F399014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 307 | 190 | 307 | 306 |
Family's Representative Sequence
| Representative Sequence | 3300005341|Ga0070691_10015391|Ga0070691_100153914 |
| Length | 306 |
| Sequence | MRAMVLAAGLGTRLRPITYEMPKPMVPVLNKPVMEHILRLLARHGFSETIANLHWFPELIEGYFGDGSLSYSREEQLLGTSGGVRNAAGFLGDSFLIISGDALTDIDLTAMREFHESHDGIATLAMKRVQDTSQFGVAIVGADGRIQGFQEKPDPSEALSDLANCGIYMFRKEIFDFFPAPGTAKVAGPDDPPGFADWATDVFPALLDGDVPFYSHEIDAYWNDIGNLDELRQGNLDALRGEVDVDPGAPEVSDGVRAASPLDGAELIAPILVGSGVEIGSILLAGTELPPATVMIGGIAAHANKP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 37 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 41 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 42 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 43 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 48 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 49 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 108 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 109 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 110 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 111 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 114 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 115 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 116 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 117 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 119 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 120 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 121 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 122 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 123 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 124 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 125 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 126 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 171 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 172 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 173 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 174 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 175 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 177 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 178 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 179 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 180 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 181 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 184 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.33 |
| Nodule | 0 |
| Rhizoplane | 10.75 |
| Rhizosphere | 88.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.33 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000415 | 3300001977 | Bacteria | 6338 |
| 2 | JGI24748J21848_1000923 | 3300002074 | Bacteria | 3194 |
| 3 | JGI25406J46586_10061358 | 3300003203 | Bacteria | 1212 |
| 4 | JGI25404J52841_10004672 | 3300003659 | Bacteria | 2791 |
| 5 | Ga0070683_100017584 | 3300005329 | Bacteria | 6320 |
| 6 | Ga0070683_100272178 | 3300005329 | Unclassified | 1611 |
| 7 | Ga0070670_100040566 | 3300005331 | Bacteria | 4002 |
| 8 | Ga0070677_10000195 | 3300005333 | Bacteria | 20886 |
| 9 | Ga0070680_100011928 | 3300005336 | Bacteria | 6742 |
| 10 | Ga0070682_100000013 | 3300005337 | Bacteria | 254641 |
| 11 | Ga0070682_100000045 | 3300005337 | Bacteria | 131960 |
| 12 | Ga0068868_100000151 | 3300005338 | Bacteria | 44963 |
| 13 | Ga0070689_100066164 | 3300005340 | Bacteria | 2816 |
| 14 | Ga0070691_10015391 | 3300005341 | Bacteria | 3515 |
| 15 | Ga0070661_100000742 | 3300005344 | Bacteria | 23671 |
| 16 | Ga0070675_100000053 | 3300005354 | Bacteria | 70601 |
| 17 | Ga0070674_100000008 | 3300005356 | Bacteria | 143844 |
| 18 | Ga0070674_100000082 | 3300005356 | Bacteria | 44418 |
| 19 | Ga0070674_100201818 | 3300005356 | Bacteria | 1536 |
| 20 | Ga0070673_100011981 | 3300005364 | Bacteria | 5939 |
| 21 | Ga0070688_100001548 | 3300005365 | Bacteria | 11509 |
| 22 | Ga0070688_100254985 | 3300005365 | Bacteria | 1250 |
| 23 | Ga0070667_100000695 | 3300005367 | Bacteria | 32405 |
| 24 | Ga0070714_100145719 | 3300005435 | Bacteria | 2130 |
| 25 | Ga0070713_100000009 | 3300005436 | Bacteria | 153056 |
| 26 | Ga0070711_100003353 | 3300005439 | Bacteria | 9323 |
| 27 | Ga0070711_100134525 | 3300005439 | Bacteria | 1846 |
| 28 | Ga0070662_100000016 | 3300005457 | Bacteria | 105820 |
| 29 | Ga0070681_10066295 | 3300005458 | Bacteria | 3579 |
| 30 | Ga0068867_100068809 | 3300005459 | Bacteria | 2643 |
| 31 | Ga0070685_10000282 | 3300005466 | Bacteria | 32605 |
| 32 | Ga0070679_100000312 | 3300005530 | Bacteria | 41159 |
| 33 | Ga0070684_100069606 | 3300005535 | Bacteria | 3095 |
| 34 | Ga0070684_100081668 | 3300005535 | Bacteria | 2861 |
| 35 | Ga0070684_100086454 | 3300005535 | Bacteria | 2783 |
| 36 | Ga0068853_100002766 | 3300005539 | Bacteria | 13247 |
| 37 | Ga0070693_100002833 | 3300005547 | Bacteria | 7982 |
| 38 | Ga0070665_100000244 | 3300005548 | Bacteria | 90284 |
| 39 | Ga0070665_100069034 | 3300005548 | Bacteria | 3542 |
| 40 | Ga0068855_100085257 | 3300005563 | Bacteria | 3656 |
| 41 | Ga0068854_100000031 | 3300005578 | Bacteria | 107298 |
| 42 | Ga0068854_100029227 | 3300005578 | Bacteria | 3815 |
| 43 | Ga0068856_100026831 | 3300005614 | Bacteria | 5617 |
| 44 | Ga0068856_100036947 | 3300005614 | Bacteria | 4790 |
| 45 | Ga0068856_100272608 | 3300005614 | Bacteria | 1708 |
| 46 | Ga0068852_100347724 | 3300005616 | Bacteria | 1447 |
| 47 | Ga0068864_100000045 | 3300005618 | Bacteria | 154739 |
| 48 | Ga0068866_10000001 | 3300005718 | Bacteria | 519680 |
| 49 | Ga0068866_10000597 | 3300005718 | Bacteria | 16444 |
| 50 | Ga0068851_10003973 | 3300005834 | Bacteria | 6624 |
| 51 | Ga0068851_10005652 | 3300005834 | Bacteria | 5681 |
| 52 | Ga0068863_100000021 | 3300005841 | Bacteria | 198088 |
| 53 | Ga0068858_100000267 | 3300005842 | Bacteria | 55818 |
| 54 | Ga0068858_100001207 | 3300005842 | Bacteria | 26780 |
| 55 | Ga0068860_100015490 | 3300005843 | Bacteria | 7445 |
| 56 | Ga0081540_1000006 | 3300005983 | Bacteria | 208724 |
| 57 | Ga0081539_10003705 | 3300005985 | Bacteria | 18213 |
| 58 | Ga0070715_10000001 | 3300006163 | Bacteria | 693690 |
| 59 | Ga0070715_10064836 | 3300006163 | Unclassified | 1615 |
| 60 | Ga0070712_100001071 | 3300006175 | Bacteria | 16531 |
| 61 | Ga0097621_100255085 | 3300006237 | Bacteria | 1537 |
| 62 | Ga0068871_100105794 | 3300006358 | Bacteria | 2362 |
| 63 | Ga0075433_10000339 | 3300006852 | Bacteria | 29053 |
| 64 | Ga0075433_10050642 | 3300006852 | Bacteria | 3616 |
| 65 | Ga0068865_100007424 | 3300006881 | Bacteria | 6746 |
| 66 | Ga0111539_10392778 | 3300009094 | Bacteria | 1616 |
| 67 | Ga0105245_10000016 | 3300009098 | Bacteria | 204372 |
| 68 | Ga0105245_10000545 | 3300009098 | Bacteria | 34359 |
| 69 | Ga0105245_10006117 | 3300009098 | Bacteria | 10584 |
| 70 | Ga0105245_10011455 | 3300009098 | Bacteria | 7723 |
| 71 | Ga0105243_10196007 | 3300009148 | Bacteria | 1768 |
| 72 | Ga0105248_10000118 | 3300009177 | Bacteria | 90018 |
| 73 | Ga0105238_10000011 | 3300009551 | Bacteria | 261080 |
| 74 | Ga0105249_10000068 | 3300009553 | Bacteria | 148594 |
| 75 | Ga0105249_10026979 | 3300009553 | Bacteria | 5180 |
| 76 | Ga0157371_10008951 | 3300013102 | Bacteria | 7921 |
| 77 | Ga0157370_10096608 | 3300013104 | Bacteria | 2772 |
| 78 | Ga0157374_10002990 | 3300013296 | Bacteria | 14146 |
| 79 | Ga0157374_10433586 | 3300013296 | Unclassified | 1314 |
| 80 | Ga0157372_10000409 | 3300013307 | Bacteria | 47021 |
| 81 | Ga0157375_10000367 | 3300013308 | Bacteria | 41173 |
| 82 | Ga0163163_10208706 | 3300014325 | Bacteria | 2002 |
| 83 | Ga0157380_10000059 | 3300014326 | Bacteria | 62280 |
| 84 | Ga0157380_10008211 | 3300014326 | Bacteria | 7439 |
| 85 | Ga0157379_10012785 | 3300014968 | Bacteria | 7341 |
| 86 | Ga0163161_10000032 | 3300017792 | Bacteria | 165511 |
| 87 | Ga0207656_10002114 | 3300025321 | Bacteria | 6635 |
| 88 | Ga0207656_10011983 | 3300025321 | Bacteria | 3288 |
| 89 | Ga0207682_10000206 | 3300025893 | Bacteria | 26843 |
| 90 | Ga0207642_10000006 | 3300025899 | Bacteria | 230268 |
| 91 | Ga0207642_10000007 | 3300025899 | Bacteria | 226017 |
| 92 | Ga0207642_10000222 | 3300025899 | Bacteria | 16787 |
| 93 | Ga0207680_10079830 | 3300025903 | Bacteria | 2053 |
| 94 | Ga0207685_10000011 | 3300025905 | Bacteria | 213430 |
| 95 | Ga0207685_10033271 | 3300025905 | Unclassified | 1862 |
| 96 | Ga0207705_10134104 | 3300025909 | Unclassified | 1845 |
| 97 | Ga0207707_10026539 | 3300025912 | Bacteria | 5063 |
| 98 | Ga0207693_10002622 | 3300025915 | Bacteria | 15629 |
| 99 | Ga0207663_10001693 | 3300025916 | Bacteria | 10365 |
| 100 | Ga0207649_10000076 | 3300025920 | Bacteria | 83824 |
| 101 | Ga0207652_10000483 | 3300025921 | Bacteria | 40881 |
| 102 | Ga0207694_10000004 | 3300025924 | Bacteria | 967075 |
| 103 | Ga0207650_10094729 | 3300025925 | Bacteria | 2288 |
| 104 | Ga0207659_10000010 | 3300025926 | Bacteria | 286639 |
| 105 | Ga0207687_10000007 | 3300025927 | Bacteria | 604185 |
| 106 | Ga0207687_10000018 | 3300025927 | Bacteria | 236159 |
| 107 | Ga0207687_10018640 | 3300025927 | Bacteria | 4585 |
| 108 | Ga0207687_10148620 | 3300025927 | Unclassified | 1785 |
| 109 | Ga0207700_10000025 | 3300025928 | Bacteria | 147429 |
| 110 | Ga0207664_10122964 | 3300025929 | Bacteria | 2174 |
| 111 | Ga0207706_10000068 | 3300025933 | Bacteria | 105795 |
| 112 | Ga0207709_10059785 | 3300025935 | Bacteria | 2373 |
| 113 | Ga0207670_10255157 | 3300025936 | Bacteria | 1357 |
| 114 | Ga0207669_10000004 | 3300025937 | Bacteria | 196828 |
| 115 | Ga0207669_10000012 | 3300025937 | Bacteria | 138242 |
| 116 | Ga0207669_10062649 | 3300025937 | Bacteria | 2292 |
| 117 | Ga0207704_10000146 | 3300025938 | Bacteria | 37894 |
| 118 | Ga0207691_10000190 | 3300025940 | Bacteria | 58438 |
| 119 | Ga0207711_10000020 | 3300025941 | Bacteria | 363325 |
| 120 | Ga0207661_10000492 | 3300025944 | Bacteria | 25390 |
| 121 | Ga0207661_10011186 | 3300025944 | Bacteria | 6491 |
| 122 | Ga0207661_10013761 | 3300025944 | Bacteria | 5909 |
| 123 | Ga0207661_10015563 | 3300025944 | Bacteria | 5601 |
| 124 | Ga0207661_10104055 | 3300025944 | Bacteria | 2390 |
| 125 | Ga0207651_10005233 | 3300025960 | Bacteria | 6632 |
| 126 | Ga0207712_10000007 | 3300025961 | Bacteria | 539589 |
| 127 | Ga0207712_10018816 | 3300025961 | Bacteria | 4503 |
| 128 | Ga0207668_10002301 | 3300025972 | Bacteria | 11150 |
| 129 | Ga0207640_10000015 | 3300025981 | Bacteria | 215411 |
| 130 | Ga0207640_10030237 | 3300025981 | Bacteria | 3334 |
| 131 | Ga0207658_10002223 | 3300025986 | Bacteria | 14411 |
| 132 | Ga0207677_10000372 | 3300026023 | Bacteria | 31162 |
| 133 | Ga0207703_10000040 | 3300026035 | Bacteria | 168191 |
| 134 | Ga0207703_10001815 | 3300026035 | Bacteria | 19030 |
| 135 | Ga0207639_10005404 | 3300026041 | Bacteria | 8640 |
| 136 | Ga0207639_10076286 | 3300026041 | Bacteria | 2639 |
| 137 | Ga0207702_10000607 | 3300026078 | Bacteria | 39638 |
| 138 | Ga0207702_10014913 | 3300026078 | Bacteria | 6446 |
| 139 | Ga0207702_10051333 | 3300026078 | Bacteria | 3485 |
| 140 | Ga0207641_10000094 | 3300026088 | Bacteria | 124545 |
| 141 | Ga0207648_10004376 | 3300026089 | Bacteria | 14522 |
| 142 | Ga0207676_10000016 | 3300026095 | Bacteria | 311561 |
| 143 | Ga0207674_10063095 | 3300026116 | Bacteria | 3741 |
| 144 | Ga0207683_10042652 | 3300026121 | Bacteria | 3963 |
| 145 | Ga0207698_10109603 | 3300026142 | Bacteria | 2311 |
| 146 | Ga0268266_10000020 | 3300028379 | Bacteria | 527065 |
| 147 | Ga0268266_10002949 | 3300028379 | Bacteria | 17563 |
| 148 | Ga0268265_10000555 | 3300028380 | Bacteria | 38092 |
| 149 | Ga0268264_10006502 | 3300028381 | Bacteria | 9842 |
| 150 | Ga0268264_10035012 | 3300028381 | Bacteria | 4134 |
| 151 | Ga0265337_1000002 | 3300028556 | Bacteria | 139247 |
| 152 | Ga0265326_10000007 | 3300028558 | Bacteria | 223057 |
| 153 | Ga0265322_10000001 | 3300028654 | Bacteria | 543854 |
| 154 | Ga0265336_10009760 | 3300028666 | Bacteria | 3308 |
| 155 | Ga0265324_10000309 | 3300029957 | Bacteria | 35875 |
| 156 | Ga0265328_10001155 | 3300031239 | Bacteria | 12164 |
| 157 | Ga0265320_10000002 | 3300031240 | Bacteria | 542875 |
| 158 | Ga0265329_10015065 | 3300031242 | Bacteria | 2711 |
| 159 | Ga0265331_10000774 | 3300031250 | Bacteria | 26605 |
| 160 | Ga0265327_10000011 | 3300031251 | Bacteria | 543807 |
| 161 | Ga0265316_10036634 | 3300031344 | Bacteria | 3966 |
| 162 | Ga0265314_10000058 | 3300031711 | Bacteria | 167476 |
| 163 | Ga0307415_100235936 | 3300032126 | Bacteria | 1476 |
| 164 | Ga0373953_0071371 | 3300035117 | Bacteria | 1433 |
| 165 | Ga0373937_0033726 | 3300036401 | Bacteria | 4652 |
| 166 | Ga0451853_3306025 | 3300041512 | Bacteria | 4072 |
| 167 | Ga0466963_0000023 | 3300044694 | Bacteria | 52546 |
| 168 | Ga0466963_0080878 | 3300044694 | Bacteria | 2200 |
| 169 | Ga0466960_0120008 | 3300044901 | Bacteria | 1376 |
| 170 | Ga0466967_0000027 | 3300045976 | Bacteria | 64265 |
| 171 | Ga0466967_0029185 | 3300045976 | Bacteria | 4614 |
| 172 | Ga0495592_0000036 | 3300046454 | Bacteria | 125461 |
| 173 | Ga0495592_0107570 | 3300046454 | Bacteria | 1978 |
| 174 | Ga0495603_0000097 | 3300046455 | Bacteria | 40321 |
| 175 | Ga0495603_0002329 | 3300046455 | Bacteria | 11149 |
| 176 | Ga0495603_0008466 | 3300046455 | Bacteria | 6213 |
| 177 | Ga0495629_0000189 | 3300046459 | Bacteria | 55743 |
| 178 | Ga0495629_0051523 | 3300046459 | Bacteria | 2881 |
| 179 | Ga0495629_0118400 | 3300046459 | Bacteria | 1845 |
| 180 | Ga0495641_0000003 | 3300046461 | Bacteria | 242879 |
| 181 | Ga0495651_0069950 | 3300046462 | Bacteria | 2671 |
| 182 | Ga0495651_0165147 | 3300046462 | Bacteria | 1582 |
| 183 | Ga0495653_0058813 | 3300046463 | Bacteria | 2921 |
| 184 | Ga0495653_0158912 | 3300046463 | Bacteria | 1571 |
| 185 | Ga0495582_0000029 | 3300046473 | Bacteria | 77919 |
| 186 | Ga0495639_0016083 | 3300046475 | Bacteria | 3245 |
| 187 | Ga0495662_0000650 | 3300046476 | Bacteria | 16301 |
| 188 | Ga0495606_0000221 | 3300046507 | Bacteria | 101157 |
| 189 | Ga0495608_0000031 | 3300046511 | Bacteria | 145255 |
| 190 | Ga0495608_0000305 | 3300046511 | Bacteria | 34510 |
| 191 | Ga0495608_0036339 | 3300046511 | Bacteria | 3317 |
| 192 | Ga0495608_0106134 | 3300046511 | Bacteria | 1808 |
| 193 | Ga0495618_0000004 | 3300046514 | Bacteria | 245690 |
| 194 | Ga0495620_0000210 | 3300046515 | Bacteria | 44013 |
| 195 | Ga0495628_0002459 | 3300046516 | Bacteria | 16708 |
| 196 | Ga0495628_0024082 | 3300046516 | Bacteria | 4987 |
| 197 | Ga0495628_0087565 | 3300046516 | Bacteria | 2414 |
| 198 | Ga0495630_0000018 | 3300046517 | Bacteria | 186064 |
| 199 | Ga0495630_0137721 | 3300046517 | Bacteria | 1855 |
| 200 | Ga0495644_0001110 | 3300046523 | Bacteria | 11072 |
| 201 | Ga0495640_0025861 | 3300046533 | Bacteria | 4251 |
| 202 | Ga0495586_0002826 | 3300046535 | Bacteria | 9376 |
| 203 | Ga0495645_0006825 | 3300046543 | Bacteria | 7931 |
| 204 | Ga0495645_0121067 | 3300046543 | Bacteria | 1842 |
| 205 | Ga0495645_0193808 | 3300046543 | Bacteria | 1383 |
| 206 | Ga0495656_0000241 | 3300046615 | Bacteria | 19365 |
| 207 | Ga0495668_0061206 | 3300046616 | Bacteria | 2077 |
| 208 | Ga0495634_0000401 | 3300046642 | Bacteria | 42619 |
| 209 | Ga0495634_0002056 | 3300046642 | Bacteria | 17049 |
| 210 | Ga0495634_0009507 | 3300046642 | Bacteria | 7167 |
| 211 | Ga0495634_0034297 | 3300046642 | Bacteria | 3484 |
| 212 | Ga0495634_0231417 | 3300046642 | Bacteria | 1137 |
| 213 | Ga0495625_0000122 | 3300046660 | Bacteria | 121146 |
| 214 | Ga0495635_0000016 | 3300046663 | Bacteria | 214088 |
| 215 | Ga0495588_0000663 | 3300046674 | Bacteria | 15934 |
| 216 | Ga0495657_0000024 | 3300046675 | Bacteria | 145255 |
| 217 | Ga0495657_0010121 | 3300046675 | Bacteria | 7106 |
| 218 | Ga0495599_0014774 | 3300046678 | Bacteria | 4834 |
| 219 | Ga0495599_0106409 | 3300046678 | Bacteria | 1748 |
| 220 | Ga0495647_0000025 | 3300046681 | Bacteria | 65184 |
| 221 | Ga0495647_0002118 | 3300046681 | Bacteria | 6206 |
| 222 | Ga0495647_0004170 | 3300046681 | Bacteria | 4681 |
| 223 | Ga0495658_0000026 | 3300046683 | Bacteria | 77681 |
| 224 | Ga0495658_0008691 | 3300046683 | Bacteria | 5043 |
| 225 | Ga0495669_0000260 | 3300046684 | Bacteria | 30549 |
| 226 | Ga0495613_0000073 | 3300046689 | Bacteria | 98688 |
| 227 | Ga0495613_0000152 | 3300046689 | Bacteria | 68384 |
| 228 | Ga0495613_0067833 | 3300046689 | Bacteria | 2603 |
| 229 | Ga0495613_0101031 | 3300046689 | Bacteria | 2083 |
| 230 | Ga0495624_0000009 | 3300046690 | Bacteria | 145026 |
| 231 | Ga0495624_0000661 | 3300046690 | Bacteria | 26956 |
| 232 | Ga0495624_0058051 | 3300046690 | Bacteria | 2432 |
| 233 | Ga0495649_0001868 | 3300046694 | Bacteria | 15419 |
| 234 | Ga0495600_0002245 | 3300046809 | Bacteria | 11004 |
| 235 | Ga0495600_0003562 | 3300046809 | Bacteria | 9162 |
| 236 | Ga0495600_0111556 | 3300046809 | Bacteria | 1780 |
| 237 | Ga0495604_0000019 | 3300047317 | Bacteria | 175064 |
| 238 | Ga0495604_0000985 | 3300047317 | Bacteria | 23770 |
| 239 | Ga0495674_0000731 | 3300047319 | Bacteria | 31001 |
| 240 | Ga0495672_0055209 | 3300047320 | Bacteria | 2319 |
| 241 | Ga0495672_0075155 | 3300047320 | Bacteria | 1901 |
| 242 | Ga0495676_0001652 | 3300047321 | Bacteria | 19468 |
| 243 | Ga0495680_0000061 | 3300047322 | Bacteria | 90676 |
| 244 | Ga0495680_0000647 | 3300047322 | Bacteria | 39030 |
| 245 | Ga0495680_0085084 | 3300047322 | Bacteria | 2382 |
| 246 | Ga0495680_0133187 | 3300047322 | Bacteria | 1824 |
| 247 | Ga0495675_0000428 | 3300047444 | Bacteria | 28143 |
| 248 | Ga0495593_0223464 | 3300047673 | Bacteria | 945 |
| 249 | Ga0495602_0000021 | 3300048088 | Bacteria | 168585 |
| 250 | Ga0495602_0037753 | 3300048088 | Bacteria | 4477 |
| 251 | Ga0496100_0000002 | 3300048903 | Bacteria | 489057 |
| 252 | Ga0496101_0000001 | 3300048904 | Bacteria | 489057 |
| 253 | Ga0496104_0000009 | 3300048907 | Bacteria | 488055 |
| 254 | Ga0496105_0000027 | 3300048908 | Bacteria | 148197 |
| 255 | Ga0496106_0000149 | 3300048909 | Bacteria | 51656 |
| 256 | Ga0496106_0000955 | 3300048909 | Bacteria | 21074 |
| 257 | Ga0496106_0065561 | 3300048909 | Bacteria | 2765 |
| 258 | Ga0496107_0000013 | 3300048910 | Bacteria | 178284 |
| 259 | Ga0496107_0090426 | 3300048910 | Bacteria | 2236 |
| 260 | Ga0496108_0000001 | 3300048911 | Bacteria | 919044 |
| 261 | Ga0496108_0000132 | 3300048911 | Bacteria | 73888 |
| 262 | Ga0496108_0003860 | 3300048911 | Bacteria | 12036 |
| 263 | Ga0496108_0027854 | 3300048911 | Bacteria | 4671 |
| 264 | Ga0496109_0000003 | 3300048912 | Bacteria | 420862 |
| 265 | Ga0496109_0000007 | 3300048912 | Bacteria | 247554 |
| 266 | Ga0496109_0000028 | 3300048912 | Bacteria | 168138 |
| 267 | Ga0496109_0028496 | 3300048912 | Bacteria | 4994 |
| 268 | Ga0496110_0004281 | 3300048913 | Bacteria | 11045 |
| 269 | Ga0496110_0007855 | 3300048913 | Bacteria | 8546 |
| 270 | Ga0496110_0053016 | 3300048913 | Bacteria | 3564 |
| 271 | Ga0496110_0206003 | 3300048913 | Bacteria | 1788 |
| 272 | Ga0496110_0371373 | 3300048913 | Bacteria | 1303 |
| 273 | Ga0496111_0005935 | 3300048914 | Bacteria | 7879 |
| 274 | Ga0496111_0015168 | 3300048914 | Bacteria | 5281 |
| 275 | Ga0496111_0079758 | 3300048914 | Bacteria | 2388 |
| 276 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 277 | Ga0496112_0008569 | 3300048915 | Bacteria | 9166 |
| 278 | Ga0496112_0096310 | 3300048915 | Bacteria | 2930 |
| 279 | Ga0496113_0000029 | 3300048916 | Bacteria | 61873 |
| 280 | Ga0496113_0034992 | 3300048916 | Bacteria | 3670 |
| 281 | Ga0496113_0320031 | 3300048916 | Bacteria | 1243 |
| 282 | Ga0496114_0009573 | 3300048917 | Bacteria | 7695 |
| 283 | Ga0496114_0105390 | 3300048917 | Bacteria | 2411 |
| 284 | Ga0501072_0014261 | 3300049588 | Bacteria | 6089 |
| 285 | Ga0501075_0000392 | 3300049591 | Bacteria | 25374 |
| 286 | nmdc:mga0qj67_60234_c1 | 3300050509 | Bacteria | 3012 |
| 287 | nmdc:mga0a205_11_c1 | 3300050515 | Bacteria | 121735 |
| 288 | nmdc:mga0a205_437_c2 | 3300050515 | Bacteria | 25944 |
| 289 | Ga0495601_0000039 | 3300053077 | Bacteria | 79594 |
| 290 | Ga0495601_0003202 | 3300053077 | Bacteria | 9364 |
| 291 | Ga0495601_0075506 | 3300053077 | Bacteria | 2157 |
| 292 | Ga0495601_0091201 | 3300053077 | Bacteria | 1962 |
| 293 | Ga0495601_0176949 | 3300053077 | Bacteria | 1395 |
| 294 | Ga0495612_0000098 | 3300053078 | Bacteria | 37601 |
| 295 | Ga0495612_0001743 | 3300053078 | Bacteria | 8910 |
| 296 | Ga0495612_0042526 | 3300053078 | Bacteria | 1855 |
| 297 | Ga0495655_0005988 | 3300053083 | Bacteria | 2182 |
| 298 | Ga0495595_0000014 | 3300053084 | Bacteria | 145255 |
| 299 | Ga0495595_0000658 | 3300053084 | Bacteria | 13138 |
| 300 | Ga0495619_0000021 | 3300053085 | Bacteria | 187095 |
| 301 | Ga0495619_0000055 | 3300053085 | Bacteria | 95570 |
| 302 | Ga0495619_0000147 | 3300053085 | Bacteria | 51947 |
| 303 | Ga0495619_0000534 | 3300053085 | Bacteria | 25127 |
| 304 | Ga0495619_0003046 | 3300053085 | Bacteria | 10884 |
| 305 | Ga0495619_0025808 | 3300053085 | Bacteria | 3776 |
| 306 | Ga0495619_0062933 | 3300053085 | Bacteria | 2471 |
| 307 | Ga0500614_000026 | 3300053123 | Bacteria | 35584 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047673 | Ga0495593_0223464 | Ga0495593_0223464_14_928 | 271 |
| 2 | 3300013308 | Ga0157375_10000367 | Ga0157375_100003672 | 279 |
| 3 | 3300046463 | Ga0495653_0058813 | Ga0495653_0058813_109_1110 | 279 |
| 4 | 3300005356 | Ga0070674_100000008 | Ga0070674_100000008110 | 280 |
| 5 | 3300005718 | Ga0068866_10000597 | Ga0068866_100005972 | 280 |
| 6 | 3300009148 | Ga0105243_10196007 | Ga0105243_101960072 | 280 |
| 7 | 3300025899 | Ga0207642_10000222 | Ga0207642_100002221 | 281 |
| 8 | 3300025935 | Ga0207709_10059785 | Ga0207709_100597852 | 281 |
| 9 | 3300025937 | Ga0207669_10000004 | Ga0207669_1000000496 | 281 |
| 10 | 3300046660 | Ga0495625_0000122 | Ga0495625_0000122_16304_17296 | 281 |
| 11 | 3300041512 | Ga0451853_3306025 | Ga0451853_3306025_475_1476 | 284 |
| 12 | 3300046809 | Ga0495600_0111556 | Ga0495600_0111556_551_1552 | 284 |
| 13 | 3300046690 | Ga0495624_0000009 | Ga0495624_0000009_133287_134288 | 286 |
| 14 | 3300005367 | Ga0070667_100000695 | Ga0070667_10000069524 | 288 |
| 15 | 3300005539 | Ga0068853_100002766 | Ga0068853_1000027665 | 288 |
| 16 | 3300009553 | Ga0105249_10026979 | Ga0105249_100269794 | 288 |
| 17 | 3300025972 | Ga0207668_10002301 | Ga0207668_100023014 | 288 |
| 18 | 3300026041 | Ga0207639_10005404 | Ga0207639_100054042 | 288 |
| 19 | 3300046543 | Ga0495645_0193808 | Ga0495645_0193808_118_1119 | 288 |
| 20 | 3300047322 | Ga0495680_0000061 | Ga0495680_0000061_88770_89771 | 288 |
| 21 | 3300048913 | Ga0496110_0004281 | Ga0496110_0004281_3986_4987 | 288 |
| 22 | 3300053085 | Ga0495619_0000021 | Ga0495619_0000021_115856_116893 | 288 |
| 23 | 3300048907 | Ga0496104_0000009 | Ga0496104_0000009_22620_23621 | 289 |
| 24 | 3300048908 | Ga0496105_0000027 | Ga0496105_0000027_124904_125905 | 289 |
| 25 | 3300053077 | Ga0495601_0003202 | Ga0495601_0003202_6852_7853 | 289 |
| 26 | 3300005548 | Ga0070665_100000244 | Ga0070665_10000024453 | 290 |
| 27 | 3300005842 | Ga0068858_100001207 | Ga0068858_10000120712 | 290 |
| 28 | 3300026035 | Ga0207703_10001815 | Ga0207703_1000181517 | 290 |
| 29 | 3300028379 | Ga0268266_10000020 | Ga0268266_1000002051 | 290 |
| 30 | 3300046694 | Ga0495649_0001868 | Ga0495649_0001868_2723_3724 | 290 |
| 31 | 3300025961 | Ga0207712_10018816 | Ga0207712_100188164 | 291 |
| 32 | 3300025986 | Ga0207658_10002223 | Ga0207658_100022236 | 291 |
| 33 | 3300028380 | Ga0268265_10000555 | Ga0268265_1000055510 | 291 |
| 34 | 3300028381 | Ga0268264_10035012 | Ga0268264_100350123 | 291 |
| 35 | 3300048916 | Ga0496113_0320031 | Ga0496113_0320031_262_1227 | 291 |
| 36 | 3300049588 | Ga0501072_0014261 | Ga0501072_0014261_1824_2846 | 291 |
| 37 | 3300046462 | Ga0495651_0165147 | Ga0495651_0165147_219_1226 | 292 |
| 38 | 3300053078 | Ga0495612_0001743 | Ga0495612_0001743_2670_3671 | 292 |
| 39 | 3300003203 | JGI25406J46586_10061358 | JGI25406J46586_100613581 | 293 |
| 40 | 3300005985 | Ga0081539_10003705 | Ga0081539_100037054 | 293 |
| 41 | 3300046684 | Ga0495669_0000260 | Ga0495669_0000260_7086_8087 | 293 |
| 42 | 3300046454 | Ga0495592_0107570 | Ga0495592_0107570_784_1791 | 294 |
| 43 | 3300048903 | Ga0496100_0000002 | Ga0496100_0000002_195534_196535 | 294 |
| 44 | 3300048904 | Ga0496101_0000001 | Ga0496101_0000001_195534_196535 | 294 |
| 45 | 3300048909 | Ga0496106_0000955 | Ga0496106_0000955_18851_19852 | 294 |
| 46 | 3300048910 | Ga0496107_0000013 | Ga0496107_0000013_23256_24257 | 294 |
| 47 | 3300046543 | Ga0495645_0006825 | Ga0495645_0006825_3744_4748 | 295 |
| 48 | 3300009098 | Ga0105245_10000016 | Ga0105245_10000016156 | 296 |
| 49 | 3300025927 | Ga0207687_10000018 | Ga0207687_1000001868 | 296 |
| 50 | 3300050509 | nmdc:mga0qj67_60234_c1 | nmdc:mga0qj67_60234_c1_1144_2142 | 296 |
| 51 | 3300053078 | Ga0495612_0042526 | Ga0495612_0042526_391_1395 | 296 |
| 52 | 3300005578 | Ga0068854_100029227 | Ga0068854_1000292273 | 297 |
| 53 | 3300013104 | Ga0157370_10096608 | Ga0157370_100966082 | 297 |
| 54 | 3300025981 | Ga0207640_10030237 | Ga0207640_100302373 | 297 |
| 55 | 3300046459 | Ga0495629_0051523 | Ga0495629_0051523_1835_2839 | 297 |
| 56 | 3300005333 | Ga0070677_10000195 | Ga0070677_1000019518 | 298 |
| 57 | 3300005842 | Ga0068858_100000267 | Ga0068858_10000026748 | 298 |
| 58 | 3300025893 | Ga0207682_10000206 | Ga0207682_1000020618 | 298 |
| 59 | 3300026035 | Ga0207703_10000040 | Ga0207703_10000040102 | 298 |
| 60 | 3300046642 | Ga0495634_0009507 | Ga0495634_0009507_2611_3615 | 299 |
| 61 | 3300048911 | Ga0496108_0003860 | Ga0496108_0003860_3175_4176 | 299 |
| 62 | 3300048913 | Ga0496110_0206003 | Ga0496110_0206003_618_1622 | 299 |
| 63 | 3300048915 | Ga0496112_0096310 | Ga0496112_0096310_1454_2458 | 299 |
| 64 | 3300048916 | Ga0496113_0034992 | Ga0496113_0034992_312_1313 | 299 |
| 65 | 3300005614 | Ga0068856_100036947 | Ga0068856_1000369474 | 300 |
| 66 | 3300026078 | Ga0207702_10014913 | Ga0207702_100149134 | 300 |
| 67 | 3300046535 | Ga0495586_0002826 | Ga0495586_0002826_2361_3362 | 300 |
| 68 | 3300005614 | Ga0068856_100026831 | Ga0068856_1000268314 | 301 |
| 69 | 3300009098 | Ga0105245_10000545 | Ga0105245_1000054514 | 301 |
| 70 | 3300009098 | Ga0105245_10006117 | Ga0105245_100061174 | 301 |
| 71 | 3300009177 | Ga0105248_10000118 | Ga0105248_1000011840 | 301 |
| 72 | 3300013102 | Ga0157371_10008951 | Ga0157371_100089516 | 301 |
| 73 | 3300013307 | Ga0157372_10000409 | Ga0157372_1000040910 | 301 |
| 74 | 3300025941 | Ga0207711_10000020 | Ga0207711_10000020111 | 301 |
| 75 | 3300026078 | Ga0207702_10000607 | Ga0207702_100006078 | 301 |
| 76 | 3300045976 | Ga0466967_0000027 | Ga0466967_0000027_30892_31887 | 301 |
| 77 | 3300046475 | Ga0495639_0016083 | Ga0495639_0016083_702_1703 | 301 |
| 78 | 3300046642 | Ga0495634_0000401 | Ga0495634_0000401_18549_19559 | 301 |
| 79 | 3300046642 | Ga0495634_0231417 | Ga0495634_0231417_118_1119 | 301 |
| 80 | 3300046683 | Ga0495658_0008691 | Ga0495658_0008691_1860_2855 | 301 |
| 81 | 3300046689 | Ga0495613_0101031 | Ga0495613_0101031_979_1980 | 301 |
| 82 | 3300048911 | Ga0496108_0000132 | Ga0496108_0000132_34295_35290 | 301 |
| 83 | 3300048912 | Ga0496109_0000007 | Ga0496109_0000007_141129_142124 | 301 |
| 84 | 3300048915 | Ga0496112_0008569 | Ga0496112_0008569_3589_4584 | 301 |
| 85 | 3300048916 | Ga0496113_0000029 | Ga0496113_0000029_49891_50886 | 301 |
| 86 | 3300053085 | Ga0495619_0000055 | Ga0495619_0000055_59533_60528 | 301 |
| 87 | 3300005356 | Ga0070674_100201818 | Ga0070674_1002018181 | 302 |
| 88 | 3300006237 | Ga0097621_100255085 | Ga0097621_1002550852 | 302 |
| 89 | 3300006358 | Ga0068871_100105794 | Ga0068871_1001057942 | 302 |
| 90 | 3300025937 | Ga0207669_10062649 | Ga0207669_100626492 | 302 |
| 91 | 3300025944 | Ga0207661_10104055 | Ga0207661_101040552 | 302 |
| 92 | 3300045976 | Ga0466967_0029185 | Ga0466967_0029185_800_1816 | 302 |
| 93 | 3300046459 | Ga0495629_0000189 | Ga0495629_0000189_24654_25649 | 302 |
| 94 | 3300046517 | Ga0495630_0000018 | Ga0495630_0000018_126993_127988 | 302 |
| 95 | 3300046674 | Ga0495588_0000663 | Ga0495588_0000663_14548_15543 | 302 |
| 96 | 3300046681 | Ga0495647_0002118 | Ga0495647_0002118_1568_2563 | 302 |
| 97 | 3300046690 | Ga0495624_0000661 | Ga0495624_0000661_7231_8226 | 302 |
| 98 | 3300047322 | Ga0495680_0085084 | Ga0495680_0085084_1233_2234 | 302 |
| 99 | 3300005439 | Ga0070711_100003353 | Ga0070711_1000033536 | 303 |
| 100 | 3300013296 | Ga0157374_10433586 | Ga0157374_104335862 | 303 |
| 101 | 3300025916 | Ga0207663_10001693 | Ga0207663_100016934 | 303 |
| 102 | 3300044694 | Ga0466963_0080878 | Ga0466963_0080878_391_1389 | 303 |
| 103 | 3300003659 | JGI25404J52841_10004672 | JGI25404J52841_100046721 | 304 |
| 104 | 3300005331 | Ga0070670_100040566 | Ga0070670_1000405662 | 304 |
| 105 | 3300005337 | Ga0070682_100000045 | Ga0070682_10000004510 | 304 |
| 106 | 3300005365 | Ga0070688_100001548 | Ga0070688_1000015488 | 304 |
| 107 | 3300005466 | Ga0070685_10000282 | Ga0070685_1000028210 | 304 |
| 108 | 3300005578 | Ga0068854_100000031 | Ga0068854_10000003181 | 304 |
| 109 | 3300005834 | Ga0068851_10003973 | Ga0068851_100039733 | 304 |
| 110 | 3300005983 | Ga0081540_1000006 | Ga0081540_1000006196 | 304 |
| 111 | 3300006163 | Ga0070715_10064836 | Ga0070715_100648362 | 304 |
| 112 | 3300006881 | Ga0068865_100007424 | Ga0068865_1000074244 | 304 |
| 113 | 3300025321 | Ga0207656_10002114 | Ga0207656_100021144 | 304 |
| 114 | 3300025905 | Ga0207685_10033271 | Ga0207685_100332712 | 304 |
| 115 | 3300025925 | Ga0207650_10094729 | Ga0207650_100947294 | 304 |
| 116 | 3300025927 | Ga0207687_10000007 | Ga0207687_10000007252 | 304 |
| 117 | 3300025927 | Ga0207687_10148620 | Ga0207687_101486202 | 304 |
| 118 | 3300025938 | Ga0207704_10000146 | Ga0207704_1000014642 | 304 |
| 119 | 3300025981 | Ga0207640_10000015 | Ga0207640_10000015135 | 304 |
| 120 | 3300026041 | Ga0207639_10076286 | Ga0207639_100762862 | 304 |
| 121 | 3300046642 | Ga0495634_0034297 | Ga0495634_0034297_1870_2880 | 304 |
| 122 | 3300047321 | Ga0495676_0001652 | Ga0495676_0001652_11605_12606 | 304 |
| 123 | 3300053077 | Ga0495601_0091201 | Ga0495601_0091201_437_1447 | 304 |
| 124 | 3300053085 | Ga0495619_0025808 | Ga0495619_0025808_1089_2099 | 304 |
| 125 | 3300025903 | Ga0207680_10079830 | Ga0207680_100798302 | 305 |
| 126 | 3300044901 | Ga0466960_0120008 | Ga0466960_0120008_299_1300 | 305 |
| 127 | 3300046473 | Ga0495582_0000029 | Ga0495582_0000029_36111_37112 | 305 |
| 128 | 3300046515 | Ga0495620_0000210 | Ga0495620_0000210_37782_38783 | 305 |
| 129 | 3300046683 | Ga0495658_0000026 | Ga0495658_0000026_40831_41832 | 305 |
| 130 | 3300048913 | Ga0496110_0007855 | Ga0496110_0007855_84_1079 | 305 |
| 131 | 3300048914 | Ga0496111_0005935 | Ga0496111_0005935_216_1211 | 305 |
| 132 | 3300005341 | Ga0070691_10015391 | Ga0070691_100153914 | 306 |
| 133 | 3300017792 | Ga0163161_10000032 | Ga0163161_10000032110 | 306 |
| 134 | 3300046511 | Ga0495608_0000305 | Ga0495608_0000305_31956_32966 | 306 |
| 135 | 3300046681 | Ga0495647_0004170 | Ga0495647_0004170_1347_2357 | 306 |
| 136 | 3300047320 | Ga0495672_0075155 | Ga0495672_0075155_454_1446 | 306 |
| 137 | 3300005329 | Ga0070683_100272178 | Ga0070683_1002721782 | 307 |
| 138 | 3300005457 | Ga0070662_100000016 | Ga0070662_10000001658 | 307 |
| 139 | 3300005618 | Ga0068864_100000045 | Ga0068864_10000004535 | 307 |
| 140 | 3300006175 | Ga0070712_100001071 | Ga0070712_1000010713 | 307 |
| 141 | 3300006852 | Ga0075433_10000339 | Ga0075433_1000033915 | 307 |
| 142 | 3300006852 | Ga0075433_10050642 | Ga0075433_100506424 | 307 |
| 143 | 3300014326 | Ga0157380_10000059 | Ga0157380_1000005914 | 307 |
| 144 | 3300014968 | Ga0157379_10012785 | Ga0157379_100127854 | 307 |
| 145 | 3300025915 | Ga0207693_10002622 | Ga0207693_1000262214 | 307 |
| 146 | 3300025933 | Ga0207706_10000068 | Ga0207706_1000006858 | 307 |
| 147 | 3300026078 | Ga0207702_10051333 | Ga0207702_100513332 | 307 |
| 148 | 3300026095 | Ga0207676_10000016 | Ga0207676_10000016128 | 307 |
| 149 | 3300035117 | Ga0373953_0071371 | Ga0373953_0071371_262_1263 | 307 |
| 150 | 3300036401 | Ga0373937_0033726 | Ga0373937_0033726_3298_4299 | 307 |
| 151 | 3300046461 | Ga0495641_0000003 | Ga0495641_0000003_214764_215765 | 307 |
| 152 | 3300046507 | Ga0495606_0000221 | Ga0495606_0000221_45256_46251 | 307 |
| 153 | 3300046511 | Ga0495608_0000031 | Ga0495608_0000031_130893_131888 | 307 |
| 154 | 3300046511 | Ga0495608_0036339 | Ga0495608_0036339_1151_2152 | 307 |
| 155 | 3300046511 | Ga0495608_0106134 | Ga0495608_0106134_135_1136 | 307 |
| 156 | 3300046675 | Ga0495657_0000024 | Ga0495657_0000024_130893_131888 | 307 |
| 157 | 3300046678 | Ga0495599_0014774 | Ga0495599_0014774_1829_2830 | 307 |
| 158 | 3300046689 | Ga0495613_0000073 | Ga0495613_0000073_16925_17920 | 307 |
| 159 | 3300046690 | Ga0495624_0058051 | Ga0495624_0058051_919_1929 | 307 |
| 160 | 3300046809 | Ga0495600_0003562 | Ga0495600_0003562_7980_8975 | 307 |
| 161 | 3300047317 | Ga0495604_0000019 | Ga0495604_0000019_54483_55484 | 307 |
| 162 | 3300047317 | Ga0495604_0000985 | Ga0495604_0000985_10062_11057 | 307 |
| 163 | 3300047320 | Ga0495672_0055209 | Ga0495672_0055209_743_1738 | 307 |
| 164 | 3300047444 | Ga0495675_0000428 | Ga0495675_0000428_13368_14363 | 307 |
| 165 | 3300048088 | Ga0495602_0000021 | Ga0495602_0000021_108523_109518 | 307 |
| 166 | 3300048912 | Ga0496109_0000028 | Ga0496109_0000028_39764_40765 | 307 |
| 167 | 3300048914 | Ga0496111_0015168 | Ga0496111_0015168_353_1348 | 307 |
| 168 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_136416_137426 | 307 |
| 169 | 3300048917 | Ga0496114_0009573 | Ga0496114_0009573_5552_6553 | 307 |
| 170 | 3300048917 | Ga0496114_0105390 | Ga0496114_0105390_1165_2160 | 307 |
| 171 | 3300050515 | nmdc:mga0a205_11_c1 | nmdc:mga0a205_11_c1_43195_44205 | 307 |
| 172 | 3300050515 | nmdc:mga0a205_437_c2 | nmdc:mga0a205_437_c2_22869_23864 | 307 |
| 173 | 3300053077 | Ga0495601_0000039 | Ga0495601_0000039_6179_7174 | 307 |
| 174 | 3300053083 | Ga0495655_0005988 | Ga0495655_0005988_586_1581 | 307 |
| 175 | 3300053084 | Ga0495595_0000014 | Ga0495595_0000014_13368_14363 | 307 |
| 176 | 3300053084 | Ga0495595_0000658 | Ga0495595_0000658_10597_11607 | 307 |
| 177 | 3300053085 | Ga0495619_0000147 | Ga0495619_0000147_13368_14363 | 307 |
| 178 | 3300053085 | Ga0495619_0003046 | Ga0495619_0003046_764_1765 | 307 |
| 179 | 3300053123 | Ga0500614_000026 | Ga0500614_000026_19086_20087 | 307 |
| 180 | 3300002074 | JGI24748J21848_1000923 | JGI24748J21848_10009232 | 308 |
| 181 | 3300005364 | Ga0070673_100011981 | Ga0070673_1000119813 | 308 |
| 182 | 3300005535 | Ga0070684_100081668 | Ga0070684_1000816683 | 308 |
| 183 | 3300009094 | Ga0111539_10392778 | Ga0111539_103927782 | 308 |
| 184 | 3300014325 | Ga0163163_10208706 | Ga0163163_102087063 | 308 |
| 185 | 3300025960 | Ga0207651_10005233 | Ga0207651_100052336 | 308 |
| 186 | 3300046462 | Ga0495651_0069950 | Ga0495651_0069950_195_1205 | 308 |
| 187 | 3300046533 | Ga0495640_0025861 | Ga0495640_0025861_2500_3504 | 308 |
| 188 | 3300046642 | Ga0495634_0002056 | Ga0495634_0002056_5432_6529 | 308 |
| 189 | 3300046681 | Ga0495647_0000025 | Ga0495647_0000025_41940_42941 | 308 |
| 190 | 3300047319 | Ga0495674_0000731 | Ga0495674_0000731_11896_12900 | 308 |
| 191 | 3300047322 | Ga0495680_0000647 | Ga0495680_0000647_1548_2558 | 308 |
| 192 | 3300048088 | Ga0495602_0037753 | Ga0495602_0037753_2242_3243 | 308 |
| 193 | 3300048909 | Ga0496106_0000149 | Ga0496106_0000149_44491_45492 | 308 |
| 194 | 3300048913 | Ga0496110_0053016 | Ga0496110_0053016_2508_3521 | 308 |
| 195 | 3300048914 | Ga0496111_0079758 | Ga0496111_0079758_868_1881 | 308 |
| 196 | 3300005354 | Ga0070675_100000053 | Ga0070675_10000005359 | 309 |
| 197 | 3300005356 | Ga0070674_100000082 | Ga0070674_10000008236 | 309 |
| 198 | 3300005459 | Ga0068867_100068809 | Ga0068867_1000688092 | 309 |
| 199 | 3300005718 | Ga0068866_10000001 | Ga0068866_10000001220 | 309 |
| 200 | 3300005843 | Ga0068860_100015490 | Ga0068860_1000154908 | 309 |
| 201 | 3300006163 | Ga0070715_10000001 | Ga0070715_10000001194 | 309 |
| 202 | 3300025899 | Ga0207642_10000006 | Ga0207642_10000006223 | 309 |
| 203 | 3300025899 | Ga0207642_10000007 | Ga0207642_1000000713 | 309 |
| 204 | 3300025905 | Ga0207685_10000011 | Ga0207685_10000011194 | 309 |
| 205 | 3300025926 | Ga0207659_10000010 | Ga0207659_10000010240 | 309 |
| 206 | 3300025937 | Ga0207669_10000012 | Ga0207669_1000001240 | 309 |
| 207 | 3300025944 | Ga0207661_10011186 | Ga0207661_100111863 | 309 |
| 208 | 3300026089 | Ga0207648_10004376 | Ga0207648_100043763 | 309 |
| 209 | 3300028381 | Ga0268264_10006502 | Ga0268264_100065022 | 309 |
| 210 | 3300044694 | Ga0466963_0000023 | Ga0466963_0000023_44094_45095 | 309 |
| 211 | 3300046454 | Ga0495592_0000036 | Ga0495592_0000036_51038_52048 | 309 |
| 212 | 3300046455 | Ga0495603_0002329 | Ga0495603_0002329_7787_8788 | 309 |
| 213 | 3300046459 | Ga0495629_0118400 | Ga0495629_0118400_747_1748 | 309 |
| 214 | 3300046476 | Ga0495662_0000650 | Ga0495662_0000650_13782_14792 | 309 |
| 215 | 3300046516 | Ga0495628_0024082 | Ga0495628_0024082_1930_2931 | 309 |
| 216 | 3300046523 | Ga0495644_0001110 | Ga0495644_0001110_2209_3210 | 309 |
| 217 | 3300046615 | Ga0495656_0000241 | Ga0495656_0000241_6101_7111 | 309 |
| 218 | 3300046675 | Ga0495657_0010121 | Ga0495657_0010121_4717_5718 | 309 |
| 219 | 3300047322 | Ga0495680_0133187 | Ga0495680_0133187_26_1036 | 309 |
| 220 | 3300048909 | Ga0496106_0065561 | Ga0496106_0065561_1452_2453 | 309 |
| 221 | 3300048910 | Ga0496107_0090426 | Ga0496107_0090426_259_1260 | 309 |
| 222 | 3300048911 | Ga0496108_0000001 | Ga0496108_0000001_487516_488517 | 309 |
| 223 | 3300048911 | Ga0496108_0027854 | Ga0496108_0027854_593_1594 | 309 |
| 224 | 3300048912 | Ga0496109_0000003 | Ga0496109_0000003_162062_163063 | 309 |
| 225 | 3300048912 | Ga0496109_0028496 | Ga0496109_0028496_2369_3370 | 309 |
| 226 | 3300048913 | Ga0496110_0371373 | Ga0496110_0371373_159_1160 | 309 |
| 227 | 3300053077 | Ga0495601_0075506 | Ga0495601_0075506_470_1471 | 309 |
| 228 | 3300053078 | Ga0495612_0000098 | Ga0495612_0000098_36409_37410 | 309 |
| 229 | 3300005329 | Ga0070683_100017584 | Ga0070683_1000175843 | 310 |
| 230 | 3300005340 | Ga0070689_100066164 | Ga0070689_1000661642 | 310 |
| 231 | 3300005344 | Ga0070661_100000742 | Ga0070661_10000074220 | 310 |
| 232 | 3300005365 | Ga0070688_100254985 | Ga0070688_1002549851 | 310 |
| 233 | 3300005435 | Ga0070714_100145719 | Ga0070714_1001457192 | 310 |
| 234 | 3300005436 | Ga0070713_100000009 | Ga0070713_10000000970 | 310 |
| 235 | 3300005439 | Ga0070711_100134525 | Ga0070711_1001345252 | 310 |
| 236 | 3300005535 | Ga0070684_100069606 | Ga0070684_1000696062 | 310 |
| 237 | 3300005535 | Ga0070684_100086454 | Ga0070684_1000864544 | 310 |
| 238 | 3300005548 | Ga0070665_100069034 | Ga0070665_1000690344 | 310 |
| 239 | 3300005616 | Ga0068852_100347724 | Ga0068852_1003477242 | 310 |
| 240 | 3300005834 | Ga0068851_10005652 | Ga0068851_100056521 | 310 |
| 241 | 3300009098 | Ga0105245_10011455 | Ga0105245_100114556 | 310 |
| 242 | 3300009551 | Ga0105238_10000011 | Ga0105238_1000001110 | 310 |
| 243 | 3300009553 | Ga0105249_10000068 | Ga0105249_1000006850 | 310 |
| 244 | 3300025321 | Ga0207656_10011983 | Ga0207656_100119831 | 310 |
| 245 | 3300025909 | Ga0207705_10134104 | Ga0207705_101341041 | 310 |
| 246 | 3300025920 | Ga0207649_10000076 | Ga0207649_1000007682 | 310 |
| 247 | 3300025924 | Ga0207694_10000004 | Ga0207694_10000004611 | 310 |
| 248 | 3300025927 | Ga0207687_10018640 | Ga0207687_100186404 | 310 |
| 249 | 3300025928 | Ga0207700_10000025 | Ga0207700_1000002570 | 310 |
| 250 | 3300025929 | Ga0207664_10122964 | Ga0207664_101229642 | 310 |
| 251 | 3300025936 | Ga0207670_10255157 | Ga0207670_102551572 | 310 |
| 252 | 3300025940 | Ga0207691_10000190 | Ga0207691_1000019062 | 310 |
| 253 | 3300025944 | Ga0207661_10000492 | Ga0207661_100004928 | 310 |
| 254 | 3300025944 | Ga0207661_10013761 | Ga0207661_100137614 | 310 |
| 255 | 3300025944 | Ga0207661_10015563 | Ga0207661_100155631 | 310 |
| 256 | 3300025961 | Ga0207712_10000007 | Ga0207712_10000007202 | 310 |
| 257 | 3300026116 | Ga0207674_10063095 | Ga0207674_100630952 | 310 |
| 258 | 3300026121 | Ga0207683_10042652 | Ga0207683_100426522 | 310 |
| 259 | 3300026142 | Ga0207698_10109603 | Ga0207698_101096033 | 310 |
| 260 | 3300028379 | Ga0268266_10002949 | Ga0268266_100029495 | 310 |
| 261 | 3300032126 | Ga0307415_100235936 | Ga0307415_1002359362 | 310 |
| 262 | 3300046543 | Ga0495645_0121067 | Ga0495645_0121067_525_1526 | 310 |
| 263 | 3300053077 | Ga0495601_0176949 | Ga0495601_0176949_251_1252 | 310 |
| 264 | 3300053085 | Ga0495619_0000534 | Ga0495619_0000534_8944_9945 | 310 |
| 265 | 3300005336 | Ga0070680_100011928 | Ga0070680_1000119286 | 311 |
| 266 | 3300005337 | Ga0070682_100000013 | Ga0070682_100000013174 | 311 |
| 267 | 3300005338 | Ga0068868_100000151 | Ga0068868_10000015141 | 311 |
| 268 | 3300005458 | Ga0070681_10066295 | Ga0070681_100662953 | 311 |
| 269 | 3300005530 | Ga0070679_100000312 | Ga0070679_10000031210 | 311 |
| 270 | 3300005547 | Ga0070693_100002833 | Ga0070693_1000028336 | 311 |
| 271 | 3300005563 | Ga0068855_100085257 | Ga0068855_1000852572 | 311 |
| 272 | 3300025912 | Ga0207707_10026539 | Ga0207707_100265394 | 311 |
| 273 | 3300025921 | Ga0207652_10000483 | Ga0207652_1000048310 | 311 |
| 274 | 3300026023 | Ga0207677_10000372 | Ga0207677_1000037221 | 311 |
| 275 | 3300046455 | Ga0495603_0008466 | Ga0495603_0008466_2796_3806 | 311 |
| 276 | 3300046514 | Ga0495618_0000004 | Ga0495618_0000004_101578_102588 | 311 |
| 277 | 3300046809 | Ga0495600_0002245 | Ga0495600_0002245_8480_9490 | 311 |
| 278 | 3300005614 | Ga0068856_100272608 | Ga0068856_1002726082 | 312 |
| 279 | 3300005841 | Ga0068863_100000021 | Ga0068863_10000002192 | 312 |
| 280 | 3300014326 | Ga0157380_10008211 | Ga0157380_100082116 | 312 |
| 281 | 3300026088 | Ga0207641_10000094 | Ga0207641_10000094137 | 312 |
| 282 | 3300028556 | Ga0265337_1000002 | Ga0265337_100000222 | 312 |
| 283 | 3300028558 | Ga0265326_10000007 | Ga0265326_1000000781 | 312 |
| 284 | 3300028654 | Ga0265322_10000001 | Ga0265322_10000001224 | 312 |
| 285 | 3300028666 | Ga0265336_10009760 | Ga0265336_100097602 | 312 |
| 286 | 3300029957 | Ga0265324_10000309 | Ga0265324_1000030932 | 312 |
| 287 | 3300031239 | Ga0265328_10001155 | Ga0265328_100011554 | 312 |
| 288 | 3300031240 | Ga0265320_10000002 | Ga0265320_10000002223 | 312 |
| 289 | 3300031242 | Ga0265329_10015065 | Ga0265329_100150654 | 312 |
| 290 | 3300031250 | Ga0265331_10000774 | Ga0265331_100007744 | 312 |
| 291 | 3300031251 | Ga0265327_10000011 | Ga0265327_10000011223 | 312 |
| 292 | 3300031344 | Ga0265316_10036634 | Ga0265316_100366341 | 312 |
| 293 | 3300031711 | Ga0265314_10000058 | Ga0265314_10000058130 | 312 |
| 294 | 3300046455 | Ga0495603_0000097 | Ga0495603_0000097_8375_9385 | 312 |
| 295 | 3300046517 | Ga0495630_0137721 | Ga0495630_0137721_605_1615 | 312 |
| 296 | 3300046678 | Ga0495599_0106409 | Ga0495599_0106409_170_1180 | 312 |
| 297 | 3300046689 | Ga0495613_0000152 | Ga0495613_0000152_6596_7606 | 312 |
| 298 | 3300049591 | Ga0501075_0000392 | Ga0501075_0000392_23655_24665 | 312 |
| 299 | 3300053085 | Ga0495619_0062933 | Ga0495619_0062933_633_1643 | 312 |
| 300 | 3300001977 | JGI24746J21847_1000415 | JGI24746J21847_10004155 | 313 |
| 301 | 3300013296 | Ga0157374_10002990 | Ga0157374_100029904 | 313 |
| 302 | 3300046463 | Ga0495653_0158912 | Ga0495653_0158912_487_1497 | 313 |
| 303 | 3300046516 | Ga0495628_0002459 | Ga0495628_0002459_1031_2041 | 313 |
| 304 | 3300046516 | Ga0495628_0087565 | Ga0495628_0087565_332_1342 | 313 |
| 305 | 3300046616 | Ga0495668_0061206 | Ga0495668_0061206_676_1686 | 313 |
| 306 | 3300046663 | Ga0495635_0000016 | Ga0495635_0000016_52920_53930 | 313 |
| 307 | 3300046689 | Ga0495613_0067833 | Ga0495613_0067833_821_1831 | 313 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5xhw-assembly1.cif.gz_A | crystal structure of hddc from yersinia pseudotuberculosis | 0.8778 | 2 | 240 |
| 4y7u-assembly1.cif.gz_A | structural analysis of muru | 0.8669 | 1 | 246 |
| 4y7v-assembly1.cif.gz_A | structural analysis of muru | 0.8591 | 1 | 246 |
| 7d74-assembly1.cif.gz_G | cryo-em structure of gmppa/gmppb complex bound to gtp (state ii) | 0.856 | 1 | 263 |
| 7d72-assembly1.cif.gz_F | cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose | 0.8539 | 1 | 263 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_L7N6A5_2_240_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.9123 | 2 | 246 | 3.90.550.10 |
| af_L7N6A5_2_240_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8867 | 2 | 246 | 3.90.550.10 |
| af_Q8ILP1_1_241_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8852 | 1 | 249 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8735 | 1 | 231 | 3.90.550.10 |
| af_Q58501_1_209_3.90.550.10 | Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A | 0.8697 | 1 | 231 | 3.90.550.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8EAW9-F1-model_v4 | NDP-sugar synthase | 0.9379 | 1 | 263 |
GO:0005525
GO:0009058 |
| AF-A0A7C6LAE7-F1-model_v4 | NTP transferase domain-containing protein | 0.9344 | 1 | 263 |
GO:0005525
GO:0005975 GO:0009058 GO:0016740 GO:0016868 |
| AF-A5N6V6-F1-model_v4 | Predicted glucose-1-phosphate nucleotidyltransferase containing an additional conserved domain | 0.934 | 1 | 263 |
GO:0005525
GO:0005975 GO:0009058 GO:0016740 GO:0016868 |
| AF-A0A7C4F6P4-F1-model_v4 | Nucleotidyl transferase domain-containing protein | 0.9321 | 1 | 263 |
GO:0005525
GO:0009058 GO:0016868 |
| AF-A0A7C3ZTT6-F1-model_v4 | NDP-sugar synthase | 0.9311 | 1 | 264 |
GO:0005525
GO:0009058 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar