F399442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 216 | 304 | 196 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2757320392|2757572162 |
| Length | 217 |
| Sequence | RTNSPRTAPRRTSPKQTPATLATSPEPVPAEPRLATLHYLYLLAMLAVIAAILTAAMVMQYVRGELPCPLCLLQRAALFGVAFGIMQQFHSGFSFRNTGLSLLFAIFLLVVSVRQTLLDIYPRPGHEYIGSAILGLHMPVWSILIAIALLIAYAFKLIIFGNADEVRNARLADHPLIRALALVLGLYMVAIVLINFGSVILQCGLDECHTFSYKLLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 2 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 3 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 8 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 9 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 64 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 65 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 66 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 70 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 71 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 72 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 149 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 152 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 153 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 158 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 164 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 165 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 167 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 168 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 172 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 173 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 187 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 190 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 193 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 194 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 195 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 197 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 204 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 205 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 206 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 207 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 208 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 209 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 210 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 214 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 216 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.02 |
| Metatranscriptomes | 0 |
| Isolates | 0.98 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.05 |
| Nodule | 0.33 |
| Rhizoplane | 4.23 |
| Rhizosphere | 82.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1002882 | 3300001976 | Bacteria | 2279 |
| 2 | JGI24744J21845_10021031 | 3300002077 | Bacteria | 1285 |
| 3 | JGI24035J26624_1013415 | 3300002126 | Unclassified | 832 |
| 4 | JGI24033J26618_1014082 | 3300002155 | Bacteria | 977 |
| 5 | JGI24034J26672_10017510 | 3300002239 | Bacteria | 1109 |
| 6 | JGI24742J22300_10027610 | 3300002244 | Bacteria | 984 |
| 7 | Ga0065712_10251885 | 3300005290 | Bacteria | 958 |
| 8 | Ga0070658_10245009 | 3300005327 | Bacteria | 1520 |
| 9 | Ga0070676_10087675 | 3300005328 | Bacteria | 1900 |
| 10 | Ga0070683_100073426 | 3300005329 | Bacteria | 3194 |
| 11 | Ga0070690_100011313 | 3300005330 | Bacteria | 5216 |
| 12 | Ga0070670_100342207 | 3300005331 | Bacteria | 1313 |
| 13 | Ga0068869_100018579 | 3300005334 | Bacteria | 4734 |
| 14 | Ga0068869_100280317 | 3300005334 | Bacteria | 1340 |
| 15 | Ga0070666_10034603 | 3300005335 | Bacteria | 3348 |
| 16 | Ga0070666_10076024 | 3300005335 | Bacteria | 2290 |
| 17 | Ga0070680_100206037 | 3300005336 | Bacteria | 1659 |
| 18 | Ga0068868_100236588 | 3300005338 | Bacteria | 1533 |
| 19 | Ga0070660_100040567 | 3300005339 | Bacteria | 3543 |
| 20 | Ga0070661_100002976 | 3300005344 | Bacteria | 11677 |
| 21 | Ga0070661_100258321 | 3300005344 | Bacteria | 1346 |
| 22 | Ga0070668_100080826 | 3300005347 | Bacteria | 2547 |
| 23 | Ga0070671_100086674 | 3300005355 | Bacteria | 2620 |
| 24 | Ga0070671_100198034 | 3300005355 | Unclassified | 1703 |
| 25 | Ga0070671_100378249 | 3300005355 | Bacteria | 1210 |
| 26 | Ga0070674_100028952 | 3300005356 | Bacteria | 3642 |
| 27 | Ga0070673_100098064 | 3300005364 | Unclassified | 2408 |
| 28 | Ga0070688_100053257 | 3300005365 | Bacteria | 2530 |
| 29 | Ga0070667_100094685 | 3300005367 | Unclassified | 2574 |
| 30 | Ga0070667_100190785 | 3300005367 | Bacteria | 1815 |
| 31 | Ga0070701_10015018 | 3300005438 | Bacteria | 3565 |
| 32 | Ga0070700_100043164 | 3300005441 | Bacteria | 2772 |
| 33 | Ga0070663_100138947 | 3300005455 | Bacteria | 1853 |
| 34 | Ga0070678_100011535 | 3300005456 | Bacteria | 5459 |
| 35 | Ga0070678_100065179 | 3300005456 | Bacteria | 2703 |
| 36 | Ga0070662_100083582 | 3300005457 | Bacteria | 2383 |
| 37 | Ga0070681_10013929 | 3300005458 | Bacteria | 8001 |
| 38 | Ga0068867_100036848 | 3300005459 | Bacteria | 3553 |
| 39 | Ga0068867_100130345 | 3300005459 | Bacteria | 1953 |
| 40 | Ga0070685_10002423 | 3300005466 | Bacteria | 9595 |
| 41 | Ga0070698_100642853 | 3300005471 | Unclassified | 1002 |
| 42 | Ga0070679_100008919 | 3300005530 | Bacteria | 9462 |
| 43 | Ga0070679_100008928 | 3300005530 | Bacteria | 9457 |
| 44 | Ga0070684_100012926 | 3300005535 | Bacteria | 6711 |
| 45 | Ga0070697_100122028 | 3300005536 | Bacteria | 2180 |
| 46 | Ga0068853_100104986 | 3300005539 | Bacteria | 2502 |
| 47 | Ga0068853_100133554 | 3300005539 | Bacteria | 2223 |
| 48 | Ga0068853_100525946 | 3300005539 | Bacteria | 1118 |
| 49 | Ga0070672_100019200 | 3300005543 | Bacteria | 4959 |
| 50 | Ga0070686_100048553 | 3300005544 | Bacteria | 2689 |
| 51 | Ga0070696_100206413 | 3300005546 | Bacteria | 1469 |
| 52 | Ga0070693_100009452 | 3300005547 | Unclassified | 4849 |
| 53 | Ga0070665_100019466 | 3300005548 | Bacteria | 6812 |
| 54 | Ga0070665_100064618 | 3300005548 | Bacteria | 3670 |
| 55 | Ga0070665_100316517 | 3300005548 | Bacteria | 1565 |
| 56 | Ga0070704_100365851 | 3300005549 | Unclassified | 1221 |
| 57 | Ga0068855_100248092 | 3300005563 | Bacteria | 1986 |
| 58 | Ga0070664_100025838 | 3300005564 | Bacteria | 4868 |
| 59 | Ga0068857_100083451 | 3300005577 | Bacteria | 2854 |
| 60 | Ga0068854_100125560 | 3300005578 | Bacteria | 1953 |
| 61 | Ga0068854_100141274 | 3300005578 | Bacteria | 1848 |
| 62 | Ga0068856_100125566 | 3300005614 | Bacteria | 2569 |
| 63 | Ga0068856_100306813 | 3300005614 | Bacteria | 1605 |
| 64 | Ga0070702_100008640 | 3300005615 | Bacteria | 4944 |
| 65 | Ga0068852_100088658 | 3300005616 | Bacteria | 2763 |
| 66 | Ga0068859_100011391 | 3300005617 | Bacteria | 8943 |
| 67 | Ga0068859_100807789 | 3300005617 | Bacteria | 1025 |
| 68 | Ga0068864_100037547 | 3300005618 | Bacteria | 4134 |
| 69 | Ga0068851_10008888 | 3300005834 | Bacteria | 4659 |
| 70 | Ga0068870_10000731 | 3300005840 | Bacteria | 12640 |
| 71 | Ga0068863_100079738 | 3300005841 | Bacteria | 3100 |
| 72 | Ga0068863_101133178 | 3300005841 | Bacteria | 787 |
| 73 | Ga0068860_100315991 | 3300005843 | Bacteria | 1532 |
| 74 | Ga0068860_100482357 | 3300005843 | Bacteria | 1236 |
| 75 | Ga0068862_100096283 | 3300005844 | Bacteria | 2583 |
| 76 | Ga0081455_10289248 | 3300005937 | Bacteria | 1180 |
| 77 | Ga0081538_10008040 | 3300005981 | Bacteria | 9016 |
| 78 | Ga0075365_10006416 | 3300006038 | Bacteria | 6471 |
| 79 | Ga0075368_10102985 | 3300006042 | Unclassified | 1173 |
| 80 | Ga0075363_100021712 | 3300006048 | Bacteria | 3238 |
| 81 | Ga0075363_100060608 | 3300006048 | Bacteria | 2037 |
| 82 | Ga0075363_100200547 | 3300006048 | Bacteria | 1140 |
| 83 | Ga0075364_10018208 | 3300006051 | Bacteria | 4395 |
| 84 | Ga0075364_10071789 | 3300006051 | Bacteria | 2281 |
| 85 | Ga0075364_10312787 | 3300006051 | Unclassified | 1070 |
| 86 | Ga0075364_10434027 | 3300006051 | Bacteria | 897 |
| 87 | Ga0070712_100033002 | 3300006175 | Bacteria | 3499 |
| 88 | Ga0075362_10017476 | 3300006177 | Bacteria | 2955 |
| 89 | Ga0075362_10034473 | 3300006177 | Bacteria | 2207 |
| 90 | Ga0075362_10098633 | 3300006177 | Bacteria | 1364 |
| 91 | Ga0075367_10023850 | 3300006178 | Bacteria | 3446 |
| 92 | Ga0075367_10040557 | 3300006178 | Bacteria | 2719 |
| 93 | Ga0075367_10083220 | 3300006178 | Unclassified | 1938 |
| 94 | Ga0075369_10057053 | 3300006186 | Bacteria | 1698 |
| 95 | Ga0075366_10022554 | 3300006195 | Bacteria | 3663 |
| 96 | Ga0097621_100077077 | 3300006237 | Bacteria | 2766 |
| 97 | Ga0097621_100093261 | 3300006237 | Unclassified | 2523 |
| 98 | Ga0068871_100009558 | 3300006358 | Bacteria | 7038 |
| 99 | Ga0068871_100136770 | 3300006358 | Bacteria | 2081 |
| 100 | Ga0068871_100170601 | 3300006358 | Bacteria | 1865 |
| 101 | Ga0068871_100290283 | 3300006358 | Bacteria | 1433 |
| 102 | Ga0068871_100851247 | 3300006358 | Bacteria | 843 |
| 103 | Ga0075430_100016511 | 3300006846 | Bacteria | 6288 |
| 104 | Ga0075431_100131448 | 3300006847 | Bacteria | 2581 |
| 105 | Ga0068865_100048392 | 3300006881 | Bacteria | 2925 |
| 106 | Ga0068865_100054888 | 3300006881 | Unclassified | 2771 |
| 107 | Ga0097620_100011391 | 3300006931 | Bacteria | 8943 |
| 108 | Ga0097620_100807809 | 3300006931 | Bacteria | 1025 |
| 109 | Ga0111539_10187045 | 3300009094 | Bacteria | 2418 |
| 110 | Ga0111539_10257903 | 3300009094 | Bacteria | 2030 |
| 111 | Ga0105245_10188493 | 3300009098 | Bacteria | 1974 |
| 112 | Ga0105243_10243297 | 3300009148 | Bacteria | 1602 |
| 113 | Ga0105248_10116180 | 3300009177 | Bacteria | 3018 |
| 114 | Ga0105248_10237027 | 3300009177 | Bacteria | 2054 |
| 115 | Ga0105237_10244575 | 3300009545 | Bacteria | 1795 |
| 116 | Ga0105237_10808410 | 3300009545 | Unclassified | 944 |
| 117 | Ga0105238_10208107 | 3300009551 | Bacteria | 1932 |
| 118 | Ga0105238_10465215 | 3300009551 | Bacteria | 1263 |
| 119 | Ga0105249_10270521 | 3300009553 | Bacteria | 1693 |
| 120 | Ga0105249_10395171 | 3300009553 | Bacteria | 1412 |
| 121 | Ga0105239_10047827 | 3300010375 | Bacteria | 4688 |
| 122 | Ga0105239_10201879 | 3300010375 | Bacteria | 2227 |
| 123 | Ga0105246_10058575 | 3300011119 | Bacteria | 2669 |
| 124 | Ga0105246_10579278 | 3300011119 | Bacteria | 966 |
| 125 | Ga0157373_10012335 | 3300013100 | Bacteria | 6283 |
| 126 | Ga0157373_10497511 | 3300013100 | Bacteria | 880 |
| 127 | Ga0157371_10049792 | 3300013102 | Bacteria | 2976 |
| 128 | Ga0157370_10062872 | 3300013104 | Bacteria | 3519 |
| 129 | Ga0157370_10489725 | 3300013104 | Bacteria | 1130 |
| 130 | Ga0157369_11280304 | 3300013105 | Unclassified | 747 |
| 131 | Ga0157374_10038747 | 3300013296 | Bacteria | 4382 |
| 132 | Ga0157374_10039632 | 3300013296 | Bacteria | 4336 |
| 133 | Ga0157374_10066273 | 3300013296 | Bacteria | 3394 |
| 134 | Ga0157378_10032421 | 3300013297 | Bacteria | 4616 |
| 135 | Ga0163162_10291455 | 3300013306 | Unclassified | 1764 |
| 136 | Ga0157372_10017454 | 3300013307 | Bacteria | 7705 |
| 137 | Ga0157372_10109687 | 3300013307 | Bacteria | 3161 |
| 138 | Ga0157375_10053462 | 3300013308 | Bacteria | 3973 |
| 139 | Ga0163163_10013933 | 3300014325 | Bacteria | 7377 |
| 140 | Ga0157380_10129308 | 3300014326 | Bacteria | 2152 |
| 141 | Ga0157377_10010220 | 3300014745 | Bacteria | 4635 |
| 142 | Ga0157379_10049590 | 3300014968 | Bacteria | 3749 |
| 143 | Ga0157379_10565703 | 3300014968 | Bacteria | 1059 |
| 144 | Ga0157376_10122084 | 3300014969 | Unclassified | 2311 |
| 145 | Ga0157376_10224920 | 3300014969 | Bacteria | 1740 |
| 146 | Ga0207673_1002238 | 3300025290 | Bacteria | 2186 |
| 147 | Ga0207697_10000432 | 3300025315 | Bacteria | 23587 |
| 148 | Ga0207682_10003554 | 3300025893 | Bacteria | 6743 |
| 149 | Ga0207642_10360532 | 3300025899 | Unclassified | 860 |
| 150 | Ga0207647_10133915 | 3300025904 | Bacteria | 1455 |
| 151 | Ga0207645_10004941 | 3300025907 | Bacteria | 9773 |
| 152 | Ga0207643_10000787 | 3300025908 | Bacteria | 19328 |
| 153 | Ga0207684_10136855 | 3300025910 | Bacteria | 2104 |
| 154 | Ga0207707_10067885 | 3300025912 | Bacteria | 3106 |
| 155 | Ga0207671_10138864 | 3300025914 | Bacteria | 1871 |
| 156 | Ga0207693_10047029 | 3300025915 | Bacteria | 3391 |
| 157 | Ga0207657_10088624 | 3300025919 | Bacteria | 2586 |
| 158 | Ga0207657_10248267 | 3300025919 | Unclassified | 1419 |
| 159 | Ga0207649_10021685 | 3300025920 | Bacteria | 3703 |
| 160 | Ga0207649_10284615 | 3300025920 | Bacteria | 1203 |
| 161 | Ga0207649_10442324 | 3300025920 | Unclassified | 980 |
| 162 | Ga0207649_10681691 | 3300025920 | Bacteria | 796 |
| 163 | Ga0207652_10092082 | 3300025921 | Bacteria | 2666 |
| 164 | Ga0207650_10001056 | 3300025925 | Bacteria | 20479 |
| 165 | Ga0207650_10053973 | 3300025925 | Bacteria | 2980 |
| 166 | Ga0207650_10054278 | 3300025925 | Bacteria | 2972 |
| 167 | Ga0207659_10000625 | 3300025926 | Bacteria | 20981 |
| 168 | Ga0207706_10004630 | 3300025933 | Bacteria | 12900 |
| 169 | Ga0207709_10288901 | 3300025935 | Bacteria | 1214 |
| 170 | Ga0207670_10052504 | 3300025936 | Bacteria | 2741 |
| 171 | Ga0207669_10028481 | 3300025937 | Bacteria | 3074 |
| 172 | Ga0207669_10029291 | 3300025937 | Bacteria | 3042 |
| 173 | Ga0207704_10101749 | 3300025938 | Bacteria | 1917 |
| 174 | Ga0207691_10007442 | 3300025940 | Bacteria | 10542 |
| 175 | Ga0207691_10019884 | 3300025940 | Bacteria | 6352 |
| 176 | Ga0207711_10021481 | 3300025941 | Bacteria | 5393 |
| 177 | Ga0207689_10004242 | 3300025942 | Bacteria | 13038 |
| 178 | Ga0207661_10030601 | 3300025944 | Bacteria | 4148 |
| 179 | Ga0207679_10044533 | 3300025945 | Bacteria | 3202 |
| 180 | Ga0207679_10073547 | 3300025945 | Bacteria | 2586 |
| 181 | Ga0207679_10097164 | 3300025945 | Bacteria | 2293 |
| 182 | Ga0207679_10144890 | 3300025945 | Bacteria | 1925 |
| 183 | Ga0207651_10173659 | 3300025960 | Unclassified | 1702 |
| 184 | Ga0207651_10852897 | 3300025960 | Unclassified | 809 |
| 185 | Ga0207658_10086089 | 3300025986 | Unclassified | 2422 |
| 186 | Ga0207677_10337741 | 3300026023 | Bacteria | 1257 |
| 187 | Ga0207677_10436099 | 3300026023 | Bacteria | 1119 |
| 188 | Ga0207703_10110296 | 3300026035 | Bacteria | 2347 |
| 189 | Ga0207639_10027390 | 3300026041 | Bacteria | 4153 |
| 190 | Ga0207639_10195674 | 3300026041 | Bacteria | 1730 |
| 191 | Ga0207639_10323312 | 3300026041 | Bacteria | 1370 |
| 192 | Ga0207678_10002213 | 3300026067 | Bacteria | 17569 |
| 193 | Ga0207708_10001242 | 3300026075 | Bacteria | 19243 |
| 194 | Ga0207702_10057004 | 3300026078 | Bacteria | 3319 |
| 195 | Ga0207641_10154877 | 3300026088 | Bacteria | 2078 |
| 196 | Ga0207648_10055299 | 3300026089 | Bacteria | 3465 |
| 197 | Ga0207648_10074676 | 3300026089 | Bacteria | 2955 |
| 198 | Ga0207676_10006568 | 3300026095 | Bacteria | 8222 |
| 199 | Ga0207674_10010562 | 3300026116 | Bacteria | 10449 |
| 200 | Ga0207674_11063513 | 3300026116 | Bacteria | 778 |
| 201 | Ga0207675_100003995 | 3300026118 | Bacteria | 14307 |
| 202 | Ga0207683_10002432 | 3300026121 | Bacteria | 16241 |
| 203 | Ga0207683_10002830 | 3300026121 | Bacteria | 15160 |
| 204 | Ga0207698_10091334 | 3300026142 | Bacteria | 2492 |
| 205 | Ga0207698_10685592 | 3300026142 | Bacteria | 1018 |
| 206 | Ga0209813_10058529 | 3300027866 | Unclassified | 1225 |
| 207 | Ga0268266_10043169 | 3300028379 | Bacteria | 3852 |
| 208 | Ga0268266_10164228 | 3300028379 | Bacteria | 2010 |
| 209 | Ga0268266_10249815 | 3300028379 | Bacteria | 1640 |
| 210 | Ga0268265_10191517 | 3300028380 | Bacteria | 1766 |
| 211 | Ga0268264_10201850 | 3300028381 | Bacteria | 1820 |
| 212 | Ga0268264_10237889 | 3300028381 | Bacteria | 1685 |
| 213 | Ga0265330_10044004 | 3300031235 | Bacteria | 1973 |
| 214 | Ga0265332_10057178 | 3300031238 | Bacteria | 1671 |
| 215 | Ga0265325_10018107 | 3300031241 | Bacteria | 3907 |
| 216 | Ga0265340_10003840 | 3300031247 | Bacteria | 8470 |
| 217 | Ga0265340_10171822 | 3300031247 | Bacteria | 982 |
| 218 | Ga0265339_10117046 | 3300031249 | Bacteria | 1373 |
| 219 | Ga0265316_10033896 | 3300031344 | Bacteria | 4153 |
| 220 | Ga0265316_10326890 | 3300031344 | Bacteria | 1113 |
| 221 | Ga0265313_10250383 | 3300031595 | Bacteria | 722 |
| 222 | Ga0265342_10308992 | 3300031712 | Bacteria | 831 |
| 223 | Ga0307410_11183864 | 3300031852 | Bacteria | 665 |
| 224 | Ga0307406_10221609 | 3300031901 | Bacteria | 1406 |
| 225 | Ga0307407_10082880 | 3300031903 | Bacteria | 1945 |
| 226 | Ga0307412_10031171 | 3300031911 | Bacteria | 3365 |
| 227 | Ga0307416_100016871 | 3300032002 | Bacteria | 5090 |
| 228 | Ga0307416_100811907 | 3300032002 | Bacteria | 1032 |
| 229 | Ga0307411_10019902 | 3300032005 | Bacteria | 3889 |
| 230 | Ga0307411_10491907 | 3300032005 | Bacteria | 1035 |
| 231 | Ga0307411_10841628 | 3300032005 | Bacteria | 811 |
| 232 | Ga0307411_10926041 | 3300032005 | Bacteria | 776 |
| 233 | Ga0307415_100097592 | 3300032126 | Unclassified | 2145 |
| 234 | Ga0373944_0106270 | 3300035089 | Bacteria | 954 |
| 235 | Ga0373954_0254488 | 3300035118 | Bacteria | 865 |
| 236 | Ga0373931_0244037 | 3300035691 | Bacteria | 1090 |
| 237 | Ga0373947_0069983 | 3300035725 | Bacteria | 2149 |
| 238 | Ga0373947_0254454 | 3300035725 | Bacteria | 1162 |
| 239 | Ga0373937_0276229 | 3300036401 | Bacteria | 1586 |
| 240 | Ga0395899_0053076 | 3300037312 | Bacteria | 3002 |
| 241 | Ga0395900_0012825 | 3300037418 | Bacteria | 8564 |
| 242 | Ga0395898_0019389 | 3300037466 | Bacteria | 6922 |
| 243 | Ga0395905_0005450 | 3300037471 | Bacteria | 12988 |
| 244 | Ga0395905_0051272 | 3300037471 | Bacteria | 3865 |
| 245 | Ga0395905_0682833 | 3300037471 | Bacteria | 929 |
| 246 | Ga0395905_1238062 | 3300037471 | Bacteria | 650 |
| 247 | Ga0395905_1264502 | 3300037471 | Bacteria | 642 |
| 248 | Ga0395901_0007901 | 3300038443 | Bacteria | 10730 |
| 249 | Ga0395901_1187944 | 3300038443 | Bacteria | 729 |
| 250 | Ga0466965_0106378 | 3300044683 | Bacteria | 1439 |
| 251 | Ga0466967_0143041 | 3300045976 | Bacteria | 2229 |
| 252 | Ga0495650_0053851 | 3300046471 | Bacteria | 1645 |
| 253 | Ga0495580_0164510 | 3300046472 | Bacteria | 1535 |
| 254 | Ga0495621_0018925 | 3300046539 | Bacteria | 2243 |
| 255 | Ga0495668_0151314 | 3300046616 | Bacteria | 1271 |
| 256 | Ga0495625_0648232 | 3300046660 | Bacteria | 629 |
| 257 | Ga0495669_0033908 | 3300046684 | Bacteria | 2249 |
| 258 | Ga0495672_0210911 | 3300047320 | Bacteria | 965 |
| 259 | Ga0496100_0018243 | 3300048903 | Bacteria | 4159 |
| 260 | Ga0496101_0096260 | 3300048904 | Bacteria | 2209 |
| 261 | Ga0496102_0140710 | 3300048905 | Bacteria | 2262 |
| 262 | Ga0496104_0063292 | 3300048907 | Bacteria | 3508 |
| 263 | Ga0496105_0413754 | 3300048908 | Bacteria | 1068 |
| 264 | Ga0496106_0122539 | 3300048909 | Bacteria | 2033 |
| 265 | Ga0496107_0050866 | 3300048910 | Bacteria | 2987 |
| 266 | Ga0496108_0001343 | 3300048911 | Bacteria | 19336 |
| 267 | Ga0496109_0013013 | 3300048912 | Bacteria | 7195 |
| 268 | Ga0496110_0004049 | 3300048913 | Bacteria | 11313 |
| 269 | Ga0496111_0144653 | 3300048914 | Bacteria | 1762 |
| 270 | Ga0496114_0041997 | 3300048917 | Bacteria | 3789 |
| 271 | Ga0496115_0275327 | 3300048918 | Bacteria | 1382 |
| 272 | Ga0496123_0149540 | 3300048926 | Bacteria | 1262 |
| 273 | Ga0496126_0573077 | 3300048929 | Bacteria | 893 |
| 274 | Ga0501037_0492832 | 3300049573 | Bacteria | 832 |
| 275 | Ga0501040_0466836 | 3300049576 | Bacteria | 909 |
| 276 | Ga0501048_0772147 | 3300049582 | Bacteria | 690 |
| 277 | Ga0501072_0510359 | 3300049588 | Unclassified | 951 |
| 278 | Ga0501075_0396035 | 3300049591 | Bacteria | 1053 |
| 279 | Ga0501077_0431138 | 3300049593 | Bacteria | 844 |
| 280 | Ga0501080_0479890 | 3300049742 | Bacteria | 1112 |
| 281 | Ga0501044_0263316 | 3300049823 | Bacteria | 1662 |
| 282 | nmdc:mga03683_23861_c1 | 3300050489 | Unclassified | 2387 |
| 283 | nmdc:mga03683_25529_c1 | 3300050489 | Bacteria | 2323 |
| 284 | nmdc:mga03683_47019_c1 | 3300050489 | Bacteria | 1790 |
| 285 | nmdc:mga03n38_16291_c1 | 3300050490 | Bacteria | 2889 |
| 286 | nmdc:mga03n38_52559_c1 | 3300050490 | Bacteria | 1824 |
| 287 | nmdc:mga03n38_91443_c1 | 3300050490 | Unclassified | 1449 |
| 288 | nmdc:mga03n38_91979_c1 | 3300050490 | Bacteria | 1446 |
| 289 | nmdc:mga00v17_31133_c1 | 3300050491 | Bacteria | 3144 |
| 290 | nmdc:mga00v17_31412_c1 | 3300050491 | Bacteria | 3132 |
| 291 | nmdc:mga00v17_415324_c1 | 3300050491 | Bacteria | 874 |
| 292 | nmdc:mga0yw44_26567_c1 | 3300050492 | Bacteria | 3308 |
| 293 | nmdc:mga0k408_23964_c1 | 3300050493 | Bacteria | 3447 |
| 294 | nmdc:mga06z11_1235_c1 | 3300050494 | Bacteria | 9444 |
| 295 | nmdc:mga06z11_21385_c1 | 3300050494 | Bacteria | 3005 |
| 296 | nmdc:mga07m45_123671_c1 | 3300050496 | Bacteria | 1495 |
| 297 | nmdc:mga07m45_217470_c1 | 3300050496 | Bacteria | 1111 |
| 298 | nmdc:mga0qj67_69519_c1 | 3300050509 | Bacteria | 2808 |
| 299 | nmdc:mga06r32_11796_c1 | 3300050510 | Bacteria | 7871 |
| 300 | nmdc:mga08y16_105870_c1 | 3300050511 | Bacteria | 2928 |
| 301 | nmdc:mga0sz30_28799_c1 | 3300050516 | Bacteria | 1497 |
| 302 | Ga0495612_0234661 | 3300053078 | Bacteria | 814 |
| 303 | Ga0500658_0010522 | 3300053134 | Bacteria | 3412 |
| 304 | Ga0500568_0010812 | 3300053139 | Bacteria | 4258 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031712 | Ga0265342_10308992 | Ga0265342_103089922 | 165 |
| 2 | 3300037471 | Ga0395905_1264502 | Ga0395905_1264502_18_533 | 171 |
| 3 | 3300038443 | Ga0395901_1187944 | Ga0395901_1187944_19_534 | 171 |
| 4 | 3300009551 | Ga0105238_10465215 | Ga0105238_104652153 | 174 |
| 5 | 3300013296 | Ga0157374_10066273 | Ga0157374_100662732 | 174 |
| 6 | 3300037471 | Ga0395905_0682833 | Ga0395905_0682833_19_543 | 174 |
| 7 | 3300006038 | Ga0075365_10006416 | Ga0075365_100064162 | 176 |
| 8 | 3300006051 | Ga0075364_10071789 | Ga0075364_100717893 | 176 |
| 9 | 3300006178 | Ga0075367_10040557 | Ga0075367_100405573 | 176 |
| 10 | 3300025919 | Ga0207657_10248267 | Ga0207657_102482673 | 176 |
| 11 | 3300025925 | Ga0207650_10053973 | Ga0207650_100539733 | 176 |
| 12 | 3300031901 | Ga0307406_10221609 | Ga0307406_102216092 | 176 |
| 13 | 3300031911 | Ga0307412_10031171 | Ga0307412_100311714 | 176 |
| 14 | 3300032002 | Ga0307416_100016871 | Ga0307416_1000168715 | 176 |
| 15 | 3300032005 | Ga0307411_10019902 | Ga0307411_100199025 | 176 |
| 16 | 3300050491 | nmdc:mga00v17_31133_c1 | nmdc:mga00v17_31133_c1_1917_2474 | 176 |
| 17 | 3300050492 | nmdc:mga0yw44_26567_c1 | nmdc:mga0yw44_26567_c1_702_1259 | 176 |
| 18 | 3300050494 | nmdc:mga06z11_21385_c1 | nmdc:mga06z11_21385_c1_772_1329 | 176 |
| 19 | 3300005336 | Ga0070680_100206037 | Ga0070680_1002060373 | 177 |
| 20 | 3300005344 | Ga0070661_100002976 | Ga0070661_10000297614 | 177 |
| 21 | 3300005458 | Ga0070681_10013929 | Ga0070681_1001392912 | 177 |
| 22 | 3300005530 | Ga0070679_100008928 | Ga0070679_1000089288 | 177 |
| 23 | 3300005539 | Ga0068853_100525946 | Ga0068853_1005259462 | 177 |
| 24 | 3300013100 | Ga0157373_10012335 | Ga0157373_100123355 | 177 |
| 25 | 3300013104 | Ga0157370_10062872 | Ga0157370_100628725 | 177 |
| 26 | 3300013307 | Ga0157372_10017454 | Ga0157372_1001745411 | 177 |
| 27 | 3300025912 | Ga0207707_10067885 | Ga0207707_100678854 | 177 |
| 28 | 3300025920 | Ga0207649_10021685 | Ga0207649_100216854 | 177 |
| 29 | 3300025921 | Ga0207652_10092082 | Ga0207652_100920823 | 177 |
| 30 | 3300026041 | Ga0207639_10027390 | Ga0207639_100273904 | 177 |
| 31 | 3300009553 | Ga0105249_10395171 | Ga0105249_103951713 | 178 |
| 32 | 3300046471 | Ga0495650_0053851 | Ga0495650_0053851_745_1317 | 179 |
| 33 | 3300048918 | Ga0496115_0275327 | Ga0496115_0275327_743_1318 | 179 |
| 34 | 3300005981 | Ga0081538_10008040 | Ga0081538_1000804011 | 183 |
| 35 | 3300050496 | nmdc:mga07m45_217470_c1 | nmdc:mga07m45_217470_c1_485_1081 | 186 |
| 36 | 3300005530 | Ga0070679_100008919 | Ga0070679_1000089196 | 187 |
| 37 | 3300005547 | Ga0070693_100009452 | Ga0070693_1000094523 | 187 |
| 38 | 3300005334 | Ga0068869_100280317 | Ga0068869_1002803173 | 189 |
| 39 | 3300005564 | Ga0070664_100025838 | Ga0070664_1000258384 | 189 |
| 40 | 3300009545 | Ga0105237_10808410 | Ga0105237_108084102 | 189 |
| 41 | 3300013307 | Ga0157372_10109687 | Ga0157372_101096872 | 189 |
| 42 | 3300025945 | Ga0207679_10097164 | Ga0207679_100971644 | 189 |
| 43 | 3300032005 | Ga0307411_10841628 | Ga0307411_108416281 | 189 |
| 44 | 3300006048 | Ga0075363_100021712 | Ga0075363_1000217124 | 190 |
| 45 | 3300006048 | Ga0075363_100200547 | Ga0075363_1002005472 | 190 |
| 46 | 3300006178 | Ga0075367_10023850 | Ga0075367_100238502 | 190 |
| 47 | 3300031235 | Ga0265330_10044004 | Ga0265330_100440043 | 190 |
| 48 | 3300031238 | Ga0265332_10057178 | Ga0265332_100571782 | 190 |
| 49 | 3300031241 | Ga0265325_10018107 | Ga0265325_100181075 | 190 |
| 50 | 3300031247 | Ga0265340_10003840 | Ga0265340_100038405 | 190 |
| 51 | 3300031249 | Ga0265339_10117046 | Ga0265339_101170461 | 190 |
| 52 | 3300031344 | Ga0265316_10033896 | Ga0265316_100338963 | 190 |
| 53 | 3300031344 | Ga0265316_10326890 | Ga0265316_103268902 | 190 |
| 54 | 3300031595 | Ga0265313_10250383 | Ga0265313_102503832 | 190 |
| 55 | 3300046660 | Ga0495625_0648232 | Ga0495625_0648232_39_611 | 190 |
| 56 | 3300050490 | nmdc:mga03n38_16291_c1 | nmdc:mga03n38_16291_c1_1413_1985 | 190 |
| 57 | 3300050490 | nmdc:mga03n38_91979_c1 | nmdc:mga03n38_91979_c1_256_828 | 190 |
| 58 | 3300050494 | nmdc:mga06z11_1235_c1 | nmdc:mga06z11_1235_c1_8852_9424 | 190 |
| 59 | 3300050496 | nmdc:mga07m45_123671_c1 | nmdc:mga07m45_123671_c1_173_745 | 190 |
| 60 | 3300053139 | Ga0500568_0010812 | Ga0500568_0010812_2428_3000 | 190 |
| 61 | 3300049573 | Ga0501037_0492832 | Ga0501037_0492832_41_625 | 191 |
| 62 | 3300049823 | Ga0501044_0263316 | Ga0501044_0263316_750_1334 | 191 |
| 63 | 3300005355 | Ga0070671_100198034 | Ga0070671_1001980342 | 193 |
| 64 | 3300005614 | Ga0068856_100306813 | Ga0068856_1003068131 | 193 |
| 65 | 3300006358 | Ga0068871_100009558 | Ga0068871_1000095585 | 193 |
| 66 | 3300006358 | Ga0068871_100851247 | Ga0068871_1008512472 | 193 |
| 67 | 3300005331 | Ga0070670_100342207 | Ga0070670_1003422071 | 194 |
| 68 | 3300005344 | Ga0070661_100258321 | Ga0070661_1002583212 | 194 |
| 69 | 3300005355 | Ga0070671_100378249 | Ga0070671_1003782492 | 194 |
| 70 | 3300005539 | Ga0068853_100104986 | Ga0068853_1001049862 | 194 |
| 71 | 3300005578 | Ga0068854_100141274 | Ga0068854_1001412742 | 194 |
| 72 | 3300005937 | Ga0081455_10289248 | Ga0081455_102892484 | 194 |
| 73 | 3300006042 | Ga0075368_10102985 | Ga0075368_101029853 | 194 |
| 74 | 3300006051 | Ga0075364_10312787 | Ga0075364_103127873 | 194 |
| 75 | 3300006051 | Ga0075364_10434027 | Ga0075364_104340272 | 194 |
| 76 | 3300006177 | Ga0075362_10034473 | Ga0075362_100344733 | 194 |
| 77 | 3300006177 | Ga0075362_10098633 | Ga0075362_100986333 | 194 |
| 78 | 3300006178 | Ga0075367_10083220 | Ga0075367_100832203 | 194 |
| 79 | 3300009094 | Ga0111539_10257903 | Ga0111539_102579033 | 194 |
| 80 | 3300011119 | Ga0105246_10579278 | Ga0105246_105792782 | 194 |
| 81 | 3300013104 | Ga0157370_10489725 | Ga0157370_104897252 | 194 |
| 82 | 3300013105 | Ga0157369_11280304 | Ga0157369_112803041 | 194 |
| 83 | 3300025920 | Ga0207649_10284615 | Ga0207649_102846153 | 194 |
| 84 | 3300025920 | Ga0207649_10442324 | Ga0207649_104423242 | 194 |
| 85 | 3300025920 | Ga0207649_10681691 | Ga0207649_106816911 | 194 |
| 86 | 3300025945 | Ga0207679_10073547 | Ga0207679_100735473 | 194 |
| 87 | 3300025945 | Ga0207679_10144890 | Ga0207679_101448903 | 194 |
| 88 | 3300026041 | Ga0207639_10323312 | Ga0207639_103233122 | 194 |
| 89 | 3300026116 | Ga0207674_11063513 | Ga0207674_110635132 | 194 |
| 90 | 3300026142 | Ga0207698_10091334 | Ga0207698_100913342 | 194 |
| 91 | 3300027866 | Ga0209813_10058529 | Ga0209813_100585293 | 194 |
| 92 | 3300028380 | Ga0268265_10191517 | Ga0268265_101915173 | 194 |
| 93 | 3300028381 | Ga0268264_10201850 | Ga0268264_102018503 | 194 |
| 94 | 3300031852 | Ga0307410_11183864 | Ga0307410_111838641 | 194 |
| 95 | 3300032002 | Ga0307416_100811907 | Ga0307416_1008119072 | 194 |
| 96 | 3300032005 | Ga0307411_10491907 | Ga0307411_104919072 | 194 |
| 97 | 3300032126 | Ga0307415_100097592 | Ga0307415_1000975923 | 194 |
| 98 | 3300037312 | Ga0395899_0053076 | Ga0395899_0053076_2115_2702 | 194 |
| 99 | 3300037418 | Ga0395900_0012825 | Ga0395900_0012825_5747_6334 | 194 |
| 100 | 3300037466 | Ga0395898_0019389 | Ga0395898_0019389_6035_6622 | 194 |
| 101 | 3300037471 | Ga0395905_0005450 | Ga0395905_0005450_12101_12688 | 194 |
| 102 | 3300037471 | Ga0395905_0051272 | Ga0395905_0051272_986_1570 | 194 |
| 103 | 3300037471 | Ga0395905_1238062 | Ga0395905_1238062_43_627 | 194 |
| 104 | 3300038443 | Ga0395901_0007901 | Ga0395901_0007901_8294_8881 | 194 |
| 105 | 3300045976 | Ga0466967_0143041 | Ga0466967_0143041_385_972 | 194 |
| 106 | 3300046616 | Ga0495668_0151314 | Ga0495668_0151314_555_1139 | 194 |
| 107 | 3300046684 | Ga0495669_0033908 | Ga0495669_0033908_704_1288 | 194 |
| 108 | 3300049742 | Ga0501080_0479890 | Ga0501080_0479890_302_886 | 194 |
| 109 | 3300050489 | nmdc:mga03683_47019_c1 | nmdc:mga03683_47019_c1_596_1180 | 194 |
| 110 | 3300050490 | nmdc:mga03n38_91443_c1 | nmdc:mga03n38_91443_c1_434_1024 | 194 |
| 111 | 3300050491 | nmdc:mga00v17_415324_c1 | nmdc:mga00v17_415324_c1_253_843 | 194 |
| 112 | 3300031903 | Ga0307407_10082880 | Ga0307407_100828802 | 195 |
| 113 | 3300032005 | Ga0307411_10926041 | Ga0307411_109260412 | 195 |
| 114 | iso_pu_bacteria | 2758568016 | 2758641973 | 195 |
| 115 | 3300005548 | Ga0070665_100316517 | Ga0070665_1003165173 | 196 |
| 116 | 3300006048 | Ga0075363_100060608 | Ga0075363_1000606083 | 196 |
| 117 | 3300006051 | Ga0075364_10018208 | Ga0075364_100182083 | 196 |
| 118 | 3300006177 | Ga0075362_10017476 | Ga0075362_100174763 | 196 |
| 119 | 3300006186 | Ga0075369_10057053 | Ga0075369_100570533 | 196 |
| 120 | 3300006195 | Ga0075366_10022554 | Ga0075366_100225543 | 196 |
| 121 | 3300006846 | Ga0075430_100016511 | Ga0075430_1000165114 | 196 |
| 122 | 3300006847 | Ga0075431_100131448 | Ga0075431_1001314482 | 196 |
| 123 | 3300025925 | Ga0207650_10054278 | Ga0207650_100542782 | 196 |
| 124 | 3300028379 | Ga0268266_10249815 | Ga0268266_102498153 | 196 |
| 125 | 3300049588 | Ga0501072_0510359 | Ga0501072_0510359_342_932 | 196 |
| 126 | 3300050489 | nmdc:mga03683_25529_c1 | nmdc:mga03683_25529_c1_905_1495 | 196 |
| 127 | 3300050490 | nmdc:mga03n38_52559_c1 | nmdc:mga03n38_52559_c1_89_679 | 196 |
| 128 | 3300050491 | nmdc:mga00v17_31412_c1 | nmdc:mga00v17_31412_c1_1446_2036 | 196 |
| 129 | 3300050493 | nmdc:mga0k408_23964_c1 | nmdc:mga0k408_23964_c1_1670_2260 | 196 |
| 130 | 3300050509 | nmdc:mga0qj67_69519_c1 | nmdc:mga0qj67_69519_c1_537_1127 | 196 |
| 131 | 3300050510 | nmdc:mga06r32_11796_c1 | nmdc:mga06r32_11796_c1_4200_4790 | 196 |
| 132 | 3300050516 | nmdc:mga0sz30_28799_c1 | nmdc:mga0sz30_28799_c1_499_1089 | 196 |
| 133 | 3300053134 | Ga0500658_0010522 | Ga0500658_0010522_2148_2738 | 196 |
| 134 | 3300031247 | Ga0265340_10171822 | Ga0265340_101718222 | 197 |
| 135 | 3300035118 | Ga0373954_0254488 | Ga0373954_0254488_95_706 | 197 |
| 136 | 3300035725 | Ga0373947_0254454 | Ga0373947_0254454_463_1074 | 197 |
| 137 | 3300036401 | Ga0373937_0276229 | Ga0373937_0276229_208_819 | 197 |
| 138 | 3300047320 | Ga0495672_0210911 | Ga0495672_0210911_200_811 | 197 |
| 139 | 3300049576 | Ga0501040_0466836 | Ga0501040_0466836_156_749 | 197 |
| 140 | 3300049582 | Ga0501048_0772147 | Ga0501048_0772147_44_637 | 197 |
| 141 | 3300049591 | Ga0501075_0396035 | Ga0501075_0396035_171_764 | 197 |
| 142 | 3300050489 | nmdc:mga03683_23861_c1 | nmdc:mga03683_23861_c1_1171_1764 | 197 |
| 143 | 3300053078 | Ga0495612_0234661 | Ga0495612_0234661_22_615 | 197 |
| 144 | iso_pu_bacteria | 2757320392 | 2757572162 | 197 |
| 145 | 3300005328 | Ga0070676_10087675 | Ga0070676_100876752 | 198 |
| 146 | 3300005335 | Ga0070666_10076024 | Ga0070666_100760242 | 198 |
| 147 | 3300005338 | Ga0068868_100236588 | Ga0068868_1002365883 | 198 |
| 148 | 3300005356 | Ga0070674_100028952 | Ga0070674_1000289522 | 198 |
| 149 | 3300005364 | Ga0070673_100098064 | Ga0070673_1000980641 | 198 |
| 150 | 3300005367 | Ga0070667_100094685 | Ga0070667_1000946851 | 198 |
| 151 | 3300005456 | Ga0070678_100011535 | Ga0070678_1000115353 | 198 |
| 152 | 3300005459 | Ga0068867_100036848 | Ga0068867_1000368485 | 198 |
| 153 | 3300005471 | Ga0070698_100642853 | Ga0070698_1006428531 | 198 |
| 154 | 3300005536 | Ga0070697_100122028 | Ga0070697_1001220283 | 198 |
| 155 | 3300005543 | Ga0070672_100019200 | Ga0070672_1000192006 | 198 |
| 156 | 3300005546 | Ga0070696_100206413 | Ga0070696_1002064132 | 198 |
| 157 | 3300005548 | Ga0070665_100019466 | Ga0070665_1000194664 | 198 |
| 158 | 3300005549 | Ga0070704_100365851 | Ga0070704_1003658513 | 198 |
| 159 | 3300005617 | Ga0068859_100807789 | Ga0068859_1008077891 | 198 |
| 160 | 3300005841 | Ga0068863_101133178 | Ga0068863_1011331781 | 198 |
| 161 | 3300005843 | Ga0068860_100482357 | Ga0068860_1004823572 | 198 |
| 162 | 3300006237 | Ga0097621_100093261 | Ga0097621_1000932616 | 198 |
| 163 | 3300006358 | Ga0068871_100170601 | Ga0068871_1001706013 | 198 |
| 164 | 3300006358 | Ga0068871_100290283 | Ga0068871_1002902832 | 198 |
| 165 | 3300006881 | Ga0068865_100054888 | Ga0068865_1000548884 | 198 |
| 166 | 3300006931 | Ga0097620_100807809 | Ga0097620_1008078092 | 198 |
| 167 | 3300009177 | Ga0105248_10116180 | Ga0105248_101161804 | 198 |
| 168 | 3300010375 | Ga0105239_10047827 | Ga0105239_100478274 | 198 |
| 169 | 3300013296 | Ga0157374_10038747 | Ga0157374_100387472 | 198 |
| 170 | 3300013306 | Ga0163162_10291455 | Ga0163162_102914554 | 198 |
| 171 | 3300013308 | Ga0157375_10053462 | Ga0157375_100534623 | 198 |
| 172 | 3300014968 | Ga0157379_10565703 | Ga0157379_105657031 | 198 |
| 173 | 3300014969 | Ga0157376_10122084 | Ga0157376_101220844 | 198 |
| 174 | 3300025910 | Ga0207684_10136855 | Ga0207684_101368552 | 198 |
| 175 | 3300025937 | Ga0207669_10028481 | Ga0207669_100284812 | 198 |
| 176 | 3300025938 | Ga0207704_10101749 | Ga0207704_101017494 | 198 |
| 177 | 3300025940 | Ga0207691_10019884 | Ga0207691_100198843 | 198 |
| 178 | 3300025960 | Ga0207651_10173659 | Ga0207651_101736594 | 198 |
| 179 | 3300025986 | Ga0207658_10086089 | Ga0207658_100860895 | 198 |
| 180 | 3300026023 | Ga0207677_10337741 | Ga0207677_103377412 | 198 |
| 181 | 3300026089 | Ga0207648_10055299 | Ga0207648_100552992 | 198 |
| 182 | 3300026121 | Ga0207683_10002432 | Ga0207683_1000243219 | 198 |
| 183 | 3300028379 | Ga0268266_10043169 | Ga0268266_100431692 | 198 |
| 184 | 3300048926 | Ga0496123_0149540 | Ga0496123_0149540_645_1244 | 199 |
| 185 | 3300048929 | Ga0496126_0573077 | Ga0496126_0573077_199_798 | 199 |
| 186 | 3300049593 | Ga0501077_0431138 | Ga0501077_0431138_33_656 | 199 |
| 187 | iso_pu_bacteria | 2534681786 | 2535486328 | 199 |
| 188 | 3300001976 | JGI24752J21851_1002882 | JGI24752J21851_10028823 | 201 |
| 189 | 3300002077 | JGI24744J21845_10021031 | JGI24744J21845_100210311 | 201 |
| 190 | 3300002126 | JGI24035J26624_1013415 | JGI24035J26624_10134152 | 201 |
| 191 | 3300002155 | JGI24033J26618_1014082 | JGI24033J26618_10140822 | 201 |
| 192 | 3300002239 | JGI24034J26672_10017510 | JGI24034J26672_100175101 | 201 |
| 193 | 3300002244 | JGI24742J22300_10027610 | JGI24742J22300_100276102 | 201 |
| 194 | 3300005290 | Ga0065712_10251885 | Ga0065712_102518852 | 201 |
| 195 | 3300005327 | Ga0070658_10245009 | Ga0070658_102450092 | 201 |
| 196 | 3300005329 | Ga0070683_100073426 | Ga0070683_1000734262 | 201 |
| 197 | 3300005330 | Ga0070690_100011313 | Ga0070690_1000113132 | 201 |
| 198 | 3300005334 | Ga0068869_100018579 | Ga0068869_1000185793 | 201 |
| 199 | 3300005335 | Ga0070666_10034603 | Ga0070666_100346032 | 201 |
| 200 | 3300005339 | Ga0070660_100040567 | Ga0070660_1000405674 | 201 |
| 201 | 3300005347 | Ga0070668_100080826 | Ga0070668_1000808262 | 201 |
| 202 | 3300005355 | Ga0070671_100086674 | Ga0070671_1000866742 | 201 |
| 203 | 3300005365 | Ga0070688_100053257 | Ga0070688_1000532572 | 201 |
| 204 | 3300005367 | Ga0070667_100190785 | Ga0070667_1001907852 | 201 |
| 205 | 3300005438 | Ga0070701_10015018 | Ga0070701_100150182 | 201 |
| 206 | 3300005441 | Ga0070700_100043164 | Ga0070700_1000431642 | 201 |
| 207 | 3300005455 | Ga0070663_100138947 | Ga0070663_1001389473 | 201 |
| 208 | 3300005456 | Ga0070678_100065179 | Ga0070678_1000651792 | 201 |
| 209 | 3300005457 | Ga0070662_100083582 | Ga0070662_1000835823 | 201 |
| 210 | 3300005459 | Ga0068867_100130345 | Ga0068867_1001303453 | 201 |
| 211 | 3300005466 | Ga0070685_10002423 | Ga0070685_100024232 | 201 |
| 212 | 3300005535 | Ga0070684_100012926 | Ga0070684_1000129265 | 201 |
| 213 | 3300005539 | Ga0068853_100133554 | Ga0068853_1001335542 | 201 |
| 214 | 3300005544 | Ga0070686_100048553 | Ga0070686_1000485532 | 201 |
| 215 | 3300005548 | Ga0070665_100064618 | Ga0070665_1000646183 | 201 |
| 216 | 3300005563 | Ga0068855_100248092 | Ga0068855_1002480922 | 201 |
| 217 | 3300005577 | Ga0068857_100083451 | Ga0068857_1000834512 | 201 |
| 218 | 3300005578 | Ga0068854_100125560 | Ga0068854_1001255601 | 201 |
| 219 | 3300005614 | Ga0068856_100125566 | Ga0068856_1001255663 | 201 |
| 220 | 3300005615 | Ga0070702_100008640 | Ga0070702_1000086402 | 201 |
| 221 | 3300005616 | Ga0068852_100088658 | Ga0068852_1000886582 | 201 |
| 222 | 3300005617 | Ga0068859_100011391 | Ga0068859_1000113912 | 201 |
| 223 | 3300005618 | Ga0068864_100037547 | Ga0068864_1000375473 | 201 |
| 224 | 3300005834 | Ga0068851_10008888 | Ga0068851_100088883 | 201 |
| 225 | 3300005840 | Ga0068870_10000731 | Ga0068870_100007318 | 201 |
| 226 | 3300005841 | Ga0068863_100079738 | Ga0068863_1000797382 | 201 |
| 227 | 3300005843 | Ga0068860_100315991 | Ga0068860_1003159911 | 201 |
| 228 | 3300005844 | Ga0068862_100096283 | Ga0068862_1000962833 | 201 |
| 229 | 3300006175 | Ga0070712_100033002 | Ga0070712_1000330022 | 201 |
| 230 | 3300006237 | Ga0097621_100077077 | Ga0097621_1000770773 | 201 |
| 231 | 3300006358 | Ga0068871_100136770 | Ga0068871_1001367703 | 201 |
| 232 | 3300006881 | Ga0068865_100048392 | Ga0068865_1000483923 | 201 |
| 233 | 3300006931 | Ga0097620_100011391 | Ga0097620_1000113912 | 201 |
| 234 | 3300009094 | Ga0111539_10187045 | Ga0111539_101870453 | 201 |
| 235 | 3300009098 | Ga0105245_10188493 | Ga0105245_101884932 | 201 |
| 236 | 3300009148 | Ga0105243_10243297 | Ga0105243_102432973 | 201 |
| 237 | 3300009177 | Ga0105248_10237027 | Ga0105248_102370273 | 201 |
| 238 | 3300009545 | Ga0105237_10244575 | Ga0105237_102445753 | 201 |
| 239 | 3300009551 | Ga0105238_10208107 | Ga0105238_102081072 | 201 |
| 240 | 3300009553 | Ga0105249_10270521 | Ga0105249_102705213 | 201 |
| 241 | 3300010375 | Ga0105239_10201879 | Ga0105239_102018793 | 201 |
| 242 | 3300011119 | Ga0105246_10058575 | Ga0105246_100585752 | 201 |
| 243 | 3300013100 | Ga0157373_10497511 | Ga0157373_104975112 | 201 |
| 244 | 3300013102 | Ga0157371_10049792 | Ga0157371_100497922 | 201 |
| 245 | 3300013296 | Ga0157374_10039632 | Ga0157374_100396322 | 201 |
| 246 | 3300013297 | Ga0157378_10032421 | Ga0157378_100324213 | 201 |
| 247 | 3300014325 | Ga0163163_10013933 | Ga0163163_100139333 | 201 |
| 248 | 3300014326 | Ga0157380_10129308 | Ga0157380_101293082 | 201 |
| 249 | 3300014745 | Ga0157377_10010220 | Ga0157377_100102204 | 201 |
| 250 | 3300014968 | Ga0157379_10049590 | Ga0157379_100495902 | 201 |
| 251 | 3300014969 | Ga0157376_10224920 | Ga0157376_102249202 | 201 |
| 252 | 3300025290 | Ga0207673_1002238 | Ga0207673_10022382 | 201 |
| 253 | 3300025315 | Ga0207697_10000432 | Ga0207697_100004323 | 201 |
| 254 | 3300025893 | Ga0207682_10003554 | Ga0207682_100035543 | 201 |
| 255 | 3300025899 | Ga0207642_10360532 | Ga0207642_103605321 | 201 |
| 256 | 3300025904 | Ga0207647_10133915 | Ga0207647_101339153 | 201 |
| 257 | 3300025907 | Ga0207645_10004941 | Ga0207645_100049419 | 201 |
| 258 | 3300025908 | Ga0207643_10000787 | Ga0207643_100007872 | 201 |
| 259 | 3300025914 | Ga0207671_10138864 | Ga0207671_101388643 | 201 |
| 260 | 3300025915 | Ga0207693_10047029 | Ga0207693_100470293 | 201 |
| 261 | 3300025919 | Ga0207657_10088624 | Ga0207657_100886242 | 201 |
| 262 | 3300025925 | Ga0207650_10001056 | Ga0207650_100010566 | 201 |
| 263 | 3300025926 | Ga0207659_10000625 | Ga0207659_100006252 | 201 |
| 264 | 3300025933 | Ga0207706_10004630 | Ga0207706_100046306 | 201 |
| 265 | 3300025935 | Ga0207709_10288901 | Ga0207709_102889013 | 201 |
| 266 | 3300025936 | Ga0207670_10052504 | Ga0207670_100525042 | 201 |
| 267 | 3300025937 | Ga0207669_10029291 | Ga0207669_100292913 | 201 |
| 268 | 3300025940 | Ga0207691_10007442 | Ga0207691_100074424 | 201 |
| 269 | 3300025941 | Ga0207711_10021481 | Ga0207711_100214814 | 201 |
| 270 | 3300025942 | Ga0207689_10004242 | Ga0207689_100042426 | 201 |
| 271 | 3300025944 | Ga0207661_10030601 | Ga0207661_100306013 | 201 |
| 272 | 3300025945 | Ga0207679_10044533 | Ga0207679_100445332 | 201 |
| 273 | 3300025960 | Ga0207651_10852897 | Ga0207651_108528971 | 201 |
| 274 | 3300026023 | Ga0207677_10436099 | Ga0207677_104360992 | 201 |
| 275 | 3300026035 | Ga0207703_10110296 | Ga0207703_101102963 | 201 |
| 276 | 3300026041 | Ga0207639_10195674 | Ga0207639_101956742 | 201 |
| 277 | 3300026067 | Ga0207678_10002213 | Ga0207678_1000221316 | 201 |
| 278 | 3300026075 | Ga0207708_10001242 | Ga0207708_100012423 | 201 |
| 279 | 3300026078 | Ga0207702_10057004 | Ga0207702_100570043 | 201 |
| 280 | 3300026088 | Ga0207641_10154877 | Ga0207641_101548773 | 201 |
| 281 | 3300026089 | Ga0207648_10074676 | Ga0207648_100746762 | 201 |
| 282 | 3300026095 | Ga0207676_10006568 | Ga0207676_100065685 | 201 |
| 283 | 3300026116 | Ga0207674_10010562 | Ga0207674_100105626 | 201 |
| 284 | 3300026118 | Ga0207675_100003995 | Ga0207675_1000039958 | 201 |
| 285 | 3300026121 | Ga0207683_10002830 | Ga0207683_100028305 | 201 |
| 286 | 3300026142 | Ga0207698_10685592 | Ga0207698_106855922 | 201 |
| 287 | 3300028379 | Ga0268266_10164228 | Ga0268266_101642282 | 201 |
| 288 | 3300028381 | Ga0268264_10237889 | Ga0268264_102378892 | 201 |
| 289 | 3300035089 | Ga0373944_0106270 | Ga0373944_0106270_278_883 | 201 |
| 290 | 3300035691 | Ga0373931_0244037 | Ga0373931_0244037_354_959 | 201 |
| 291 | 3300035725 | Ga0373947_0069983 | Ga0373947_0069983_1199_1804 | 201 |
| 292 | 3300044683 | Ga0466965_0106378 | Ga0466965_0106378_425_1030 | 201 |
| 293 | 3300046472 | Ga0495580_0164510 | Ga0495580_0164510_796_1401 | 201 |
| 294 | 3300046539 | Ga0495621_0018925 | Ga0495621_0018925_1270_1875 | 201 |
| 295 | 3300048903 | Ga0496100_0018243 | Ga0496100_0018243_1934_2539 | 201 |
| 296 | 3300048904 | Ga0496101_0096260 | Ga0496101_0096260_1461_2066 | 201 |
| 297 | 3300048905 | Ga0496102_0140710 | Ga0496102_0140710_599_1204 | 201 |
| 298 | 3300048907 | Ga0496104_0063292 | Ga0496104_0063292_1524_2129 | 201 |
| 299 | 3300048908 | Ga0496105_0413754 | Ga0496105_0413754_259_864 | 201 |
| 300 | 3300048909 | Ga0496106_0122539 | Ga0496106_0122539_1204_1809 | 201 |
| 301 | 3300048910 | Ga0496107_0050866 | Ga0496107_0050866_906_1511 | 201 |
| 302 | 3300048911 | Ga0496108_0001343 | Ga0496108_0001343_16730_17335 | 201 |
| 303 | 3300048912 | Ga0496109_0013013 | Ga0496109_0013013_4817_5422 | 201 |
| 304 | 3300048913 | Ga0496110_0004049 | Ga0496110_0004049_3760_4365 | 201 |
| 305 | 3300048914 | Ga0496111_0144653 | Ga0496111_0144653_59_664 | 201 |
| 306 | 3300048917 | Ga0496114_0041997 | Ga0496114_0041997_1643_2248 | 201 |
| 307 | 3300050511 | nmdc:mga08y16_105870_c1 | nmdc:mga08y16_105870_c1_496_1101 | 201 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6wvf-assembly1.cif.gz_A | e.coli dsbb c104s with ubiquinone | 0.7956 | 23 | 151 |
| 8piv-assembly1.cif.gz_H | homomeric glua2 flip r/g-unedited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 1 | 0.7789 | 54 | 138 |
| 8p3s-assembly1.cif.gz_F | homomeric glua2 flip r/g-unedited q/r-edited f231a mutant in tandem with tarp gamma-2, desensitized conformation 2 | 0.7593 | 54 | 138 |
| 2ltq-assembly1.cif.gz_A | high resolution structure of dsbb c41s by joint calculation with solid-state nmr and x-ray data | 0.7389 | 23 | 141 |
| 2rld-assembly1.cif.gz_B | crystal structure of a protein with unknown function from s23 ribosomal protein family (bt_0352) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution | 0.713 | 23 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2zuqD00 | Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like | 0.8248 | 25 | 139 | 1.20.1550.10 |
| 2zuqA00 | Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like | 0.8171 | 23 | 141 | 1.20.1550.10 |
| af_A4HWU7_4_181_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7527 | 54 | 137 | 1.20.140.150 |
| 2ltqA00 | Mainly Alpha;Up-down Bundle;Bromodomain-like;DsbB-like | 0.7389 | 23 | 141 | 1.20.1550.10 |
| af_Q4DT64_84_280_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.7077 | 54 | 138 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9IPW9-F1-model_v4 | Disulfide bond formation protein B | 0.9495 | 13 | 201 |
GO:0006457
GO:0015035 GO:0016020 |
| AF-E3BE84-F1-model_v4 | Disulfide bond formation protein B | 0.9478 | 19 | 106 |
GO:0006457
GO:0015035 GO:0016020 |
| AF-A0A078L4E1-F1-model_v4 | Disulfide bond formation protein B | 0.9458 | 1 | 196 |
GO:0006457
GO:0015035 GO:0016020 |
| AF-A0A2H9V8D2-F1-model_v4 | deleted | 0.9399 | 11 | 201 |
|
| AF-A0A841M4Y4-F1-model_v4 | Disulfide bond formation protein DsbB | 0.9395 | 1 | 201 |
GO:0006457
GO:0015035 GO:0016020 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar