899_0043717 3300037312 Unclassified 3340
243 Ga0395899_0060713 3300037312 Unclassified 2785
244 Ga0395899_0146339 3300037312 Bacteria 1677
245 Ga0395900_0068663 3300037418 Bacteria 3642
246 Ga0395900_0322939 3300037418 Bacteria 1523
247 Ga0395900_0560242 3300037418 Bacteria 1086
248 Ga0395898_0003075 3300037466 Bacteria 18917
249 Ga0395898_0017027 3300037466 Bacteria 7422
250 Ga0395898_0018423 3300037466 Bacteria 7119
251 Ga0395905_0031389 3300037471 Bacteria 5001
252 Ga0395905_0307627 3300037471 Bacteria 1473
253 Ga0395901_0017067 3300038443 Bacteria 7400
254 Ga0395901_0023200 3300038443 Bacteria 6360
255 Ga0395901_0042564 3300038443 Bacteria 4709
256 Ga0395901_0071643 3300038443 Bacteria 3612
257 Ga0395901_0395889 3300038443 Bacteria 1419
258 Ga0395901_0528323 3300038443 Unclassified 1198
259 Ga0451841_0278047 3300041498 Bacteria 1517
260 Ga0451853_3186503 3300041512 Bacteria 2368
261 Ga0466972_0000003 3300044658 Bacteria 391452
262 Ga0466970_0000561 3300044765 Bacteria 18151
263 Ga0466957_0000070 3300044842 Bacteria 39824
264 Ga0466960_0021765 3300044901 Bacteria 2859
265 Ga0495580_0009622 3300046472 Bacteria 7590
266 Ga0495582_0073752 3300046473 Bacteria 1889
267 Ga0495606_0004249 3300046507 Bacteria 14482
268 Ga0495630_0024597 3300046517 Bacteria 4451
269 Ga0495668_0000562 3300046616 Bacteria 45637
270 Ga0495668_0003561 3300046616 Bacteria 11572
271 Ga0495611_0001562 3300046648 Bacteria 11215
272 Ga0495670_0033006 3300046691 Bacteria 2575
273 Ga0495674_0085779 3300047319 Unclassified 2697
274 Ga0495674_0124150 3300047319 Unclassified 2179
275 Ga0495672_0092573 3300047320 Bacteria 1657
276 Ga0495686_0000004 3300047472 Bacteria 869019
277 Ga0495686_0000616 3300047472 Bacteria 49206
278 Ga0496101_0083838 3300048904 Bacteria 2360
279 Ga0496109_0038819 3300048912 Bacteria 4307
280 Ga0501033_0049182 3300049570 Bacteria 3130
281 Ga0501034_0000225 3300049571 Bacteria 107163
282 Ga0501034_0023947 3300049571 Bacteria 6213
283 Ga0501034_0060159 3300049571 Bacteria 3816
284 Ga0501219_000027 3300049703 Bacteria 23249
285 Ga0501080_0236191 3300049742 Bacteria 1670
286 Ga0501241_012647 3300049758 Bacteria 1534
287 Ga0501269_007412 3300049766 Bacteria 1326
288 Ga0501044_0019717 3300049823 Bacteria 7206
289 Ga0501284_00021 3300050005 Bacteria 89729
290 Ga0501284_00455 3300050005 Bacteria 2113
291 nmdc:mga07m45_120762_c1 3300050496 Bacteria 1513
292 nmdc:mga05p37_360908_c1 3300050507 Bacteria 1708
293 nmdc:mga08y16_346230_c1 3300050511 Bacteria 1527
294 Ga0500578_0244053 3300053086 Bacteria 1084
295 Ga0500646_0012649 3300053090 Bacteria 2179
296 Ga0500583_0114873 3300053092 Bacteria 1328
297 Ga0500651_0140533 3300053093 Bacteria 1456
298 Ga0500562_000138 3300053108 Bacteria 21490
299 Ga0500642_0001877 3300053130 Bacteria 6071
300 Ga0500652_066887 3300053131 Bacteria 1486
301 Ga0500589_031388 3300053147 Bacteria 2475
302 Ga0500604_0000265 3300053151 Bacteria 14657
303 Ga0500616_0000314 3300053153 Bacteria 69589
304 Ga0500622_0002452 3300053156 Bacteria 13375

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035172 Ga0373955_0025758 Ga0373955_0025758_2028_2981 315
2 3300037418 Ga0395900_0560242 Ga0395900_0560242_114_1076 318
3 3300050005 Ga0501284_00455 Ga0501284_00455_504_1493 323
4 3300013307 Ga0157372_10130495 Ga0157372_101304952 328
5 3300005337 Ga0070682_100006926 Ga0070682_1000069263 331
6 3300005341 Ga0070691_10024793 Ga0070691_100247932 331
7 3300005458 Ga0070681_10075464 Ga0070681_100754642 331
8 3300005539 Ga0068853_100163082 Ga0068853_1001630822 331
9 3300005563 Ga0068855_100106056 Ga0068855_1001060562 331
10 3300009093 Ga0105240_10032774 Ga0105240_100327745 331
11 3300009174 Ga0105241_10027376 Ga0105241_100273763 331
12 3300013104 Ga0157370_10058913 Ga0157370_100589132 331
13 3300025911 Ga0207654_10019431 Ga0207654_100194312 331
14 3300025912 Ga0207707_10042937 Ga0207707_100429372 331
15 3300025913 Ga0207695_10035293 Ga0207695_100352933 331
16 3300025917 Ga0207660_10012932 Ga0207660_100129322 331
17 3300025921 Ga0207652_10000986 Ga0207652_100009867 331
18 3300026041 Ga0207639_10129651 Ga0207639_101296512 331
19 3300046691 Ga0495670_0033006 Ga0495670_0033006_680_1684 332
20 iso_pu_bacteria 2881955468 2881956028 332
21 3300005327 Ga0070658_10065296 Ga0070658_100652962 335
22 3300025909 Ga0207705_10189749 Ga0207705_101897492 335
23 iso_pu_bacteria 2738541278 2738726363 335
24 3300006237 Ga0097621_100003359 Ga0097621_1000033592 336
25 3300006358 Ga0068871_100002768 Ga0068871_10000276810 336
26 3300013306 Ga0163162_10001883 Ga0163162_100018833 336
27 3300014969 Ga0157376_10031731 Ga0157376_100317314 336
28 3300014969 Ga0157376_10236303 Ga0157376_102363031 336
29 3300014969 Ga0157376_10245881 Ga0157376_102458812 336
30 iso_pu_bacteria 2914759650 2914762054 336
31 3300046616 Ga0495668_0000562 Ga0495668_0000562_3614_4627 337
32 3300049766 Ga0501269_007412 Ga0501269_007412_71_1084 337
33 3300053130 Ga0500642_0001877 Ga0500642_0001877_1163_2176 337
34 3300053153 Ga0500616_0000314 Ga0500616_0000314_60405_61418 337
35 iso_pu_bacteria 2818991444 2819590760 337
36 iso_pu_bacteria 2929154850 2929157783 337
37 3300005327 Ga0070658_10044049 Ga0070658_100440493 338
38 3300005530 Ga0070679_100008640 Ga0070679_1000086402 338
39 3300005616 Ga0068852_100007216 Ga0068852_1000072162 338
40 3300013102 Ga0157371_10086315 Ga0157371_100863152 338
41 3300049571 Ga0501034_0000225 Ga0501034_0000225_78560_79585 338
42 3300003322 rootL2_10040257 rootL2_100402576 339
43 3300003322 rootL2_10178143 rootL2_101781434 339
44 3300005331 Ga0070670_100130473 Ga0070670_1001304732 339
45 3300005354 Ga0070675_100111266 Ga0070675_1001112662 339
46 3300005355 Ga0070671_100053386 Ga0070671_1000533862 339
47 3300005364 Ga0070673_100161929 Ga0070673_1001619292 339
48 3300005367 Ga0070667_100213179 Ga0070667_1002131792 339
49 3300005456 Ga0070678_100121924 Ga0070678_1001219242 339
50 3300005563 Ga0068855_100057611 Ga0068855_1000576113 339
51 3300005616 Ga0068852_100096249 Ga0068852_1000962493 339
52 3300005843 Ga0068860_100008577 Ga0068860_1000085771 339
53 3300005844 Ga0068862_100008092 Ga0068862_1000080921 339
54 3300006237 Ga0097621_100000063 Ga0097621_10000006330 339
55 3300006358 Ga0068871_100000952 Ga0068871_1000009529 339
56 3300006847 Ga0075431_100134086 Ga0075431_1001340862 339
57 3300009094 Ga0111539_10329600 Ga0111539_103296002 339
58 3300009147 Ga0114129_10229365 Ga0114129_102293652 339
59 3300009174 Ga0105241_10063567 Ga0105241_100635672 339
60 3300009545 Ga0105237_10094008 Ga0105237_100940082 339
61 3300009553 Ga0105249_10605706 Ga0105249_106057062 339
62 3300013100 Ga0157373_10016644 Ga0157373_100166444 339
63 3300013297 Ga0157378_10024961 Ga0157378_100249612 339
64 3300013306 Ga0163162_10000158 Ga0163162_1000015824 339
65 3300013307 Ga0157372_10355060 Ga0157372_103550602 339
66 3300013307 Ga0157372_10593447 Ga0157372_105934472 339
67 3300013308 Ga0157375_10000228 Ga0157375_1000022824 339
68 3300014325 Ga0163163_10303270 Ga0163163_103032701 339
69 3300014968 Ga0157379_10056817 Ga0157379_100568173 339
70 3300014969 Ga0157376_10000439 Ga0157376_100004395 339
71 3300025909 Ga0207705_10064458 Ga0207705_100644582 339
72 3300025925 Ga0207650_10112003 Ga0207650_101120032 339
73 3300025931 Ga0207644_10018411 Ga0207644_100184114 339
74 3300025949 Ga0207667_10023082 Ga0207667_100230823 339
75 3300025986 Ga0207658_10038964 Ga0207658_100389643 339
76 3300026041 Ga0207639_10040467 Ga0207639_100404672 339
77 3300026121 Ga0207683_10190779 Ga0207683_101907792 339
78 3300026142 Ga0207698_10040845 Ga0207698_100408452 339
79 3300028380 Ga0268265_10134620 Ga0268265_101346201 339
80 3300041498 Ga0451841_0278047 Ga0451841_0278047_464_1483 339
81 3300041512 Ga0451853_3186503 Ga0451853_3186503_898_1917 339
82 3300044842 Ga0466957_0000070 Ga0466957_0000070_30774_31793 339
83 3300046616 Ga0495668_0003561 Ga0495668_0003561_1510_2529 339
84 3300048904 Ga0496101_0083838 Ga0496101_0083838_1061_2080 339
85 3300050507 nmdc:mga05p37_360908_c1 nmdc:mga05p37_360908_c1_19_1038 339
86 3300053086 Ga0500578_0244053 Ga0500578_0244053_17_1036 339
87 3300053090 Ga0500646_0012649 Ga0500646_0012649_446_1465 339
88 3300053092 Ga0500583_0114873 Ga0500583_0114873_129_1148 339
89 3300053093 Ga0500651_0140533 Ga0500651_0140533_55_1074 339
90 3300053131 Ga0500652_066887 Ga0500652_066887_293_1312 339
91 3300053147 Ga0500589_031388 Ga0500589_031388_1188_2207 339
92 3300053151 Ga0500604_0000265 Ga0500604_0000265_772_1791 339
93 3300005331 Ga0070670_100110100 Ga0070670_1001101001 340
94 3300005337 Ga0070682_100000173 Ga0070682_10000017340 340
95 3300005338 Ga0068868_100112206 Ga0068868_1001122061 340
96 3300005339 Ga0070660_100039915 Ga0070660_1000399152 340
97 3300005339 Ga0070660_100305899 Ga0070660_1003058991 340
98 3300005355 Ga0070671_100249614 Ga0070671_1002496142 340
99 3300005530 Ga0070679_100040914 Ga0070679_1000409143 340
100 3300005539 Ga0068853_100025782 Ga0068853_1000257822 340
101 3300005539 Ga0068853_100051908 Ga0068853_1000519082 340
102 3300005563 Ga0068855_100036145 Ga0068855_1000361452 340
103 3300005617 Ga0068859_100001471 Ga0068859_1000014719 340
104 3300005841 Ga0068863_100236173 Ga0068863_1002361732 340
105 3300006931 Ga0097620_100001471 Ga0097620_1000014719 340
106 3300009098 Ga0105245_10322476 Ga0105245_103224762 340
107 3300013100 Ga0157373_10180080 Ga0157373_101800802 340
108 3300013102 Ga0157371_10008867 Ga0157371_100088676 340
109 3300013102 Ga0157371_10016690 Ga0157371_100166903 340
110 3300013104 Ga0157370_10004101 Ga0157370_1000410111 340
111 3300013104 Ga0157370_10004869 Ga0157370_1000486913 340
112 3300013104 Ga0157370_10175109 Ga0157370_101751091 340
113 3300013105 Ga0157369_10052961 Ga0157369_100529613 340
114 3300013307 Ga0157372_10029138 Ga0157372_100291387 340
115 3300013307 Ga0157372_10056101 Ga0157372_100561014 340
116 3300025921 Ga0207652_10000310 Ga0207652_1000031021 340
117 3300025925 Ga0207650_10271420 Ga0207650_102714201 340
118 3300025949 Ga0207667_10029451 Ga0207667_100294514 340
119 3300026041 Ga0207639_10022784 Ga0207639_100227844 340
120 3300026041 Ga0207639_10103718 Ga0207639_101037182 340
121 3300028794 Ga0307515_10000002 Ga0307515_10000002501 340
122 3300031251 Ga0265327_10000531 Ga0265327_1000053146 340
123 3300037312 Ga0395899_0060713 Ga0395899_0060713_856_1899 340
124 3300037312 Ga0395899_0146339 Ga0395899_0146339_474_1517 340
125 3300037418 Ga0395900_0322939 Ga0395900_0322939_16_1059 340
126 3300037466 Ga0395898_0003075 Ga0395898_0003075_8725_9768 340
127 3300037466 Ga0395898_0017027 Ga0395898_0017027_1162_2205 340
128 3300037471 Ga0395905_0307627 Ga0395905_0307627_376_1419 340
129 3300038443 Ga0395901_0023200 Ga0395901_0023200_3640_4683 340
130 3300038443 Ga0395901_0071643 Ga0395901_0071643_1128_2171 340
131 3300038443 Ga0395901_0395889 Ga0395901_0395889_70_1113 340
132 3300038443 Ga0395901_0528323 Ga0395901_0528323_84_1127 340
133 3300047319 Ga0495674_0085779 Ga0495674_0085779_1385_2407 340
134 3300047320 Ga0495672_0092573 Ga0495672_0092573_222_1250 340
135 3300047472 Ga0495686_0000616 Ga0495686_0000616_20564_21586 340
136 3300049570 Ga0501033_0049182 Ga0501033_0049182_2029_3051 340
137 3300049571 Ga0501034_0023947 Ga0501034_0023947_3900_4922 340
138 3300049571 Ga0501034_0060159 Ga0501034_0060159_67_1089 340
139 3300049742 Ga0501080_0236191 Ga0501080_0236191_26_1048 340
140 3300049823 Ga0501044_0019717 Ga0501044_0019717_5104_6126 340
141 3300003323 rootH1_10148467 rootH1_101484673 341
142 3300003354 JGI25160J50197_1000745 JGI25160J50197_100074516 341
143 3300005327 Ga0070658_10000095 Ga0070658_1000009567 341
144 3300005329 Ga0070683_100058804 Ga0070683_1000588042 341
145 3300005335 Ga0070666_10003710 Ga0070666_100037104 341
146 3300005335 Ga0070666_10005940 Ga0070666_100059402 341
147 3300005336 Ga0070680_100154434 Ga0070680_1001544342 341
148 3300005337 Ga0070682_100085816 Ga0070682_1000858162 341
149 3300005339 Ga0070660_100012793 Ga0070660_1000127935 341
150 3300005344 Ga0070661_100003273 Ga0070661_10000327310 341
151 3300005347 Ga0070668_100000043 Ga0070668_10000004336 341
152 3300005354 Ga0070675_100021470 Ga0070675_1000214702 341
153 3300005355 Ga0070671_100067864 Ga0070671_1000678642 341
154 3300005364 Ga0070673_100003480 Ga0070673_1000034804 341
155 3300005364 Ga0070673_100019594 Ga0070673_1000195943 341
156 3300005367 Ga0070667_100000254 Ga0070667_10000025429 341
157 3300005455 Ga0070663_100070734 Ga0070663_1000707342 341
158 3300005458 Ga0070681_10006155 Ga0070681_100061552 341
159 3300005458 Ga0070681_10163415 Ga0070681_101634152 341
160 3300005458 Ga0070681_10182064 Ga0070681_101820641 341
161 3300005459 Ga0068867_100351485 Ga0068867_1003514852 341
162 3300005535 Ga0070684_100003498 Ga0070684_1000034983 341
163 3300005535 Ga0070684_100046261 Ga0070684_1000462612 341
164 3300005539 Ga0068853_100015815 Ga0068853_1000158152 341
165 3300005539 Ga0068853_100069921 Ga0068853_1000699212 341
166 3300005543 Ga0070672_100004549 Ga0070672_1000045496 341
167 3300005547 Ga0070693_100113665 Ga0070693_1001136652 341
168 3300005548 Ga0070665_100000350 Ga0070665_1000003504 341
169 3300005563 Ga0068855_100000089 Ga0068855_10000008929 341
170 3300005563 Ga0068855_100003857 Ga0068855_10000385719 341
171 3300005563 Ga0068855_100014782 Ga0068855_1000147825 341
172 3300005563 Ga0068855_100033470 Ga0068855_1000334705 341
173 3300005563 Ga0068855_100225300 Ga0068855_1002253002 341
174 3300005564 Ga0070664_100005960 Ga0070664_1000059603 341
175 3300005577 Ga0068857_100032899 Ga0068857_1000328993 341
176 3300005614 Ga0068856_100010342 Ga0068856_1000103428 341
177 3300005614 Ga0068856_100057817 Ga0068856_1000578174 341
178 3300005616 Ga0068852_100009959 Ga0068852_1000099596 341
179 3300005616 Ga0068852_100289410 Ga0068852_1002894102 341
180 3300005618 Ga0068864_100001192 Ga0068864_10000119216 341
181 3300005834 Ga0068851_10012344 Ga0068851_100123442 341
182 3300005841 Ga0068863_100003656 Ga0068863_10000365613 341
183 3300005842 Ga0068858_100000199 Ga0068858_10000019940 341
184 3300005843 Ga0068860_100003203 Ga0068860_10000320311 341
185 3300005843 Ga0068860_100070685 Ga0068860_1000706852 341
186 3300006237 Ga0097621_100016337 Ga0097621_1000163373 341
187 3300006358 Ga0068871_100007723 Ga0068871_1000077233 341
188 3300006358 Ga0068871_100021180 Ga0068871_1000211802 341
189 3300009093 Ga0105240_10004146 Ga0105240_1000414616 341
190 3300009093 Ga0105240_10013673 Ga0105240_100136739 341
191 3300009093 Ga0105240_10014151 Ga0105240_100141516 341
192 3300009093 Ga0105240_10017976 Ga0105240_100179763 341
193 3300009094 Ga0111539_10227763 Ga0111539_102277632 341
194 3300009098 Ga0105245_10015578 Ga0105245_100155786 341
195 3300009101 Ga0105247_10127848 Ga0105247_101278482 341
196 3300009174 Ga0105241_10134229 Ga0105241_101342292 341
197 3300009176 Ga0105242_10316227 Ga0105242_103162272 341
198 3300009177 Ga0105248_10019350 Ga0105248_100193504 341
199 3300009551 Ga0105238_10033928 Ga0105238_100339284 341
200 3300009553 Ga0105249_10024983 Ga0105249_100249833 341
201 3300010375 Ga0105239_10000314 Ga0105239_1000031455 341
202 3300010375 Ga0105239_10079537 Ga0105239_100795372 341
203 3300010375 Ga0105239_10226745 Ga0105239_102267452 341
204 3300013100 Ga0157373_10056705 Ga0157373_100567052 341
205 3300013104 Ga0157370_10179403 Ga0157370_101794032 341
206 3300013105 Ga0157369_10039596 Ga0157369_100395965 341
207 3300013105 Ga0157369_10103758 Ga0157369_101037583 341
208 3300013296 Ga0157374_10000001 Ga0157374_10000001248 341
209 3300013296 Ga0157374_10000084 Ga0157374_100000844 341
210 3300013297 Ga0157378_10005892 Ga0157378_100058923 341
211 3300013297 Ga0157378_10008288 Ga0157378_100082886 341
212 3300013306 Ga0163162_10000113 Ga0163162_1000011362 341
213 3300013306 Ga0163162_10000524 Ga0163162_100005243 341
214 3300013306 Ga0163162_10153960 Ga0163162_101539602 341
215 3300013306 Ga0163162_10450686 Ga0163162_104506862 341
216 3300013307 Ga0157372_10029638 Ga0157372_100296384 341
217 3300013307 Ga0157372_10063274 Ga0157372_100632743 341
218 3300013308 Ga0157375_10000565 Ga0157375_1000056529 341
219 3300013308 Ga0157375_10220246 Ga0157375_102202462 341
220 3300014325 Ga0163163_10000332 Ga0163163_1000033234 341
221 3300014325 Ga0163163_10178023 Ga0163163_101780232 341
222 3300014968 Ga0157379_10000245 Ga0157379_100002453 341
223 3300014968 Ga0157379_10049824 Ga0157379_100498243 341
224 3300014969 Ga0157376_10180706 Ga0157376_101807062 341
225 3300017792 Ga0163161_10240942 Ga0163161_102409422 341
226 3300025302 Ga0207426_1000002 Ga0207426_1000002793 341
227 3300025321 Ga0207656_10011356 Ga0207656_100113562 341
228 3300025900 Ga0207710_10109529 Ga0207710_101095291 341
229 3300025903 Ga0207680_10000939 Ga0207680_100009397 341
230 3300025904 Ga0207647_10202477 Ga0207647_102024771 341
231 3300025907 Ga0207645_10000378 Ga0207645_1000037824 341
232 3300025909 Ga0207705_10000717 Ga0207705_1000071714 341
233 3300025909 Ga0207705_10138879 Ga0207705_101388792 341
234 3300025911 Ga0207654_10103050 Ga0207654_101030503 341
235 3300025912 Ga0207707_10020416 Ga0207707_100204163 341
236 3300025913 Ga0207695_10000071 Ga0207695_10000071209 341
237 3300025913 Ga0207695_10000084 Ga0207695_10000084184 341
238 3300025913 Ga0207695_10000323 Ga0207695_1000032334 341
239 3300025913 Ga0207695_10028091 Ga0207695_100280916 341
240 3300025917 Ga0207660_10064981 Ga0207660_100649812 341
241 3300025919 Ga0207657_10006443 Ga0207657_100064433 341
242 3300025920 Ga0207649_10083721 Ga0207649_100837212 341
243 3300025921 Ga0207652_10000663 Ga0207652_1000066321 341
244 3300025924 Ga0207694_10045444 Ga0207694_100454444 341
245 3300025932 Ga0207690_10029876 Ga0207690_100298763 341
246 3300025933 Ga0207706_10010506 Ga0207706_100105062 341
247 3300025940 Ga0207691_10000227 Ga0207691_1000022729 341
248 3300025941 Ga0207711_10037821 Ga0207711_100378212 341
249 3300025942 Ga0207689_10034261 Ga0207689_100342612 341
250 3300025944 Ga0207661_10014444 Ga0207661_100144442 341
251 3300025944 Ga0207661_10037017 Ga0207661_100370172 341
252 3300025945 Ga0207679_10379138 Ga0207679_103791381 341
253 3300025949 Ga0207667_10000177 Ga0207667_1000017744 341
254 3300025949 Ga0207667_10000961 Ga0207667_1000096115 341
255 3300025949 Ga0207667_10270155 Ga0207667_102701552 341
256 3300025960 Ga0207651_10001541 Ga0207651_100015415 341
257 3300025960 Ga0207651_10033699 Ga0207651_100336991 341
258 3300025972 Ga0207668_10000679 Ga0207668_100006798 341
259 3300025986 Ga0207658_10000176 Ga0207658_1000017636 341
260 3300026023 Ga0207677_10044416 Ga0207677_100444162 341
261 3300026041 Ga0207639_10017745 Ga0207639_100177452 341
262 3300026041 Ga0207639_10037716 Ga0207639_100377163 341
263 3300026078 Ga0207702_10056125 Ga0207702_100561254 341
264 3300026088 Ga0207641_10002208 Ga0207641_1000220815 341
265 3300026089 Ga0207648_10068362 Ga0207648_100683623 341
266 3300026095 Ga0207676_10001240 Ga0207676_100012406 341
267 3300026116 Ga0207674_10029005 Ga0207674_100290052 341
268 3300026121 Ga0207683_10247384 Ga0207683_102473842 341
269 3300026142 Ga0207698_10114873 Ga0207698_101148732 341
270 3300028379 Ga0268266_10003258 Ga0268266_1000325814 341
271 3300028381 Ga0268264_10002823 Ga0268264_1000282314 341
272 3300028381 Ga0268264_10003379 Ga0268264_100033792 341
273 3300028786 Ga0307517_10002048 Ga0307517_1000204831 341
274 3300031251 Ga0265327_10000168 Ga0265327_10000168123 341
275 3300031507 Ga0307509_10129941 Ga0307509_101299412 341
276 3300033180 Ga0307510_10000091 Ga0307510_1000009157 341
277 3300036401 Ga0373937_0089974 Ga0373937_0089974_1365_2396 341
278 3300037312 Ga0395899_0043717 Ga0395899_0043717_1739_2800 341
279 3300037418 Ga0395900_0068663 Ga0395900_0068663_2489_3550 341
280 3300037466 Ga0395898_0018423 Ga0395898_0018423_1899_2960 341
281 3300037471 Ga0395905_0031389 Ga0395905_0031389_1397_2446 341
282 3300038443 Ga0395901_0017067 Ga0395901_0017067_2711_3772 341
283 3300038443 Ga0395901_0042564 Ga0395901_0042564_672_1721 341
284 3300044658 Ga0466972_0000003 Ga0466972_0000003_166737_167762 341
285 3300044765 Ga0466970_0000561 Ga0466970_0000561_4198_5223 341
286 3300044901 Ga0466960_0021765 Ga0466960_0021765_1254_2279 341
287 3300046472 Ga0495580_0009622 Ga0495580_0009622_4723_5754 341
288 3300046473 Ga0495582_0073752 Ga0495582_0073752_262_1293 341
289 3300046507 Ga0495606_0004249 Ga0495606_0004249_2007_3038 341
290 3300046517 Ga0495630_0024597 Ga0495630_0024597_2366_3397 341
291 3300046648 Ga0495611_0001562 Ga0495611_0001562_6231_7262 341
292 3300047319 Ga0495674_0124150 Ga0495674_0124150_685_1716 341
293 3300047472 Ga0495686_0000004 Ga0495686_0000004_385590_386621 341
294 3300048912 Ga0496109_0038819 Ga0496109_0038819_2440_3471 341
295 3300049703 Ga0501219_000027 Ga0501219_000027_12452_13477 341
296 3300049758 Ga0501241_012647 Ga0501241_012647_93_1118 341
297 3300050005 Ga0501284_00021 Ga0501284_00021_52196_53221 341
298 3300050511 nmdc:mga08y16_346230_c1 nmdc:mga08y16_346230_c1_47_1072 341
299 3300053108 Ga0500562_000138 Ga0500562_000138_8576_9601 341
300 3300053156 Ga0500622_0002452 Ga0500622_0002452_3745_4770 341
301 3300013297 Ga0157378_10043377 Ga0157378_100433773 342
302 3300050496 nmdc:mga07m45_120762_c1 nmdc:mga07m45_120762_c1_314_1354 346
303 3300029957 Ga0265324_10039644 Ga0265324_100396441 350
304 3300005985 Ga0081539_10000037 Ga0081539_1000003735 355
305 3300003203 JGI25406J46586_10006981 JGI25406J46586_100069814 356
306 3300001979 JGI24740J21852_10017000 JGI24740J21852_100170002 359
307 3300009545 Ga0105237_10005745 Ga0105237_100057459 359
308 3300010375 Ga0105239_10022435 Ga0105239_100224358 359
309 3300025914 Ga0207671_10039174 Ga0207671_100391745 359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01761

DHQ_synthase

3-dehydroquinate synthase

78

192

0.98

PF24621

193

332

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lk2-assembly2.cif.gz_B crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9271 18 355
3zok-assembly2.cif.gz_C structure of 3-dehydroquinate synthase from actinidia chinensis in complex with nad 0.9224 20 359
6lk2-assembly1.cif.gz_A crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+, nad and chlorogenic acid 0.9202 18 356
6lla-assembly1.cif.gz_A crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and nad 0.9129 19 359
1nvd-assembly1.cif.gz_B crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate 0.9116 38 354
ID Description Score Start End Superfamily
3clhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9445 51 177 3.40.50.1970
1xahB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9065 20 177 3.40.50.1970
3qbdA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9039 18 177 3.40.50.1970
1nvaB02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8955 179 354 1.20.1090.10
3okfB02 Mainly Alpha;Up-down Bundle;Dehydroquinate synthase-like, alpha domain;Dehydroquinate synthase-like - alpha domain 0.8918 179 358 1.20.1090.10
ID Description Score Start End GO Terms
AF-A0A3D2XH27-F1-model_v4 3-dehydroquinate synthase 0.9928 19 148 GO:0003856
AF-A0A2W5F8Z3-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9891 20 359 GO:0000166
GO:0003856
GO:0005737
GO:0008652
GO:0009073
GO:0009423
GO:0046872
AF-A0A3D2XH27-F1-model_v4 3-dehydroquinate synthase 0.9852 19 148 GO:0003856
AF-A0A2W5F8Z3-F1-model_v4 3-dehydroquinate synthase (EC 4.2.3.4) 0.9805 20 359 GO:0000166
GO:0003856
GO:0005737
GO:0008652
GO:0009073
GO:0009423
GO:0046872
AF-A0A327QAN2-F1-model_v4 3-dehydroquinate synthase (DHQS) (EC 4.2.3.4) 0.9764 19 357 GO:0000166
GO:0003856
GO:0005737
GO:0008652
GO:0009073
GO:0009423
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.85 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map