F399442

General Info

Members Datasets Scaffolds Average Seq Length
307 216 304 196

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2757320392|2757572162
Length 217
Sequence RTNSPRTAPRRTSPKQTPATLATSPEPVPAEPRLATLHYLYLLAMLAVIAAILTAAMVMQYVRGELPCPLCLLQRAALFGVAFGIMQQFHSGFSFRNTGLSLLFAIFLLVVSVRQTLLDIYPRPGHEYIGSAILGLHMPVWSILIAIALLIAYAFKLIIFGNADEVRNARLADHPLIRALALVLGLYMVAIVLINFGSVILQCGLDECHTFSYKLLQ

Samples

Sample ID Description Type Environment
1 2534681786 Brucella suis 92/29 Isolate Unclassified
2 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
3 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
181 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
199 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
200 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
205 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
206 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
207 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0
Isolates 0.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.05
Nodule 0.33
Rhizoplane 4.23
Rhizosphere 82.41
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1002882 3300001976 Bacteria 2279
2 JGI24744J21845_10021031 3300002077 Bacteria 1285
3 JGI24035J26624_1013415 3300002126 Unclassified 832
4 JGI24033J26618_1014082 3300002155 Bacteria 977
5 JGI24034J26672_10017510 3300002239 Bacteria 1109
6 JGI24742J22300_10027610 3300002244 Bacteria 984
7 Ga0065712_10251885 3300005290 Bacteria 958
8 Ga0070658_10245009 3300005327 Bacteria 1520
9 Ga0070676_10087675 3300005328 Bacteria 1900
10 Ga0070683_100073426 3300005329 Bacteria 3194
11 Ga0070690_100011313 3300005330 Bacteria 5216
12 Ga0070670_100342207 3300005331 Bacteria 1313
13 Ga0068869_100018579 3300005334 Bacteria 4734
14 Ga0068869_100280317 3300005334 Bacteria 1340
15 Ga0070666_10034603 3300005335 Bacteria 3348
16 Ga0070666_10076024 3300005335 Bacteria 2290
17 Ga0070680_100206037 3300005336 Bacteria 1659
18 Ga0068868_100236588 3300005338 Bacteria 1533
19 Ga0070660_100040567 3300005339 Bacteria 3543
20 Ga0070661_100002976 3300005344 Bacteria 11677
21 Ga0070661_100258321 3300005344 Bacteria 1346
22 Ga0070668_100080826 3300005347 Bacteria 2547
23 Ga0070671_100086674 3300005355 Bacteria 2620
24 Ga0070671_100198034 3300005355 Unclassified 1703
25 Ga0070671_100378249 3300005355 Bacteria 1210
26 Ga0070674_100028952 3300005356 Bacteria 3642
27 Ga0070673_100098064 3300005364 Unclassified 2408
28 Ga0070688_100053257 3300005365 Bacteria 2530
29 Ga0070667_100094685 3300005367 Unclassified 2574
30 Ga0070667_100190785 3300005367 Bacteria 1815
31 Ga0070701_10015018 3300005438 Bacteria 3565
32 Ga0070700_100043164 3300005441 Bacteria 2772
33 Ga0070663_100138947 3300005455 Bacteria 1853
34 Ga0070678_100011535 3300005456 Bacteria 5459
35 Ga0070678_100065179 3300005456 Bacteria 2703
36 Ga0070662_100083582 3300005457 Bacteria 2383
37 Ga0070681_10013929 3300005458 Bacteria 8001
38 Ga0068867_100036848 3300005459 Bacteria 3553
39 Ga0068867_100130345 3300005459 Bacteria 1953
40 Ga0070685_10002423 3300005466 Bacteria 9595
41 Ga0070698_100642853 3300005471 Unclassified 1002
42 Ga0070679_100008919 3300005530 Bacteria 9462
43 Ga0070679_100008928 3300005530 Bacteria 9457
44 Ga0070684_100012926 3300005535 Bacteria 6711
45 Ga0070697_100122028 3300005536 Bacteria 2180
46 Ga0068853_100104986 3300005539 Bacteria 2502
47 Ga0068853_100133554 3300005539 Bacteria 2223
48 Ga0068853_100525946 3300005539 Bacteria 1118
49 Ga0070672_100019200 3300005543 Bacteria 4959
50 Ga0070686_100048553 3300005544 Bacteria 2689
51 Ga0070696_100206413 3300005546 Bacteria 1469
52 Ga0070693_100009452 3300005547 Unclassified 4849
53 Ga0070665_100019466 3300005548 Bacteria 6812
54 Ga0070665_100064618 3300005548 Bacteria 3670
55 Ga0070665_100316517 3300005548 Bacteria 1565
56 Ga0070704_100365851 3300005549 Unclassified 1221
57 Ga0068855_100248092 3300005563 Bacteria 1986
58 Ga0070664_100025838 3300005564 Bacteria 4868
59 Ga0068857_100083451 3300005577 Bacteria 2854
60 Ga0068854_100125560 3300005578 Bacteria 1953
61 Ga0068854_100141274 3300005578 Bacteria 1848
62 Ga0068856_100125566 3300005614 Bacteria 2569
63 Ga0068856_100306813 3300005614 Bacteria 1605
64 Ga0070702_100008640 3300005615 Bacteria 4944
65 Ga0068852_100088658 3300005616 Bacteria 2763
66 Ga0068859_100011391 3300005617 Bacteria 8943
67 Ga0068859_100807789 3300005617 Bacteria 1025
68 Ga0068864_100037547 3300005618 Bacteria 4134
69 Ga0068851_10008888 3300005834 Bacteria 4659
70 Ga0068870_10000731 3300005840 Bacteria 12640
71 Ga0068863_100079738 3300005841 Bacteria 3100
72 Ga0068863_101133178 3300005841 Bacteria 787
73 Ga0068860_100315991 3300005843 Bacteria 1532
74 Ga0068860_100482357 3300005843 Bacteria 1236
75 Ga0068862_100096283 3300005844 Bacteria 2583
76 Ga0081455_10289248 3300005937 Bacteria 1180
77 Ga0081538_10008040 3300005981 Bacteria 9016
78 Ga0075365_10006416 3300006038 Bacteria 6471
79 Ga0075368_10102985 3300006042 Unclassified 1173
80 Ga0075363_100021712 3300006048 Bacteria 3238
81 Ga0075363_100060608 3300006048 Bacteria 2037
82 Ga0075363_100200547 3300006048 Bacteria 1140
83 Ga0075364_10018208 3300006051 Bacteria 4395
84 Ga0075364_10071789 3300006051 Bacteria 2281
85 Ga0075364_10312787 3300006051 Unclassified 1070
86 Ga0075364_10434027 3300006051 Bacteria 897
87 Ga0070712_100033002 3300006175 Bacteria 3499
88 Ga0075362_10017476 3300006177 Bacteria 2955
89 Ga0075362_10034473 3300006177 Bacteria 2207
90 Ga0075362_10098633 3300006177 Bacteria 1364
91 Ga0075367_10023850 3300006178 Bacteria 3446
92 Ga0075367_10040557 3300006178 Bacteria 2719
93 Ga0075367_10083220 3300006178 Unclassified 1938
94 Ga0075369_10057053 3300006186 Bacteria 1698
95 Ga0075366_10022554 3300006195 Bacteria 3663
96 Ga0097621_100077077 3300006237 Bacteria 2766
97 Ga0097621_100093261 3300006237 Unclassified 2523
98 Ga0068871_100009558 3300006358 Bacteria 7038
99 Ga0068871_100136770 3300006358 Bacteria 2081
100 Ga0068871_100170601 3300006358 Bacteria 1865
101 Ga0068871_100290283 3300006358 Bacteria 1433
102 Ga0068871_100851247 3300006358 Bacteria 843
103 Ga0075430_100016511 3300006846 Bacteria 6288
104 Ga0075431_100131448 3300006847 Bacteria 2581
105 Ga0068865_100048392 3300006881 Bacteria 2925
106 Ga0068865_100054888 3300006881 Unclassified 2771
107 Ga0097620_100011391 3300006931 Bacteria 8943
108 Ga0097620_100807809 3300006931 Bacteria 1025
109 Ga0111539_10187045 3300009094 Bacteria 2418
110 Ga0111539_10257903 3300009094 Bacteria 2030
111 Ga0105245_10188493 3300009098 Bacteria 1974
112 Ga0105243_10243297 3300009148 Bacteria 1602
113 Ga0105248_10116180 3300009177 Bacteria 3018
114 Ga0105248_10237027 3300009177 Bacteria 2054
115 Ga0105237_10244575 3300009545 Bacteria 1795
116 Ga0105237_10808410 3300009545 Unclassified 944
117 Ga0105238_10208107 3300009551 Bacteria 1932
118 Ga0105238_10465215 3300009551 Bacteria 1263
119 Ga0105249_10270521 3300009553 Bacteria 1693
120 Ga0105249_10395171 3300009553 Bacteria 1412
121 Ga0105239_10047827 3300010375 Bacteria 4688
122 Ga0105239_10201879 3300010375 Bacteria 2227
123 Ga0105246_10058575 3300011119 Bacteria 2669
124 Ga0105246_10579278 3300011119 Bacteria 966
125 Ga0157373_10012335 3300013100 Bacteria 6283
126 Ga0157373_10497511 3300013100 Bacteria 880
127 Ga0157371_10049792 3300013102 Bacteria 2976
128 Ga0157370_10062872 3300013104 Bacteria 3519
129 Ga0157370_10489725 3300013104 Bacteria 1130
130 Ga0157369_11280304 3300013105 Unclassified 747
131 Ga0157374_10038747 3300013296 Bacteria 4382
132 Ga0157374_10039632 3300013296 Bacteria 4336
133 Ga0157374_10066273 3300013296 Bacteria 3394
134 Ga0157378_10032421 3300013297 Bacteria 4616
135 Ga0163162_10291455 3300013306 Unclassified 1764
136 Ga0157372_10017454 3300013307 Bacteria 7705
137 Ga0157372_10109687 3300013307 Bacteria 3161
138 Ga0157375_10053462 3300013308 Bacteria 3973
139 Ga0163163_10013933 3300014325 Bacteria 7377
140 Ga0157380_10129308 3300014326 Bacteria 2152
141 Ga0157377_10010220 3300014745 Bacteria 4635
142 Ga0157379_10049590 3300014968 Bacteria 3749
143 Ga0157379_10565703 3300014968 Bacteria 1059
144 Ga0157376_10122084 3300014969 Unclassified 2311
145 Ga0157376_10224920 3300014969 Bacteria 1740
146 Ga0207673_1002238 3300025290 Bacteria 2186
147 Ga0207697_10000432 3300025315 Bacteria 23587
148 Ga0207682_10003554 3300025893 Bacteria 6743
149 Ga0207642_10360532 3300025899 Unclassified 860
150 Ga0207647_10133915 3300025904 Bacteria 1455
151 Ga0207645_10004941 3300025907 Bacteria 9773
152 Ga0207643_10000787 3300025908 Bacteria 19328
153 Ga0207684_10136855 3300025910 Bacteria 2104
154 Ga0207707_10067885 3300025912 Bacteria 3106
155 Ga0207671_10138864 3300025914 Bacteria 1871
156 Ga0207693_10047029 3300025915 Bacteria 3391
157 Ga0207657_10088624 3300025919 Bacteria 2586
158 Ga0207657_10248267 3300025919 Unclassified 1419
159 Ga0207649_10021685 3300025920 Bacteria 3703
160 Ga0207649_10284615 3300025920 Bacteria 1203
161 Ga0207649_10442324 3300025920 Unclassified 980
162 Ga0207649_10681691 3300025920 Bacteria 796
163 Ga0207652_10092082 3300025921 Bacteria 2666
164 Ga0207650_10001056 3300025925 Bacteria 20479
165 Ga0207650_10053973 3300025925 Bacteria 2980
166 Ga0207650_10054278 3300025925 Bacteria 2972
167 Ga0207659_10000625 3300025926 Bacteria 20981
168 Ga0207706_10004630 3300025933 Bacteria 12900
169 Ga0207709_10288901 3300025935 Bacteria 1214
170 Ga0207670_10052504 3300025936 Bacteria 2741
171 Ga0207669_10028481 3300025937 Bacteria 3074
172 Ga0207669_10029291 3300025937 Bacteria 3042
173 Ga0207704_10101749 3300025938 Bacteria 1917
174 Ga0207691_10007442 3300025940 Bacteria 10542
175 Ga0207691_10019884 3300025940 Bacteria 6352
176 Ga0207711_10021481 3300025941 Bacteria 5393
177 Ga0207689_10004242 3300025942 Bacteria 13038
178 Ga0207661_10030601 3300025944 Bacteria 4148
179 Ga0207679_10044533 3300025945 Bacteria 3202
180 Ga0207679_10073547 3300025945 Bacteria 2586
181 Ga0207679_10097164 3300025945 Bacteria 2293
182 Ga0207679_10144890 3300025945 Bacteria 1925
183 Ga0207651_10173659 3300025960 Unclassified 1702
184 Ga0207651_10852897 3300025960 Unclassified 809
185 Ga0207658_10086089 3300025986 Unclassified 2422
186 Ga0207677_10337741 3300026023 Bacteria 1257
187 Ga0207677_10436099 3300026023 Bacteria 1119
188 Ga0207703_10110296 3300026035 Bacteria 2347
189 Ga0207639_10027390 3300026041 Bacteria 4153
190 Ga0207639_10195674 3300026041 Bacteria 1730
191 Ga0207639_10323312 3300026041 Bacteria 1370
192 Ga0207678_10002213 3300026067 Bacteria 17569
193 Ga0207708_10001242 3300026075 Bacteria 19243
194 Ga0207702_10057004 3300026078 Bacteria 3319
195 Ga0207641_10154877 3300026088 Bacteria 2078
196 Ga0207648_10055299 3300026089 Bacteria 3465
197 Ga0207648_10074676 3300026089 Bacteria 2955
198 Ga0207676_10006568 3300026095 Bacteria 8222
199 Ga0207674_10010562 3300026116 Bacteria 10449
200 Ga0207674_11063513 3300026116 Bacteria 778
201 Ga0207675_100003995 3300026118 Bacteria 14307
202 Ga0207683_10002432 3300026121 Bacteria 16241
203 Ga0207683_10002830 3300026121 Bacteria 15160
204 Ga0207698_10091334 3300026142 Bacteria 2492
205 Ga0207698_10685592 3300026142 Bacteria 1018
206 Ga0209813_10058529 3300027866 Unclassified 1225
207 Ga0268266_10043169 3300028379 Bacteria 3852
208 Ga0268266_10164228 3300028379 Bacteria 2010
209 Ga0268266_10249815 3300028379 Bacteria 1640
210 Ga0268265_10191517 3300028380 Bacteria 1766
211 Ga0268264_10201850 3300028381 Bacteria 1820
212 Ga0268264_10237889 3300028381 Bacteria 1685
213 Ga0265330_10044004 3300031235 Bacteria 1973
214 Ga0265332_10057178 3300031238 Bacteria 1671
215 Ga0265325_10018107 3300031241 Bacteria 3907
216 Ga0265340_10003840 3300031247 Bacteria 8470
217 Ga0265340_10171822 3300031247 Bacteria 982
218 Ga0265339_10117046 3300031249 Bacteria 1373
219 Ga0265316_10033896 3300031344 Bacteria 4153
220 Ga0265316_10326890 3300031344 Bacteria 1113
221 Ga0265313_10250383 3300031595 Bacteria 722
222 Ga0265342_10308992 3300031712 Bacteria 831
223 Ga0307410_11183864 3300031852 Bacteria 665
224 Ga0307406_10221609 3300031901 Bacteria 1406
225 Ga0307407_10082880 3300031903 Bacteria 1945
226 Ga0307412_10031171 3300031911 Bacteria 3365
227 Ga0307416_100016871 3300032002 Bacteria 5090
228 Ga0307416_100811907 3300032002 Bacteria 1032
229 Ga0307411_10019902 3300032005 Bacteria 3889
230 Ga0307411_10491907 3300032005 Bacteria 1035
231 Ga0307411_10841628 3300032005 Bacteria 811
232 Ga0307411_10926041 3300032005 Bacteria 776
233 Ga0307415_100097592 3300032126 Unclassified 2145
234 Ga0373944_0106270 3300035089 Bacteria 954
235 Ga0373954_0254488 3300035118 Bacteria 865
236 Ga0373931_0244037 3300035691 Bacteria 1090
237 Ga0373947_0069983 3300035725 Bacteria 2149
238 Ga0373947_0254454 3300035725 Bacteria 1162
239 Ga0373937_0276229 3300036401 Bacteria 1586
240 Ga0395899_0053076 3300037312 Bacteria 3002
241 Ga0395900_0012825 3300037418 Bacteria 8564
242 Ga0395898_0019389 3300037466 Bacteria 6922
243 Ga0395905_0005450 3300037471 Bacteria 12988
244 Ga0395905_0051272 3300037471 Bacteria 3865
245 Ga0395905_0682833 3300037471 Bacteria 929
246 Ga0395905_1238062 3300037471 Bacteria 650
247 Ga0395905_1264502 3300037471 Bacteria 642
248 Ga0395901_0007901 3300038443 Bacteria 10730
249 Ga0395901_1187944 3300038443 Bacteria 729
250 Ga0466965_0106378 3300044683 Bacteria 1439
251 Ga0466967_0143041 3300045976 Bacteria 2229
252 Ga0495650_0053851 3300046471 Bacteria 1645
253 Ga0495580_0164510 3300046472 Bacteria 1535
254 Ga0495621_0018925 3300046539 Bacteria 2243
255 Ga0495668_0151314 3300046616 Bacteria 1271
256 Ga0495625_0648232 3300046660 Bacteria 629
257 Ga0495669_0033908 3300046684 Bacteria 2249
258 Ga0495672_0210911 3300047320 Bacteria 965
259 Ga0496100_0018243 3300048903 Bacteria 4159
260 Ga0496101_0096260 3300048904 Bacteria 2209
261 Ga0496102_0140710 3300048905 Bacteria 2262
262 Ga0496104_0063292 3300048907 Bacteria 3508
263 Ga0496105_0413754 3300048908 Bacteria 1068
264 Ga0496106_0122539 3300048909 Bacteria 2033
265 Ga0496107_0050866 3300048910 Bacteria 2987
266 Ga0496108_0001343 3300048911 Bacteria 19336
267 Ga0496109_0013013 3300048912 Bacteria 7195
268 Ga0496110_0004049 3300048913 Bacteria 11313
269 Ga0496111_0144653 3300048914 Bacteria 1762
270 Ga0496114_0041997 3300048917 Bacteria 3789
271 Ga0496115_0275327 3300048918 Bacteria 1382
272 Ga0496123_0149540 3300048926 Bacteria 1262
273 Ga0496126_0573077 3300048929 Bacteria 893
274 Ga0501037_0492832 3300049573 Bacteria 832
275 Ga0501040_0466836 3300049576 Bacteria 909
276 Ga0501048_0772147 3300049582 Bacteria 690
277 Ga0501072_0510359 3300049588 Unclassified 951
278 Ga0501075_0396035 3300049591 Bacteria 1053
279 Ga0501077_0431138 3300049593 Bacteria 844
280 Ga0501080_0479890 3300049742 Bacteria 1112
281 Ga0501044_0263316 3300049823 Bacteria 1662
282 nmdc:mga03683_23861_c1 3300050489 Unclassified 2387
283 nmdc:mga03683_25529_c1 3300050489 Bacteria 2323
284 nmdc:mga03683_47019_c1 3300050489 Bacteria 1790
285 nmdc:mga03n38_16291_c1 3300050490 Bacteria 2889
286 nmdc:mga03n38_52559_c1 3300050490 Bacteria 1824
287 nmdc:mga03n38_91443_c1 3300050490 Unclassified 1449
288 nmdc:mga03n38_91979_c1 3300050490 Bacteria 1446
289 nmdc:mga00v17_31133_c1 3300050491 Bacteria 3144
290 nmdc:mga00v17_31412_c1 3300050491 Bacteria 3132
291 nmdc:mga00v17_415324_c1 3300050491 Bacteria 874
292 nmdc:mga0yw44_26567_c1 3300050492 Bacteria 3308
293 nmdc:mga0k408_23964_c1 3300050493 Bacteria 3447
294 nmdc:mga06z11_1235_c1 3300050494 Bacteria 9444
295 nmdc:mga06z11_21385_c1 3300050494 Bacteria 3005
296 nmdc:mga07m45_123671_c1 3300050496 Bacteria 1495
297 nmdc:mga07m45_217470_c1 3300050496 Bacteria 1111
298 nmdc:mga0qj67_69519_c1 3300050509 Bacteria 2808
299 nmdc:mga06r32_11796_c1 3300050510 Bacteria 7871
300 nmdc:mga08y16_105870_c1 3300050511 Bacteria 2928
301 nmdc:mga0sz30_28799_c1 3300050516 Bacteria 1497
302 Ga0495612_0234661 3300053078 Bacteria 814
303 Ga0500658_0010522 3300053134 Bacteria 3412
304 Ga0500568_0010812 3300053139 Bacteria 4258

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031712 Ga0265342_10308992 Ga0265342_103089922 165
2 3300037471 Ga0395905_1264502 Ga0395905_1264502_18_533 171
3 3300038443 Ga0395901_1187944 Ga0395901_1187944_19_534 171
4 3300009551 Ga0105238_10465215 Ga0105238_104652153 174
5 3300013296 Ga0157374_10066273 Ga0157374_100662732 174
6 3300037471 Ga0395905_0682833 Ga0395905_0682833_19_543 174
7 3300006038 Ga0075365_10006416 Ga0075365_100064162 176
8 3300006051 Ga0075364_10071789 Ga0075364_100717893 176
9 3300006178 Ga0075367_10040557 Ga0075367_100405573 176
10 3300025919 Ga0207657_10248267 Ga0207657_102482673 176
11 3300025925 Ga0207650_10053973 Ga0207650_100539733 176
12 3300031901 Ga0307406_10221609 Ga0307406_102216092 176
13 3300031911 Ga0307412_10031171 Ga0307412_100311714 176
14 3300032002 Ga0307416_100016871 Ga0307416_1000168715 176
15 3300032005 Ga0307411_10019902 Ga0307411_100199025 176
16 3300050491 nmdc:mga00v17_31133_c1 nmdc:mga00v17_31133_c1_1917_2474 176
17 3300050492 nmdc:mga0yw44_26567_c1 nmdc:mga0yw44_26567_c1_702_1259 176
18 3300050494 nmdc:mga06z11_21385_c1 nmdc:mga06z11_21385_c1_772_1329 176
19 3300005336 Ga0070680_100206037 Ga0070680_1002060373 177
20 3300005344 Ga0070661_100002976 Ga0070661_10000297614 177
21 3300005458 Ga0070681_10013929 Ga0070681_1001392912 177
22 3300005530 Ga0070679_100008928 Ga0070679_1000089288 177
23 3300005539 Ga0068853_100525946 Ga0068853_1005259462 177
24 3300013100 Ga0157373_10012335 Ga0157373_100123355 177
25 3300013104 Ga0157370_10062872 Ga0157370_100628725 177
26 3300013307 Ga0157372_10017454 Ga0157372_1001745411 177
27 3300025912 Ga0207707_10067885 Ga0207707_100678854 177
28 3300025920 Ga0207649_10021685 Ga0207649_100216854 177
29 3300025921 Ga0207652_10092082 Ga0207652_100920823 177
30 3300026041 Ga0207639_10027390 Ga0207639_100273904 177
31 3300009553 Ga0105249_10395171 Ga0105249_103951713 178
32 3300046471 Ga0495650_0053851 Ga0495650_0053851_745_1317 179
33 3300048918 Ga0496115_0275327 Ga0496115_0275327_743_1318 179
34 3300005981 Ga0081538_10008040 Ga0081538_1000804011 183
35 3300050496 nmdc:mga07m45_217470_c1 nmdc:mga07m45_217470_c1_485_1081 186
36 3300005530 Ga0070679_100008919 Ga0070679_1000089196 187
37 3300005547 Ga0070693_100009452 Ga0070693_1000094523 187
38 3300005334 Ga0068869_100280317 Ga0068869_1002803173 189
39 3300005564 Ga0070664_100025838 Ga0070664_1000258384 189
40 3300009545 Ga0105237_10808410 Ga0105237_108084102 189
41 3300013307 Ga0157372_10109687 Ga0157372_101096872 189
42 3300025945 Ga0207679_10097164 Ga0207679_100971644 189
43 3300032005 Ga0307411_10841628 Ga0307411_108416281 189
44 3300006048 Ga0075363_100021712 Ga0075363_1000217124 190
45 3300006048 Ga0075363_100200547 Ga0075363_1002005472 190
46 3300006178 Ga0075367_10023850 Ga0075367_100238502 190
47 3300031235 Ga0265330_10044004 Ga0265330_100440043 190
48 3300031238 Ga0265332_10057178 Ga0265332_100571782 190
49 3300031241 Ga0265325_10018107 Ga0265325_100181075 190
50 3300031247 Ga0265340_10003840 Ga0265340_100038405 190
51 3300031249 Ga0265339_10117046 Ga0265339_101170461 190
52 3300031344 Ga0265316_10033896 Ga0265316_100338963 190
53 3300031344 Ga0265316_10326890 Ga0265316_103268902 190
54 3300031595 Ga0265313_10250383 Ga0265313_102503832 190
55 3300046660 Ga0495625_0648232 Ga0495625_0648232_39_611 190
56 3300050490 nmdc:mga03n38_16291_c1 nmdc:mga03n38_16291_c1_1413_1985 190
57 3300050490 nmdc:mga03n38_91979_c1 nmdc:mga03n38_91979_c1_256_828 190
58 3300050494 nmdc:mga06z11_1235_c1 nmdc:mga06z11_1235_c1_8852_9424 190
59 3300050496 nmdc:mga07m45_123671_c1 nmdc:mga07m45_123671_c1_173_745 190
60 3300053139 Ga0500568_0010812 Ga0500568_0010812_2428_3000 190
61 3300049573 Ga0501037_0492832 Ga0501037_0492832_41_625 191
62 3300049823 Ga0501044_0263316 Ga0501044_0263316_750_1334 191
63 3300005355 Ga0070671_100198034 Ga0070671_1001980342 193
64 3300005614 Ga0068856_100306813 Ga0068856_1003068131 193
65 3300006358 Ga0068871_100009558 Ga0068871_1000095585 193
66 3300006358 Ga0068871_100851247 Ga0068871_1008512472 193
67 3300005331 Ga0070670_100342207 Ga0070670_1003422071 194
68 3300005344 Ga0070661_100258321 Ga0070661_1002583212 194
69 3300005355 Ga0070671_100378249 Ga0070671_1003782492 194
70 3300005539 Ga0068853_100104986 Ga0068853_1001049862 194
71 3300005578 Ga0068854_100141274 Ga0068854_1001412742 194
72 3300005937 Ga0081455_10289248 Ga0081455_102892484 194
73 3300006042 Ga0075368_10102985 Ga0075368_101029853 194
74 3300006051 Ga0075364_10312787 Ga0075364_103127873 194
75 3300006051 Ga0075364_10434027 Ga0075364_104340272 194
76 3300006177 Ga0075362_10034473 Ga0075362_100344733 194
77 3300006177 Ga0075362_10098633 Ga0075362_100986333 194
78 3300006178 Ga0075367_10083220 Ga0075367_100832203 194
79 3300009094 Ga0111539_10257903 Ga0111539_102579033 194
80 3300011119 Ga0105246_10579278 Ga0105246_105792782 194
81 3300013104 Ga0157370_10489725 Ga0157370_104897252 194
82 3300013105 Ga0157369_11280304 Ga0157369_112803041 194
83 3300025920 Ga0207649_10284615 Ga0207649_102846153 194
84 3300025920 Ga0207649_10442324 Ga0207649_104423242 194
85 3300025920 Ga0207649_10681691 Ga0207649_106816911 194
86 3300025945 Ga0207679_10073547 Ga0207679_100735473 194
87 3300025945 Ga0207679_10144890 Ga0207679_101448903 194
88 3300026041 Ga0207639_10323312 Ga0207639_103233122 194
89 3300026116 Ga0207674_11063513 Ga0207674_110635132 194
90 3300026142 Ga0207698_10091334 Ga0207698_100913342 194
91 3300027866 Ga0209813_10058529 Ga0209813_100585293 194
92 3300028380 Ga0268265_10191517 Ga0268265_101915173 194
93 3300028381 Ga0268264_10201850 Ga0268264_102018503 194
94 3300031852 Ga0307410_11183864 Ga0307410_111838641 194
95 3300032002 Ga0307416_100811907 Ga0307416_1008119072 194
96 3300032005 Ga0307411_10491907 Ga0307411_104919072 194
97 3300032126 Ga0307415_100097592 Ga0307415_1000975923 194
98 3300037312 Ga0395899_0053076 Ga0395899_0053076_2115_2702 194
99 3300037418 Ga0395900_0012825 Ga0395900_0012825_5747_6334 194
100 3300037466 Ga0395898_0019389 Ga0395898_0019389_6035_6622 194
101 3300037471 Ga0395905_0005450 Ga0395905_0005450_12101_12688 194
102 3300037471 Ga0395905_0051272 Ga0395905_0051272_986_1570 194
103 3300037471 Ga0395905_1238062 Ga0395905_1238062_43_627 194
104 3300038443 Ga0395901_0007901 Ga0395901_0007901_8294_8881 194
105 3300045976 Ga0466967_0143041 Ga0466967_0143041_385_972 194
106 3300046616 Ga0495668_0151314 Ga0495668_0151314_555_1139 194
107 3300046684 Ga0495669_0033908 Ga0495669_0033908_704_1288 194
108 3300049742 Ga0501080_0479890 Ga0501080_0479890_302_886 194
109 3300050489 nmdc:mga03683_47019_c1 nmdc:mga03683_47019_c1_596_1180 194
110 3300050490 nmdc:mga03n38_91443_c1 nmdc:mga03n38_91443_c1_434_1024 194
111 3300050491 nmdc:mga00v17_415324_c1 nmdc:mga00v17_415324_c1_253_843 194
112 3300031903 Ga0307407_10082880 Ga0307407_100828802 195
113 3300032005 Ga0307411_10926041 Ga0307411_109260412 195
114 iso_pu_bacteria 2758568016 2758641973 195
115 3300005548 Ga0070665_100316517 Ga0070665_1003165173 196
116 3300006048 Ga0075363_100060608 Ga0075363_1000606083 196
117 3300006051 Ga0075364_10018208 Ga0075364_100182083 196
118 3300006177 Ga0075362_10017476 Ga0075362_100174763 196
119 3300006186 Ga0075369_10057053 Ga0075369_100570533 196
120 3300006195 Ga0075366_10022554 Ga0075366_100225543 196
121 3300006846 Ga0075430_100016511 Ga0075430_1000165114 196
122 3300006847 Ga0075431_100131448 Ga0075431_1001314482 196
123 3300025925 Ga0207650_10054278 Ga0207650_100542782 196
124 3300028379 Ga0268266_10249815 Ga0268266_102498153 196
125 3300049588 Ga0501072_0510359 Ga0501072_0510359_342_932 196
126 3300050489 nmdc:mga03683_25529_c1 nmdc:mga03683_25529_c1_905_1495 196
127 3300050490 nmdc:mga03n38_52559_c1 nmdc:mga03n38_52559_c1_89_679 196
128 3300050491 nmdc:mga00v17_31412_c1 nmdc:mga00v17_31412_c1_1446_2036 196
129 3300050493 nmdc:mga0k408_23964_c1 nmdc:mga0k408_23964_c1_1670_2260 196
130 3300050509 nmdc:mga0qj67_69519_c1 nmdc:mga0qj67_69519_c1_537_1127 196
131 3300050510 nmdc:mga06r32_11796_c1 nmdc:mga06r32_11796_c1_4200_4790 196
132 3300050516 nmdc:mga0sz30_28799_c1 nmdc:mga0sz30_28799_c1_499_1089 196
133 3300053134 Ga0500658_0010522 Ga0500658_0010522_2148_2738 196
134 3300031247 Ga0265340_10171822 Ga0265340_101718222 197
135 3300035118 Ga0373954_0254488 Ga0373954_0254488_95_706 197
136 3300035725 Ga0373947_0254454 Ga0373947_0254454_463_1074 197
137 3300036401 Ga0373937_0276229 Ga0373937_0276229_208_819 197
138 3300047320 Ga0495672_0210911 Ga0495672_0210911_200_811 197
139 3300049576 Ga0501040_0466836 Ga0501040_0466836_156_749 197
140 3300049582 Ga0501048_0772147 Ga0501048_0772147_44_637 197
141 3300049591 Ga0501075_0396035 Ga0501075_0396035_171_764 197
142 3300050489 nmdc:mga03683_23861_c1 nmdc:mga03683_23861_c1_1171_1764 197
143 3300053078 Ga0495612_0234661 Ga0495612_0234661_22_615 197
144 iso_pu_bacteria 2757320392 2757572162 197
145 3300005328 Ga0070676_10087675 Ga0070676_100876752 198
146 3300005335 Ga0070666_10076024 Ga0070666_100760242 198
147 3300005338 Ga0068868_100236588 Ga0068868_1002365883 198
148 3300005356 Ga0070674_100028952 Ga0070674_1000289522 198
149 3300005364 Ga0070673_100098064 Ga0070673_1000980641 198
150 3300005367 Ga0070667_100094685 Ga0070667_1000946851 198
151 3300005456 Ga0070678_100011535 Ga0070678_1000115353 198
152 3300005459 Ga0068867_100036848 Ga0068867_1000368485 198
153 3300005471 Ga0070698_100642853 Ga0070698_1006428531 198
154 3300005536 Ga0070697_100122028 Ga0070697_1001220283 198
155 3300005543 Ga0070672_100019200 Ga0070672_1000192006 198
156 3300005546 Ga0070696_100206413 Ga0070696_1002064132 198
157 3300005548 Ga0070665_100019466 Ga0070665_1000194664 198
158 3300005549 Ga0070704_100365851 Ga0070704_1003658513 198
159 3300005617 Ga0068859_100807789 Ga0068859_1008077891 198
160 3300005841 Ga0068863_101133178 Ga0068863_1011331781 198
161 3300005843 Ga0068860_100482357 Ga0068860_1004823572 198
162 3300006237 Ga0097621_100093261 Ga0097621_1000932616 198
163 3300006358 Ga0068871_100170601 Ga0068871_1001706013 198
164 3300006358 Ga0068871_100290283 Ga0068871_1002902832 198
165 3300006881 Ga0068865_100054888 Ga0068865_1000548884 198
166 3300006931 Ga0097620_100807809 Ga0097620_1008078092 198
167 3300009177 Ga0105248_10116180 Ga0105248_101161804 198
168 3300010375 Ga0105239_10047827 Ga0105239_100478274 198
169 3300013296 Ga0157374_10038747 Ga0157374_100387472 198
170 3300013306 Ga0163162_10291455 Ga0163162_102914554 198
171 3300013308 Ga0157375_10053462 Ga0157375_100534623 198
172 3300014968 Ga0157379_10565703 Ga0157379_105657031 198
173 3300014969 Ga0157376_10122084 Ga0157376_101220844 198
174 3300025910 Ga0207684_10136855 Ga0207684_101368552 198
175 3300025937 Ga0207669_10028481 Ga0207669_100284812 198
176 3300025938 Ga0207704_10101749 Ga0207704_101017494 198
177 3300025940 Ga0207691_10019884 Ga0207691_100198843 198
178 3300025960 Ga0207651_10173659 Ga0207651_101736594 198
179 3300025986 Ga0207658_10086089 Ga0207658_100860895 198
180 3300026023 Ga0207677_10337741 Ga0207677_103377412 198
181 3300026089 Ga0207648_10055299 Ga0207648_100552992 198
182 3300026121 Ga0207683_10002432 Ga0207683_1000243219 198
183 3300028379 Ga0268266_10043169 Ga0268266_100431692 198
184 3300048926 Ga0496123_0149540 Ga0496123_0149540_645_1244 199
185 3300048929 Ga0496126_0573077 Ga0496126_0573077_199_798 199
186 3300049593 Ga0501077_0431138 Ga0501077_0431138_33_656 199
187 iso_pu_bacteria 2534681786 2535486328 199
188 3300001976 JGI24752J21851_1002882 JGI24752J21851_10028823 201
189 3300002077 JGI24744J21845_10021031 JGI24744J21845_100210311 201
190 3300002126 JGI24035J26624_1013415 JGI24035J26624_10134152 201
191 3300002155 JGI24033J26618_1014082 JGI24033J26618_10140822 201
192 3300002239 JGI24034J26672_10017510 JGI24034J26672_100175101 201
193 3300002244 JGI24742J22300_10027610 JGI24742J22300_100276102 201
194 3300005290 Ga0065712_10251885 Ga0065712_102518852 201
195 3300005327 Ga0070658_10245009 Ga0070658_102450092 201
196 3300005329 Ga0070683_100073426 Ga0070683_1000734262 201
197 3300005330 Ga0070690_100011313 Ga0070690_1000113132 201
198 3300005334 Ga0068869_100018579 Ga0068869_1000185793 201
199 3300005335 Ga0070666_10034603 Ga0070666_100346032 201
200 3300005339 Ga0070660_100040567 Ga0070660_1000405674 201
201 3300005347 Ga0070668_100080826 Ga0070668_1000808262 201
202 3300005355 Ga0070671_100086674 Ga0070671_1000866742 201
203 3300005365 Ga0070688_100053257 Ga0070688_1000532572 201
204 3300005367 Ga0070667_100190785 Ga0070667_1001907852 201
205 3300005438 Ga0070701_10015018 Ga0070701_100150182 201
206 3300005441 Ga0070700_100043164 Ga0070700_1000431642 201
207 3300005455 Ga0070663_100138947 Ga0070663_1001389473 201
208 3300005456 Ga0070678_100065179 Ga0070678_1000651792 201
209 3300005457 Ga0070662_100083582 Ga0070662_1000835823 201
210 3300005459 Ga0068867_100130345 Ga0068867_1001303453 201
211 3300005466 Ga0070685_10002423 Ga0070685_100024232 201
212 3300005535 Ga0070684_100012926 Ga0070684_1000129265 201
213 3300005539 Ga0068853_100133554 Ga0068853_1001335542 201
214 3300005544 Ga0070686_100048553 Ga0070686_1000485532 201
215 3300005548 Ga0070665_100064618 Ga0070665_1000646183 201
216 3300005563 Ga0068855_100248092 Ga0068855_1002480922 201
217 3300005577 Ga0068857_100083451 Ga0068857_1000834512 201
218 3300005578 Ga0068854_100125560 Ga0068854_1001255601 201
219 3300005614 Ga0068856_100125566 Ga0068856_1001255663 201
220 3300005615 Ga0070702_100008640 Ga0070702_1000086402 201
221 3300005616 Ga0068852_100088658 Ga0068852_1000886582 201
222 3300005617 Ga0068859_100011391 Ga0068859_1000113912 201
223 3300005618 Ga0068864_100037547 Ga0068864_1000375473 201
224 3300005834 Ga0068851_10008888 Ga0068851_100088883 201
225 3300005840 Ga0068870_10000731 Ga0068870_100007318 201
226 3300005841 Ga0068863_100079738 Ga0068863_1000797382 201
227 3300005843 Ga0068860_100315991 Ga0068860_1003159911 201
228 3300005844 Ga0068862_100096283 Ga0068862_1000962833 201
229 3300006175 Ga0070712_100033002 Ga0070712_1000330022 201
230 3300006237 Ga0097621_100077077 Ga0097621_1000770773 201
231 3300006358 Ga0068871_100136770 Ga0068871_1001367703 201
232 3300006881 Ga0068865_100048392 Ga0068865_1000483923 201
233 3300006931 Ga0097620_100011391 Ga0097620_1000113912 201
234 3300009094 Ga0111539_10187045 Ga0111539_101870453 201
235 3300009098 Ga0105245_10188493 Ga0105245_101884932 201
236 3300009148 Ga0105243_10243297 Ga0105243_102432973 201
237 3300009177 Ga0105248_10237027 Ga0105248_102370273 201
238 3300009545 Ga0105237_10244575 Ga0105237_102445753 201
239 3300009551 Ga0105238_10208107 Ga0105238_102081072 201
240 3300009553 Ga0105249_10270521 Ga0105249_102705213 201
241 3300010375 Ga0105239_10201879 Ga0105239_102018793 201
242 3300011119 Ga0105246_10058575 Ga0105246_100585752 201
243 3300013100 Ga0157373_10497511 Ga0157373_104975112 201
244 3300013102 Ga0157371_10049792 Ga0157371_100497922 201
245 3300013296 Ga0157374_10039632 Ga0157374_100396322 201
246 3300013297 Ga0157378_10032421 Ga0157378_100324213 201
247 3300014325 Ga0163163_10013933 Ga0163163_100139333 201
248 3300014326 Ga0157380_10129308 Ga0157380_101293082 201
249 3300014745 Ga0157377_10010220 Ga0157377_100102204 201
250 3300014968 Ga0157379_10049590 Ga0157379_100495902 201
251 3300014969 Ga0157376_10224920 Ga0157376_102249202 201
252 3300025290 Ga0207673_1002238 Ga0207673_10022382 201
253 3300025315 Ga0207697_10000432 Ga0207697_100004323 201
254 3300025893 Ga0207682_10003554 Ga0207682_100035543 201
255 3300025899 Ga0207642_10360532 Ga0207642_103605321 201
256 3300025904 Ga0207647_10133915 Ga0207647_101339153 201
257 3300025907 Ga0207645_10004941 Ga0207645_100049419 201
258 3300025908 Ga0207643_10000787 Ga0207643_100007872 201
259 3300025914 Ga0207671_10138864 Ga0207671_101388643 201
260 3300025915 Ga0207693_10047029 Ga0207693_100470293 201
261 3300025919 Ga0207657_10088624 Ga0207657_100886242 201
262 3300025925 Ga0207650_10001056 Ga0207650_100010566 201
263 3300025926 Ga0207659_10000625 Ga0207659_100006252 201
264 3300025933 Ga0207706_10004630 Ga0207706_100046306 201
265 3300025935 Ga0207709_10288901 Ga0207709_102889013 201
266 3300025936 Ga0207670_10052504 Ga0207670_100525042 201
267 3300025937 Ga0207669_10029291 Ga0207669_100292913 201
268 3300025940 Ga0207691_10007442 Ga0207691_100074424 201
269 3300025941 Ga0207711_10021481 Ga0207711_100214814 201
270 3300025942 Ga0207689_10004242 Ga0207689_100042426 201
271 3300025944 Ga0207661_10030601 Ga0207661_100306013 201
272 3300025945 Ga0207679_10044533 Ga0207679_100445332 201
273 3300025960 Ga0207651_10852897 Ga0207651_108528971 201
274 3300026023 Ga0207677_10436099 Ga0207677_104360992 201
275 3300026035 Ga0207703_10110296 Ga0207703_101102963 201
276 3300026041 Ga0207639_10195674 Ga0207639_101956742 201
277 3300026067 Ga0207678_10002213 Ga0207678_1000221316 201
278 3300026075 Ga0207708_10001242 Ga0207708_100012423 201
279 3300026078 Ga0207702_10057004 Ga0207702_100570043 201
280 3300026088 Ga0207641_10154877 Ga0207641_101548773 201
281 3300026089 Ga0207648_10074676 Ga0207648_100746762 201
282 3300026095 Ga0207676_10006568 Ga0207676_100065685 201
283 3300026116 Ga0207674_10010562 Ga0207674_100105626 201
284 3300026118 Ga0207675_100003995 Ga0207675_1000039958 201
285 3300026121 Ga0207683_10002830 Ga0207683_100028305 201
286 3300026142 Ga0207698_10685592 Ga0207698_106855922 201
287 3300028379 Ga0268266_10164228 Ga0268266_101642282 201
288 3300028381 Ga0268264_10237889 Ga0268264_102378892 201
289 3300035089 Ga0373944_0106270 Ga0373944_0106270_278_883 201
290 3300035691 Ga0373931_0244037 Ga0373931_0244037_354_959 201
291 3300035725 Ga0373947_0069983 Ga0373947_0069983_1199_1804 201
292 3300044683 Ga0466965_0106378 Ga0466965_0106378_425_1030 201
293 3300046472 Ga0495580_0164510 Ga0495580_0164510_796_1401 201
294 3300046539 Ga0495621_0018925 Ga0495621_0018925_1270_1875 201
295 3300048903 Ga0496100_0018243 Ga0496100_0018243_1934_2539 201
296 3300048904 Ga0496101_0096260 Ga0496101_0096260_1461_2066 201
297 3300048905 Ga0496102_0140710 Ga0496102_0140710_599_1204 201
298 3300048907 Ga0496104_0063292 Ga0496104_0063292_1524_2129 201
299 3300048908 Ga0496105_0413754 Ga0496105_0413754_259_864 201
300 3300048909 Ga0496106_0122539 Ga0496106_0122539_1204_1809 201
301 3300048910 Ga0496107_0050866 Ga0496107_0050866_906_1511 201
302 3300048911 Ga0496108_0001343 Ga0496108_0001343_16730_17335 201
303 3300048912 Ga0496109_0013013 Ga0496109_0013013_4817_5422 201
304 3300048913 Ga0496110_0004049 Ga0496110_0004049_3760_4365 201
305 3300048914 Ga0496111_0144653 Ga0496111_0144653_59_664 201
306 3300048917 Ga0496114_0041997 Ga0496114_0041997_1643_2248 201
307 3300050511 nmdc:mga08y16_105870_c1 nmdc:mga08y16_105870_c1_496_1101 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02600

DsbB

Disulfide bond formation protein DsbB

38

127

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wvf-assembly1.cif.gz_A e.coli dsbb c104s with ubiquinone 0.7956 23 151
8piv-assembly1.cif.gz_H homomeric glua2 flip r/g-unedited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 1 0.7789 54 138
8p3s-assembly1.cif.gz_F homomeric glua2 flip r/g-unedited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 2 0.7593 54 138
2ltq-assembly1.cif.gz_A high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data 0.7389 23 141
2rld-assembly1.cif.gz_B crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution 0.713 23 142
ID Description Score Start End Superfamily
2zuqD00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.8248 25 139 1.20.1550.10
2zuqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.8171 23 141 1.20.1550.10
af_A4HWU7_4_181_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7527 54 137 1.20.140.150
2ltqA00 Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like 0.7389 23 141 1.20.1550.10
af_Q4DT64_84_280_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7077 54 138 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7V9IPW9-F1-model_v4 Disulfide bond formation protein B 0.9495 13 201 GO:0006457
GO:0015035
GO:0016020
AF-E3BE84-F1-model_v4 Disulfide bond formation protein B 0.9478 19 106 GO:0006457
GO:0015035
GO:0016020
AF-A0A078L4E1-F1-model_v4 Disulfide bond formation protein B 0.9458 1 196 GO:0006457
GO:0015035
GO:0016020
AF-A0A2H9V8D2-F1-model_v4 deleted 0.9399 11 201
AF-A0A841M4Y4-F1-model_v4 Disulfide bond formation protein DsbB 0.9395 1 201 GO:0006457
GO:0015035
GO:0016020

Feature Viewer

pLDDT pTM Quality
80.85 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map