F399014

General Info

Members Datasets Scaffolds Average Seq Length
307 190 307 306

Family's Representative Sequence

Representative Sequence 3300005341|Ga0070691_10015391|Ga0070691_100153914
Length 306
Sequence MRAMVLAAGLGTRLRPITYEMPKPMVPVLNKPVMEHILRLLARHGFSETIANLHWFPELIEGYFGDGSLSYSREEQLLGTSGGVRNAAGFLGDSFLIISGDALTDIDLTAMREFHESHDGIATLAMKRVQDTSQFGVAIVGADGRIQGFQEKPDPSEALSDLANCGIYMFRKEIFDFFPAPGTAKVAGPDDPPGFADWATDVFPALLDGDVPFYSHEIDAYWNDIGNLDELRQGNLDALRGEVDVDPGAPEVSDGVRAASPLDGAELIAPILVGSGVEIGSILLAGTELPPATVMIGGIAAHANKP

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
108 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
109 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
110 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
111 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
146 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
156 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
157 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
172 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
173 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
176 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
177 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
178 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
179 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
180 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 10.75
Rhizosphere 88.6
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000415 3300001977 Bacteria 6338
2 JGI24748J21848_1000923 3300002074 Bacteria 3194
3 JGI25406J46586_10061358 3300003203 Bacteria 1212
4 JGI25404J52841_10004672 3300003659 Bacteria 2791
5 Ga0070683_100017584 3300005329 Bacteria 6320
6 Ga0070683_100272178 3300005329 Unclassified 1611
7 Ga0070670_100040566 3300005331 Bacteria 4002
8 Ga0070677_10000195 3300005333 Bacteria 20886
9 Ga0070680_100011928 3300005336 Bacteria 6742
10 Ga0070682_100000013 3300005337 Bacteria 254641
11 Ga0070682_100000045 3300005337 Bacteria 131960
12 Ga0068868_100000151 3300005338 Bacteria 44963
13 Ga0070689_100066164 3300005340 Bacteria 2816
14 Ga0070691_10015391 3300005341 Bacteria 3515
15 Ga0070661_100000742 3300005344 Bacteria 23671
16 Ga0070675_100000053 3300005354 Bacteria 70601
17 Ga0070674_100000008 3300005356 Bacteria 143844
18 Ga0070674_100000082 3300005356 Bacteria 44418
19 Ga0070674_100201818 3300005356 Bacteria 1536
20 Ga0070673_100011981 3300005364 Bacteria 5939
21 Ga0070688_100001548 3300005365 Bacteria 11509
22 Ga0070688_100254985 3300005365 Bacteria 1250
23 Ga0070667_100000695 3300005367 Bacteria 32405
24 Ga0070714_100145719 3300005435 Bacteria 2130
25 Ga0070713_100000009 3300005436 Bacteria 153056
26 Ga0070711_100003353 3300005439 Bacteria 9323
27 Ga0070711_100134525 3300005439 Bacteria 1846
28 Ga0070662_100000016 3300005457 Bacteria 105820
29 Ga0070681_10066295 3300005458 Bacteria 3579
30 Ga0068867_100068809 3300005459 Bacteria 2643
31 Ga0070685_10000282 3300005466 Bacteria 32605
32 Ga0070679_100000312 3300005530 Bacteria 41159
33 Ga0070684_100069606 3300005535 Bacteria 3095
34 Ga0070684_100081668 3300005535 Bacteria 2861
35 Ga0070684_100086454 3300005535 Bacteria 2783
36 Ga0068853_100002766 3300005539 Bacteria 13247
37 Ga0070693_100002833 3300005547 Bacteria 7982
38 Ga0070665_100000244 3300005548 Bacteria 90284
39 Ga0070665_100069034 3300005548 Bacteria 3542
40 Ga0068855_100085257 3300005563 Bacteria 3656
41 Ga0068854_100000031 3300005578 Bacteria 107298
42 Ga0068854_100029227 3300005578 Bacteria 3815
43 Ga0068856_100026831 3300005614 Bacteria 5617
44 Ga0068856_100036947 3300005614 Bacteria 4790
45 Ga0068856_100272608 3300005614 Bacteria 1708
46 Ga0068852_100347724 3300005616 Bacteria 1447
47 Ga0068864_100000045 3300005618 Bacteria 154739
48 Ga0068866_10000001 3300005718 Bacteria 519680
49 Ga0068866_10000597 3300005718 Bacteria 16444
50 Ga0068851_10003973 3300005834 Bacteria 6624
51 Ga0068851_10005652 3300005834 Bacteria 5681
52 Ga0068863_100000021 3300005841 Bacteria 198088
53 Ga0068858_100000267 3300005842 Bacteria 55818
54 Ga0068858_100001207 3300005842 Bacteria 26780
55 Ga0068860_100015490 3300005843 Bacteria 7445
56 Ga0081540_1000006 3300005983 Bacteria 208724
57 Ga0081539_10003705 3300005985 Bacteria 18213
58 Ga0070715_10000001 3300006163 Bacteria 693690
59 Ga0070715_10064836 3300006163 Unclassified 1615
60 Ga0070712_100001071 3300006175 Bacteria 16531
61 Ga0097621_100255085 3300006237 Bacteria 1537
62 Ga0068871_100105794 3300006358 Bacteria 2362
63 Ga0075433_10000339 3300006852 Bacteria 29053
64 Ga0075433_10050642 3300006852 Bacteria 3616
65 Ga0068865_100007424 3300006881 Bacteria 6746
66 Ga0111539_10392778 3300009094 Bacteria 1616
67 Ga0105245_10000016 3300009098 Bacteria 204372
68 Ga0105245_10000545 3300009098 Bacteria 34359
69 Ga0105245_10006117 3300009098 Bacteria 10584
70 Ga0105245_10011455 3300009098 Bacteria 7723
71 Ga0105243_10196007 3300009148 Bacteria 1768
72 Ga0105248_10000118 3300009177 Bacteria 90018
73 Ga0105238_10000011 3300009551 Bacteria 261080
74 Ga0105249_10000068 3300009553 Bacteria 148594
75 Ga0105249_10026979 3300009553 Bacteria 5180
76 Ga0157371_10008951 3300013102 Bacteria 7921
77 Ga0157370_10096608 3300013104 Bacteria 2772
78 Ga0157374_10002990 3300013296 Bacteria 14146
79 Ga0157374_10433586 3300013296 Unclassified 1314
80 Ga0157372_10000409 3300013307 Bacteria 47021
81 Ga0157375_10000367 3300013308 Bacteria 41173
82 Ga0163163_10208706 3300014325 Bacteria 2002
83 Ga0157380_10000059 3300014326 Bacteria 62280
84 Ga0157380_10008211 3300014326 Bacteria 7439
85 Ga0157379_10012785 3300014968 Bacteria 7341
86 Ga0163161_10000032 3300017792 Bacteria 165511
87 Ga0207656_10002114 3300025321 Bacteria 6635
88 Ga0207656_10011983 3300025321 Bacteria 3288
89 Ga0207682_10000206 3300025893 Bacteria 26843
90 Ga0207642_10000006 3300025899 Bacteria 230268
91 Ga0207642_10000007 3300025899 Bacteria 226017
92 Ga0207642_10000222 3300025899 Bacteria 16787
93 Ga0207680_10079830 3300025903 Bacteria 2053
94 Ga0207685_10000011 3300025905 Bacteria 213430
95 Ga0207685_10033271 3300025905 Unclassified 1862
96 Ga0207705_10134104 3300025909 Unclassified 1845
97 Ga0207707_10026539 3300025912 Bacteria 5063
98 Ga0207693_10002622 3300025915 Bacteria 15629
99 Ga0207663_10001693 3300025916 Bacteria 10365
100 Ga0207649_10000076 3300025920 Bacteria 83824
101 Ga0207652_10000483 3300025921 Bacteria 40881
102 Ga0207694_10000004 3300025924 Bacteria 967075
103 Ga0207650_10094729 3300025925 Bacteria 2288
104 Ga0207659_10000010 3300025926 Bacteria 286639
105 Ga0207687_10000007 3300025927 Bacteria 604185
106 Ga0207687_10000018 3300025927 Bacteria 236159
107 Ga0207687_10018640 3300025927 Bacteria 4585
108 Ga0207687_10148620 3300025927 Unclassified 1785
109 Ga0207700_10000025 3300025928 Bacteria 147429
110 Ga0207664_10122964 3300025929 Bacteria 2174
111 Ga0207706_10000068 3300025933 Bacteria 105795
112 Ga0207709_10059785 3300025935 Bacteria 2373
113 Ga0207670_10255157 3300025936 Bacteria 1357
114 Ga0207669_10000004 3300025937 Bacteria 196828
115 Ga0207669_10000012 3300025937 Bacteria 138242
116 Ga0207669_10062649 3300025937 Bacteria 2292
117 Ga0207704_10000146 3300025938 Bacteria 37894
118 Ga0207691_10000190 3300025940 Bacteria 58438
119 Ga0207711_10000020 3300025941 Bacteria 363325
120 Ga0207661_10000492 3300025944 Bacteria 25390
121 Ga0207661_10011186 3300025944 Bacteria 6491
122 Ga0207661_10013761 3300025944 Bacteria 5909
123 Ga0207661_10015563 3300025944 Bacteria 5601
124 Ga0207661_10104055 3300025944 Bacteria 2390
125 Ga0207651_10005233 3300025960 Bacteria 6632
126 Ga0207712_10000007 3300025961 Bacteria 539589
127 Ga0207712_10018816 3300025961 Bacteria 4503
128 Ga0207668_10002301 3300025972 Bacteria 11150
129 Ga0207640_10000015 3300025981 Bacteria 215411
130 Ga0207640_10030237 3300025981 Bacteria 3334
131 Ga0207658_10002223 3300025986 Bacteria 14411
132 Ga0207677_10000372 3300026023 Bacteria 31162
133 Ga0207703_10000040 3300026035 Bacteria 168191
134 Ga0207703_10001815 3300026035 Bacteria 19030
135 Ga0207639_10005404 3300026041 Bacteria 8640
136 Ga0207639_10076286 3300026041 Bacteria 2639
137 Ga0207702_10000607 3300026078 Bacteria 39638
138 Ga0207702_10014913 3300026078 Bacteria 6446
139 Ga0207702_10051333 3300026078 Bacteria 3485
140 Ga0207641_10000094 3300026088 Bacteria 124545
141 Ga0207648_10004376 3300026089 Bacteria 14522
142 Ga0207676_10000016 3300026095 Bacteria 311561
143 Ga0207674_10063095 3300026116 Bacteria 3741
144 Ga0207683_10042652 3300026121 Bacteria 3963
145 Ga0207698_10109603 3300026142 Bacteria 2311
146 Ga0268266_10000020 3300028379 Bacteria 527065
147 Ga0268266_10002949 3300028379 Bacteria 17563
148 Ga0268265_10000555 3300028380 Bacteria 38092
149 Ga0268264_10006502 3300028381 Bacteria 9842
150 Ga0268264_10035012 3300028381 Bacteria 4134
151 Ga0265337_1000002 3300028556 Bacteria 139247
152 Ga0265326_10000007 3300028558 Bacteria 223057
153 Ga0265322_10000001 3300028654 Bacteria 543854
154 Ga0265336_10009760 3300028666 Bacteria 3308
155 Ga0265324_10000309 3300029957 Bacteria 35875
156 Ga0265328_10001155 3300031239 Bacteria 12164
157 Ga0265320_10000002 3300031240 Bacteria 542875
158 Ga0265329_10015065 3300031242 Bacteria 2711
159 Ga0265331_10000774 3300031250 Bacteria 26605
160 Ga0265327_10000011 3300031251 Bacteria 543807
161 Ga0265316_10036634 3300031344 Bacteria 3966
162 Ga0265314_10000058 3300031711 Bacteria 167476
163 Ga0307415_100235936 3300032126 Bacteria 1476
164 Ga0373953_0071371 3300035117 Bacteria 1433
165 Ga0373937_0033726 3300036401 Bacteria 4652
166 Ga0451853_3306025 3300041512 Bacteria 4072
167 Ga0466963_0000023 3300044694 Bacteria 52546
168 Ga0466963_0080878 3300044694 Bacteria 2200
169 Ga0466960_0120008 3300044901 Bacteria 1376
170 Ga0466967_0000027 3300045976 Bacteria 64265
171 Ga0466967_0029185 3300045976 Bacteria 4614
172 Ga0495592_0000036 3300046454 Bacteria 125461
173 Ga0495592_0107570 3300046454 Bacteria 1978
174 Ga0495603_0000097 3300046455 Bacteria 40321
175 Ga0495603_0002329 3300046455 Bacteria 11149
176 Ga0495603_0008466 3300046455 Bacteria 6213
177 Ga0495629_0000189 3300046459 Bacteria 55743
178 Ga0495629_0051523 3300046459 Bacteria 2881
179 Ga0495629_0118400 3300046459 Bacteria 1845
180 Ga0495641_0000003 3300046461 Bacteria 242879
181 Ga0495651_0069950 3300046462 Bacteria 2671
182 Ga0495651_0165147 3300046462 Bacteria 1582
183 Ga0495653_0058813 3300046463 Bacteria 2921
184 Ga0495653_0158912 3300046463 Bacteria 1571
185 Ga0495582_0000029 3300046473 Bacteria 77919
186 Ga0495639_0016083 3300046475 Bacteria 3245
187 Ga0495662_0000650 3300046476 Bacteria 16301
188 Ga0495606_0000221 3300046507 Bacteria 101157
189 Ga0495608_0000031 3300046511 Bacteria 145255
190 Ga0495608_0000305 3300046511 Bacteria 34510
191 Ga0495608_0036339 3300046511 Bacteria 3317
192 Ga0495608_0106134 3300046511 Bacteria 1808
193 Ga0495618_0000004 3300046514 Bacteria 245690
194 Ga0495620_0000210 3300046515 Bacteria 44013
195 Ga0495628_0002459 3300046516 Bacteria 16708
196 Ga0495628_0024082 3300046516 Bacteria 4987
197 Ga0495628_0087565 3300046516 Bacteria 2414
198 Ga0495630_0000018 3300046517 Bacteria 186064
199 Ga0495630_0137721 3300046517 Bacteria 1855
200 Ga0495644_0001110 3300046523 Bacteria 11072
201 Ga0495640_0025861 3300046533 Bacteria 4251
202 Ga0495586_0002826 3300046535 Bacteria 9376
203 Ga0495645_0006825 3300046543 Bacteria 7931
204 Ga0495645_0121067 3300046543 Bacteria 1842
205 Ga0495645_0193808 3300046543 Bacteria 1383
206 Ga0495656_0000241 3300046615 Bacteria 19365
207 Ga0495668_0061206 3300046616 Bacteria 2077
208 Ga0495634_0000401 3300046642 Bacteria 42619
209 Ga0495634_0002056 3300046642 Bacteria 17049
210 Ga0495634_0009507 3300046642 Bacteria 7167
211 Ga0495634_0034297 3300046642 Bacteria 3484
212 Ga0495634_0231417 3300046642 Bacteria 1137
213 Ga0495625_0000122 3300046660 Bacteria 121146
214 Ga0495635_0000016 3300046663 Bacteria 214088
215 Ga0495588_0000663 3300046674 Bacteria 15934
216 Ga0495657_0000024 3300046675 Bacteria 145255
217 Ga0495657_0010121 3300046675 Bacteria 7106
218 Ga0495599_0014774 3300046678 Bacteria 4834
219 Ga0495599_0106409 3300046678 Bacteria 1748
220 Ga0495647_0000025 3300046681 Bacteria 65184
221 Ga0495647_0002118 3300046681 Bacteria 6206
222 Ga0495647_0004170 3300046681 Bacteria 4681
223 Ga0495658_0000026 3300046683 Bacteria 77681
224 Ga0495658_0008691 3300046683 Bacteria 5043
225 Ga0495669_0000260 3300046684 Bacteria 30549
226 Ga0495613_0000073 3300046689 Bacteria 98688
227 Ga0495613_0000152 3300046689 Bacteria 68384
228 Ga0495613_0067833 3300046689 Bacteria 2603
229 Ga0495613_0101031 3300046689 Bacteria 2083
230 Ga0495624_0000009 3300046690 Bacteria 145026
231 Ga0495624_0000661 3300046690 Bacteria 26956
232 Ga0495624_0058051 3300046690 Bacteria 2432
233 Ga0495649_0001868 3300046694 Bacteria 15419
234 Ga0495600_0002245 3300046809 Bacteria 11004
235 Ga0495600_0003562 3300046809 Bacteria 9162
236 Ga0495600_0111556 3300046809 Bacteria 1780
237 Ga0495604_0000019 3300047317 Bacteria 175064
238 Ga0495604_0000985 3300047317 Bacteria 23770
239 Ga0495674_0000731 3300047319 Bacteria 31001
240 Ga0495672_0055209 3300047320 Bacteria 2319
241 Ga0495672_0075155 3300047320 Bacteria 1901
242 Ga0495676_0001652 3300047321 Bacteria 19468
243 Ga0495680_0000061 3300047322 Bacteria 90676
244 Ga0495680_0000647 3300047322 Bacteria 39030
245 Ga0495680_0085084 3300047322 Bacteria 2382
246 Ga0495680_0133187 3300047322 Bacteria 1824
247 Ga0495675_0000428 3300047444 Bacteria 28143
248 Ga0495593_0223464 3300047673 Bacteria 945
249 Ga0495602_0000021 3300048088 Bacteria 168585
250 Ga0495602_0037753 3300048088 Bacteria 4477
251 Ga0496100_0000002 3300048903 Bacteria 489057
252 Ga0496101_0000001 3300048904 Bacteria 489057
253 Ga0496104_0000009 3300048907 Bacteria 488055
254 Ga0496105_0000027 3300048908 Bacteria 148197
255 Ga0496106_0000149 3300048909 Bacteria 51656
256 Ga0496106_0000955 3300048909 Bacteria 21074
257 Ga0496106_0065561 3300048909 Bacteria 2765
258 Ga0496107_0000013 3300048910 Bacteria 178284
259 Ga0496107_0090426 3300048910 Bacteria 2236
260 Ga0496108_0000001 3300048911 Bacteria 919044
261 Ga0496108_0000132 3300048911 Bacteria 73888
262 Ga0496108_0003860 3300048911 Bacteria 12036
263 Ga0496108_0027854 3300048911 Bacteria 4671
264 Ga0496109_0000003 3300048912 Bacteria 420862
265 Ga0496109_0000007 3300048912 Bacteria 247554
266 Ga0496109_0000028 3300048912 Bacteria 168138
267 Ga0496109_0028496 3300048912 Bacteria 4994
268 Ga0496110_0004281 3300048913 Bacteria 11045
269 Ga0496110_0007855 3300048913 Bacteria 8546
270 Ga0496110_0053016 3300048913 Bacteria 3564
271 Ga0496110_0206003 3300048913 Bacteria 1788
272 Ga0496110_0371373 3300048913 Bacteria 1303
273 Ga0496111_0005935 3300048914 Bacteria 7879
274 Ga0496111_0015168 3300048914 Bacteria 5281
275 Ga0496111_0079758 3300048914 Bacteria 2388
276 Ga0496112_0000003 3300048915 Bacteria 660147
277 Ga0496112_0008569 3300048915 Bacteria 9166
278 Ga0496112_0096310 3300048915 Bacteria 2930
279 Ga0496113_0000029 3300048916 Bacteria 61873
280 Ga0496113_0034992 3300048916 Bacteria 3670
281 Ga0496113_0320031 3300048916 Bacteria 1243
282 Ga0496114_0009573 3300048917 Bacteria 7695
283 Ga0496114_0105390 3300048917 Bacteria 2411
284 Ga0501072_0014261 3300049588 Bacteria 6089
285 Ga0501075_0000392 3300049591 Bacteria 25374
286 nmdc:mga0qj67_60234_c1 3300050509 Bacteria 3012
287 nmdc:mga0a205_11_c1 3300050515 Bacteria 121735
288 nmdc:mga0a205_437_c2 3300050515 Bacteria 25944
289 Ga0495601_0000039 3300053077 Bacteria 79594
290 Ga0495601_0003202 3300053077 Bacteria 9364
291 Ga0495601_0075506 3300053077 Bacteria 2157
292 Ga0495601_0091201 3300053077 Bacteria 1962
293 Ga0495601_0176949 3300053077 Bacteria 1395
294 Ga0495612_0000098 3300053078 Bacteria 37601
295 Ga0495612_0001743 3300053078 Bacteria 8910
296 Ga0495612_0042526 3300053078 Bacteria 1855
297 Ga0495655_0005988 3300053083 Bacteria 2182
298 Ga0495595_0000014 3300053084 Bacteria 145255
299 Ga0495595_0000658 3300053084 Bacteria 13138
300 Ga0495619_0000021 3300053085 Bacteria 187095
301 Ga0495619_0000055 3300053085 Bacteria 95570
302 Ga0495619_0000147 3300053085 Bacteria 51947
303 Ga0495619_0000534 3300053085 Bacteria 25127
304 Ga0495619_0003046 3300053085 Bacteria 10884
305 Ga0495619_0025808 3300053085 Bacteria 3776
306 Ga0495619_0062933 3300053085 Bacteria 2471
307 Ga0500614_000026 3300053123 Bacteria 35584

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047673 Ga0495593_0223464 Ga0495593_0223464_14_928 271
2 3300013308 Ga0157375_10000367 Ga0157375_100003672 279
3 3300046463 Ga0495653_0058813 Ga0495653_0058813_109_1110 279
4 3300005356 Ga0070674_100000008 Ga0070674_100000008110 280
5 3300005718 Ga0068866_10000597 Ga0068866_100005972 280
6 3300009148 Ga0105243_10196007 Ga0105243_101960072 280
7 3300025899 Ga0207642_10000222 Ga0207642_100002221 281
8 3300025935 Ga0207709_10059785 Ga0207709_100597852 281
9 3300025937 Ga0207669_10000004 Ga0207669_1000000496 281
10 3300046660 Ga0495625_0000122 Ga0495625_0000122_16304_17296 281
11 3300041512 Ga0451853_3306025 Ga0451853_3306025_475_1476 284
12 3300046809 Ga0495600_0111556 Ga0495600_0111556_551_1552 284
13 3300046690 Ga0495624_0000009 Ga0495624_0000009_133287_134288 286
14 3300005367 Ga0070667_100000695 Ga0070667_10000069524 288
15 3300005539 Ga0068853_100002766 Ga0068853_1000027665 288
16 3300009553 Ga0105249_10026979 Ga0105249_100269794 288
17 3300025972 Ga0207668_10002301 Ga0207668_100023014 288
18 3300026041 Ga0207639_10005404 Ga0207639_100054042 288
19 3300046543 Ga0495645_0193808 Ga0495645_0193808_118_1119 288
20 3300047322 Ga0495680_0000061 Ga0495680_0000061_88770_89771 288
21 3300048913 Ga0496110_0004281 Ga0496110_0004281_3986_4987 288
22 3300053085 Ga0495619_0000021 Ga0495619_0000021_115856_116893 288
23 3300048907 Ga0496104_0000009 Ga0496104_0000009_22620_23621 289
24 3300048908 Ga0496105_0000027 Ga0496105_0000027_124904_125905 289
25 3300053077 Ga0495601_0003202 Ga0495601_0003202_6852_7853 289
26 3300005548 Ga0070665_100000244 Ga0070665_10000024453 290
27 3300005842 Ga0068858_100001207 Ga0068858_10000120712 290
28 3300026035 Ga0207703_10001815 Ga0207703_1000181517 290
29 3300028379 Ga0268266_10000020 Ga0268266_1000002051 290
30 3300046694 Ga0495649_0001868 Ga0495649_0001868_2723_3724 290
31 3300025961 Ga0207712_10018816 Ga0207712_100188164 291
32 3300025986 Ga0207658_10002223 Ga0207658_100022236 291
33 3300028380 Ga0268265_10000555 Ga0268265_1000055510 291
34 3300028381 Ga0268264_10035012 Ga0268264_100350123 291
35 3300048916 Ga0496113_0320031 Ga0496113_0320031_262_1227 291
36 3300049588 Ga0501072_0014261 Ga0501072_0014261_1824_2846 291
37 3300046462 Ga0495651_0165147 Ga0495651_0165147_219_1226 292
38 3300053078 Ga0495612_0001743 Ga0495612_0001743_2670_3671 292
39 3300003203 JGI25406J46586_10061358 JGI25406J46586_100613581 293
40 3300005985 Ga0081539_10003705 Ga0081539_100037054 293
41 3300046684 Ga0495669_0000260 Ga0495669_0000260_7086_8087 293
42 3300046454 Ga0495592_0107570 Ga0495592_0107570_784_1791 294
43 3300048903 Ga0496100_0000002 Ga0496100_0000002_195534_196535 294
44 3300048904 Ga0496101_0000001 Ga0496101_0000001_195534_196535 294
45 3300048909 Ga0496106_0000955 Ga0496106_0000955_18851_19852 294
46 3300048910 Ga0496107_0000013 Ga0496107_0000013_23256_24257 294
47 3300046543 Ga0495645_0006825 Ga0495645_0006825_3744_4748 295
48 3300009098 Ga0105245_10000016 Ga0105245_10000016156 296
49 3300025927 Ga0207687_10000018 Ga0207687_1000001868 296
50 3300050509 nmdc:mga0qj67_60234_c1 nmdc:mga0qj67_60234_c1_1144_2142 296
51 3300053078 Ga0495612_0042526 Ga0495612_0042526_391_1395 296
52 3300005578 Ga0068854_100029227 Ga0068854_1000292273 297
53 3300013104 Ga0157370_10096608 Ga0157370_100966082 297
54 3300025981 Ga0207640_10030237 Ga0207640_100302373 297
55 3300046459 Ga0495629_0051523 Ga0495629_0051523_1835_2839 297
56 3300005333 Ga0070677_10000195 Ga0070677_1000019518 298
57 3300005842 Ga0068858_100000267 Ga0068858_10000026748 298
58 3300025893 Ga0207682_10000206 Ga0207682_1000020618 298
59 3300026035 Ga0207703_10000040 Ga0207703_10000040102 298
60 3300046642 Ga0495634_0009507 Ga0495634_0009507_2611_3615 299
61 3300048911 Ga0496108_0003860 Ga0496108_0003860_3175_4176 299
62 3300048913 Ga0496110_0206003 Ga0496110_0206003_618_1622 299
63 3300048915 Ga0496112_0096310 Ga0496112_0096310_1454_2458 299
64 3300048916 Ga0496113_0034992 Ga0496113_0034992_312_1313 299
65 3300005614 Ga0068856_100036947 Ga0068856_1000369474 300
66 3300026078 Ga0207702_10014913 Ga0207702_100149134 300
67 3300046535 Ga0495586_0002826 Ga0495586_0002826_2361_3362 300
68 3300005614 Ga0068856_100026831 Ga0068856_1000268314 301
69 3300009098 Ga0105245_10000545 Ga0105245_1000054514 301
70 3300009098 Ga0105245_10006117 Ga0105245_100061174 301
71 3300009177 Ga0105248_10000118 Ga0105248_1000011840 301
72 3300013102 Ga0157371_10008951 Ga0157371_100089516 301
73 3300013307 Ga0157372_10000409 Ga0157372_1000040910 301
74 3300025941 Ga0207711_10000020 Ga0207711_10000020111 301
75 3300026078 Ga0207702_10000607 Ga0207702_100006078 301
76 3300045976 Ga0466967_0000027 Ga0466967_0000027_30892_31887 301
77 3300046475 Ga0495639_0016083 Ga0495639_0016083_702_1703 301
78 3300046642 Ga0495634_0000401 Ga0495634_0000401_18549_19559 301
79 3300046642 Ga0495634_0231417 Ga0495634_0231417_118_1119 301
80 3300046683 Ga0495658_0008691 Ga0495658_0008691_1860_2855 301
81 3300046689 Ga0495613_0101031 Ga0495613_0101031_979_1980 301
82 3300048911 Ga0496108_0000132 Ga0496108_0000132_34295_35290 301
83 3300048912 Ga0496109_0000007 Ga0496109_0000007_141129_142124 301
84 3300048915 Ga0496112_0008569 Ga0496112_0008569_3589_4584 301
85 3300048916 Ga0496113_0000029 Ga0496113_0000029_49891_50886 301
86 3300053085 Ga0495619_0000055 Ga0495619_0000055_59533_60528 301
87 3300005356 Ga0070674_100201818 Ga0070674_1002018181 302
88 3300006237 Ga0097621_100255085 Ga0097621_1002550852 302
89 3300006358 Ga0068871_100105794 Ga0068871_1001057942 302
90 3300025937 Ga0207669_10062649 Ga0207669_100626492 302
91 3300025944 Ga0207661_10104055 Ga0207661_101040552 302
92 3300045976 Ga0466967_0029185 Ga0466967_0029185_800_1816 302
93 3300046459 Ga0495629_0000189 Ga0495629_0000189_24654_25649 302
94 3300046517 Ga0495630_0000018 Ga0495630_0000018_126993_127988 302
95 3300046674 Ga0495588_0000663 Ga0495588_0000663_14548_15543 302
96 3300046681 Ga0495647_0002118 Ga0495647_0002118_1568_2563 302
97 3300046690 Ga0495624_0000661 Ga0495624_0000661_7231_8226 302
98 3300047322 Ga0495680_0085084 Ga0495680_0085084_1233_2234 302
99 3300005439 Ga0070711_100003353 Ga0070711_1000033536 303
100 3300013296 Ga0157374_10433586 Ga0157374_104335862 303
101 3300025916 Ga0207663_10001693 Ga0207663_100016934 303
102 3300044694 Ga0466963_0080878 Ga0466963_0080878_391_1389 303
103 3300003659 JGI25404J52841_10004672 JGI25404J52841_100046721 304
104 3300005331 Ga0070670_100040566 Ga0070670_1000405662 304
105 3300005337 Ga0070682_100000045 Ga0070682_10000004510 304
106 3300005365 Ga0070688_100001548 Ga0070688_1000015488 304
107 3300005466 Ga0070685_10000282 Ga0070685_1000028210 304
108 3300005578 Ga0068854_100000031 Ga0068854_10000003181 304
109 3300005834 Ga0068851_10003973 Ga0068851_100039733 304
110 3300005983 Ga0081540_1000006 Ga0081540_1000006196 304
111 3300006163 Ga0070715_10064836 Ga0070715_100648362 304
112 3300006881 Ga0068865_100007424 Ga0068865_1000074244 304
113 3300025321 Ga0207656_10002114 Ga0207656_100021144 304
114 3300025905 Ga0207685_10033271 Ga0207685_100332712 304
115 3300025925 Ga0207650_10094729 Ga0207650_100947294 304
116 3300025927 Ga0207687_10000007 Ga0207687_10000007252 304
117 3300025927 Ga0207687_10148620 Ga0207687_101486202 304
118 3300025938 Ga0207704_10000146 Ga0207704_1000014642 304
119 3300025981 Ga0207640_10000015 Ga0207640_10000015135 304
120 3300026041 Ga0207639_10076286 Ga0207639_100762862 304
121 3300046642 Ga0495634_0034297 Ga0495634_0034297_1870_2880 304
122 3300047321 Ga0495676_0001652 Ga0495676_0001652_11605_12606 304
123 3300053077 Ga0495601_0091201 Ga0495601_0091201_437_1447 304
124 3300053085 Ga0495619_0025808 Ga0495619_0025808_1089_2099 304
125 3300025903 Ga0207680_10079830 Ga0207680_100798302 305
126 3300044901 Ga0466960_0120008 Ga0466960_0120008_299_1300 305
127 3300046473 Ga0495582_0000029 Ga0495582_0000029_36111_37112 305
128 3300046515 Ga0495620_0000210 Ga0495620_0000210_37782_38783 305
129 3300046683 Ga0495658_0000026 Ga0495658_0000026_40831_41832 305
130 3300048913 Ga0496110_0007855 Ga0496110_0007855_84_1079 305
131 3300048914 Ga0496111_0005935 Ga0496111_0005935_216_1211 305
132 3300005341 Ga0070691_10015391 Ga0070691_100153914 306
133 3300017792 Ga0163161_10000032 Ga0163161_10000032110 306
134 3300046511 Ga0495608_0000305 Ga0495608_0000305_31956_32966 306
135 3300046681 Ga0495647_0004170 Ga0495647_0004170_1347_2357 306
136 3300047320 Ga0495672_0075155 Ga0495672_0075155_454_1446 306
137 3300005329 Ga0070683_100272178 Ga0070683_1002721782 307
138 3300005457 Ga0070662_100000016 Ga0070662_10000001658 307
139 3300005618 Ga0068864_100000045 Ga0068864_10000004535 307
140 3300006175 Ga0070712_100001071 Ga0070712_1000010713 307
141 3300006852 Ga0075433_10000339 Ga0075433_1000033915 307
142 3300006852 Ga0075433_10050642 Ga0075433_100506424 307
143 3300014326 Ga0157380_10000059 Ga0157380_1000005914 307
144 3300014968 Ga0157379_10012785 Ga0157379_100127854 307
145 3300025915 Ga0207693_10002622 Ga0207693_1000262214 307
146 3300025933 Ga0207706_10000068 Ga0207706_1000006858 307
147 3300026078 Ga0207702_10051333 Ga0207702_100513332 307
148 3300026095 Ga0207676_10000016 Ga0207676_10000016128 307
149 3300035117 Ga0373953_0071371 Ga0373953_0071371_262_1263 307
150 3300036401 Ga0373937_0033726 Ga0373937_0033726_3298_4299 307
151 3300046461 Ga0495641_0000003 Ga0495641_0000003_214764_215765 307
152 3300046507 Ga0495606_0000221 Ga0495606_0000221_45256_46251 307
153 3300046511 Ga0495608_0000031 Ga0495608_0000031_130893_131888 307
154 3300046511 Ga0495608_0036339 Ga0495608_0036339_1151_2152 307
155 3300046511 Ga0495608_0106134 Ga0495608_0106134_135_1136 307
156 3300046675 Ga0495657_0000024 Ga0495657_0000024_130893_131888 307
157 3300046678 Ga0495599_0014774 Ga0495599_0014774_1829_2830 307
158 3300046689 Ga0495613_0000073 Ga0495613_0000073_16925_17920 307
159 3300046690 Ga0495624_0058051 Ga0495624_0058051_919_1929 307
160 3300046809 Ga0495600_0003562 Ga0495600_0003562_7980_8975 307
161 3300047317 Ga0495604_0000019 Ga0495604_0000019_54483_55484 307
162 3300047317 Ga0495604_0000985 Ga0495604_0000985_10062_11057 307
163 3300047320 Ga0495672_0055209 Ga0495672_0055209_743_1738 307
164 3300047444 Ga0495675_0000428 Ga0495675_0000428_13368_14363 307
165 3300048088 Ga0495602_0000021 Ga0495602_0000021_108523_109518 307
166 3300048912 Ga0496109_0000028 Ga0496109_0000028_39764_40765 307
167 3300048914 Ga0496111_0015168 Ga0496111_0015168_353_1348 307
168 3300048915 Ga0496112_0000003 Ga0496112_0000003_136416_137426 307
169 3300048917 Ga0496114_0009573 Ga0496114_0009573_5552_6553 307
170 3300048917 Ga0496114_0105390 Ga0496114_0105390_1165_2160 307
171 3300050515 nmdc:mga0a205_11_c1 nmdc:mga0a205_11_c1_43195_44205 307
172 3300050515 nmdc:mga0a205_437_c2 nmdc:mga0a205_437_c2_22869_23864 307
173 3300053077 Ga0495601_0000039 Ga0495601_0000039_6179_7174 307
174 3300053083 Ga0495655_0005988 Ga0495655_0005988_586_1581 307
175 3300053084 Ga0495595_0000014 Ga0495595_0000014_13368_14363 307
176 3300053084 Ga0495595_0000658 Ga0495595_0000658_10597_11607 307
177 3300053085 Ga0495619_0000147 Ga0495619_0000147_13368_14363 307
178 3300053085 Ga0495619_0003046 Ga0495619_0003046_764_1765 307
179 3300053123 Ga0500614_000026 Ga0500614_000026_19086_20087 307
180 3300002074 JGI24748J21848_1000923 JGI24748J21848_10009232 308
181 3300005364 Ga0070673_100011981 Ga0070673_1000119813 308
182 3300005535 Ga0070684_100081668 Ga0070684_1000816683 308
183 3300009094 Ga0111539_10392778 Ga0111539_103927782 308
184 3300014325 Ga0163163_10208706 Ga0163163_102087063 308
185 3300025960 Ga0207651_10005233 Ga0207651_100052336 308
186 3300046462 Ga0495651_0069950 Ga0495651_0069950_195_1205 308
187 3300046533 Ga0495640_0025861 Ga0495640_0025861_2500_3504 308
188 3300046642 Ga0495634_0002056 Ga0495634_0002056_5432_6529 308
189 3300046681 Ga0495647_0000025 Ga0495647_0000025_41940_42941 308
190 3300047319 Ga0495674_0000731 Ga0495674_0000731_11896_12900 308
191 3300047322 Ga0495680_0000647 Ga0495680_0000647_1548_2558 308
192 3300048088 Ga0495602_0037753 Ga0495602_0037753_2242_3243 308
193 3300048909 Ga0496106_0000149 Ga0496106_0000149_44491_45492 308
194 3300048913 Ga0496110_0053016 Ga0496110_0053016_2508_3521 308
195 3300048914 Ga0496111_0079758 Ga0496111_0079758_868_1881 308
196 3300005354 Ga0070675_100000053 Ga0070675_10000005359 309
197 3300005356 Ga0070674_100000082 Ga0070674_10000008236 309
198 3300005459 Ga0068867_100068809 Ga0068867_1000688092 309
199 3300005718 Ga0068866_10000001 Ga0068866_10000001220 309
200 3300005843 Ga0068860_100015490 Ga0068860_1000154908 309
201 3300006163 Ga0070715_10000001 Ga0070715_10000001194 309
202 3300025899 Ga0207642_10000006 Ga0207642_10000006223 309
203 3300025899 Ga0207642_10000007 Ga0207642_1000000713 309
204 3300025905 Ga0207685_10000011 Ga0207685_10000011194 309
205 3300025926 Ga0207659_10000010 Ga0207659_10000010240 309
206 3300025937 Ga0207669_10000012 Ga0207669_1000001240 309
207 3300025944 Ga0207661_10011186 Ga0207661_100111863 309
208 3300026089 Ga0207648_10004376 Ga0207648_100043763 309
209 3300028381 Ga0268264_10006502 Ga0268264_100065022 309
210 3300044694 Ga0466963_0000023 Ga0466963_0000023_44094_45095 309
211 3300046454 Ga0495592_0000036 Ga0495592_0000036_51038_52048 309
212 3300046455 Ga0495603_0002329 Ga0495603_0002329_7787_8788 309
213 3300046459 Ga0495629_0118400 Ga0495629_0118400_747_1748 309
214 3300046476 Ga0495662_0000650 Ga0495662_0000650_13782_14792 309
215 3300046516 Ga0495628_0024082 Ga0495628_0024082_1930_2931 309
216 3300046523 Ga0495644_0001110 Ga0495644_0001110_2209_3210 309
217 3300046615 Ga0495656_0000241 Ga0495656_0000241_6101_7111 309
218 3300046675 Ga0495657_0010121 Ga0495657_0010121_4717_5718 309
219 3300047322 Ga0495680_0133187 Ga0495680_0133187_26_1036 309
220 3300048909 Ga0496106_0065561 Ga0496106_0065561_1452_2453 309
221 3300048910 Ga0496107_0090426 Ga0496107_0090426_259_1260 309
222 3300048911 Ga0496108_0000001 Ga0496108_0000001_487516_488517 309
223 3300048911 Ga0496108_0027854 Ga0496108_0027854_593_1594 309
224 3300048912 Ga0496109_0000003 Ga0496109_0000003_162062_163063 309
225 3300048912 Ga0496109_0028496 Ga0496109_0028496_2369_3370 309
226 3300048913 Ga0496110_0371373 Ga0496110_0371373_159_1160 309
227 3300053077 Ga0495601_0075506 Ga0495601_0075506_470_1471 309
228 3300053078 Ga0495612_0000098 Ga0495612_0000098_36409_37410 309
229 3300005329 Ga0070683_100017584 Ga0070683_1000175843 310
230 3300005340 Ga0070689_100066164 Ga0070689_1000661642 310
231 3300005344 Ga0070661_100000742 Ga0070661_10000074220 310
232 3300005365 Ga0070688_100254985 Ga0070688_1002549851 310
233 3300005435 Ga0070714_100145719 Ga0070714_1001457192 310
234 3300005436 Ga0070713_100000009 Ga0070713_10000000970 310
235 3300005439 Ga0070711_100134525 Ga0070711_1001345252 310
236 3300005535 Ga0070684_100069606 Ga0070684_1000696062 310
237 3300005535 Ga0070684_100086454 Ga0070684_1000864544 310
238 3300005548 Ga0070665_100069034 Ga0070665_1000690344 310
239 3300005616 Ga0068852_100347724 Ga0068852_1003477242 310
240 3300005834 Ga0068851_10005652 Ga0068851_100056521 310
241 3300009098 Ga0105245_10011455 Ga0105245_100114556 310
242 3300009551 Ga0105238_10000011 Ga0105238_1000001110 310
243 3300009553 Ga0105249_10000068 Ga0105249_1000006850 310
244 3300025321 Ga0207656_10011983 Ga0207656_100119831 310
245 3300025909 Ga0207705_10134104 Ga0207705_101341041 310
246 3300025920 Ga0207649_10000076 Ga0207649_1000007682 310
247 3300025924 Ga0207694_10000004 Ga0207694_10000004611 310
248 3300025927 Ga0207687_10018640 Ga0207687_100186404 310
249 3300025928 Ga0207700_10000025 Ga0207700_1000002570 310
250 3300025929 Ga0207664_10122964 Ga0207664_101229642 310
251 3300025936 Ga0207670_10255157 Ga0207670_102551572 310
252 3300025940 Ga0207691_10000190 Ga0207691_1000019062 310
253 3300025944 Ga0207661_10000492 Ga0207661_100004928 310
254 3300025944 Ga0207661_10013761 Ga0207661_100137614 310
255 3300025944 Ga0207661_10015563 Ga0207661_100155631 310
256 3300025961 Ga0207712_10000007 Ga0207712_10000007202 310
257 3300026116 Ga0207674_10063095 Ga0207674_100630952 310
258 3300026121 Ga0207683_10042652 Ga0207683_100426522 310
259 3300026142 Ga0207698_10109603 Ga0207698_101096033 310
260 3300028379 Ga0268266_10002949 Ga0268266_100029495 310
261 3300032126 Ga0307415_100235936 Ga0307415_1002359362 310
262 3300046543 Ga0495645_0121067 Ga0495645_0121067_525_1526 310
263 3300053077 Ga0495601_0176949 Ga0495601_0176949_251_1252 310
264 3300053085 Ga0495619_0000534 Ga0495619_0000534_8944_9945 310
265 3300005336 Ga0070680_100011928 Ga0070680_1000119286 311
266 3300005337 Ga0070682_100000013 Ga0070682_100000013174 311
267 3300005338 Ga0068868_100000151 Ga0068868_10000015141 311
268 3300005458 Ga0070681_10066295 Ga0070681_100662953 311
269 3300005530 Ga0070679_100000312 Ga0070679_10000031210 311
270 3300005547 Ga0070693_100002833 Ga0070693_1000028336 311
271 3300005563 Ga0068855_100085257 Ga0068855_1000852572 311
272 3300025912 Ga0207707_10026539 Ga0207707_100265394 311
273 3300025921 Ga0207652_10000483 Ga0207652_1000048310 311
274 3300026023 Ga0207677_10000372 Ga0207677_1000037221 311
275 3300046455 Ga0495603_0008466 Ga0495603_0008466_2796_3806 311
276 3300046514 Ga0495618_0000004 Ga0495618_0000004_101578_102588 311
277 3300046809 Ga0495600_0002245 Ga0495600_0002245_8480_9490 311
278 3300005614 Ga0068856_100272608 Ga0068856_1002726082 312
279 3300005841 Ga0068863_100000021 Ga0068863_10000002192 312
280 3300014326 Ga0157380_10008211 Ga0157380_100082116 312
281 3300026088 Ga0207641_10000094 Ga0207641_10000094137 312
282 3300028556 Ga0265337_1000002 Ga0265337_100000222 312
283 3300028558 Ga0265326_10000007 Ga0265326_1000000781 312
284 3300028654 Ga0265322_10000001 Ga0265322_10000001224 312
285 3300028666 Ga0265336_10009760 Ga0265336_100097602 312
286 3300029957 Ga0265324_10000309 Ga0265324_1000030932 312
287 3300031239 Ga0265328_10001155 Ga0265328_100011554 312
288 3300031240 Ga0265320_10000002 Ga0265320_10000002223 312
289 3300031242 Ga0265329_10015065 Ga0265329_100150654 312
290 3300031250 Ga0265331_10000774 Ga0265331_100007744 312
291 3300031251 Ga0265327_10000011 Ga0265327_10000011223 312
292 3300031344 Ga0265316_10036634 Ga0265316_100366341 312
293 3300031711 Ga0265314_10000058 Ga0265314_10000058130 312
294 3300046455 Ga0495603_0000097 Ga0495603_0000097_8375_9385 312
295 3300046517 Ga0495630_0137721 Ga0495630_0137721_605_1615 312
296 3300046678 Ga0495599_0106409 Ga0495599_0106409_170_1180 312
297 3300046689 Ga0495613_0000152 Ga0495613_0000152_6596_7606 312
298 3300049591 Ga0501075_0000392 Ga0501075_0000392_23655_24665 312
299 3300053085 Ga0495619_0062933 Ga0495619_0062933_633_1643 312
300 3300001977 JGI24746J21847_1000415 JGI24746J21847_10004155 313
301 3300013296 Ga0157374_10002990 Ga0157374_100029904 313
302 3300046463 Ga0495653_0158912 Ga0495653_0158912_487_1497 313
303 3300046516 Ga0495628_0002459 Ga0495628_0002459_1031_2041 313
304 3300046516 Ga0495628_0087565 Ga0495628_0087565_332_1342 313
305 3300046616 Ga0495668_0061206 Ga0495668_0061206_676_1686 313
306 3300046663 Ga0495635_0000016 Ga0495635_0000016_52920_53930 313
307 3300046689 Ga0495613_0067833 Ga0495613_0067833_821_1831 313

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

2

241

0.91

PF12804

NTP_transf_3

MobA-like NTP transferase domain

3

142

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xhw-assembly1.cif.gz_A crystal structure of hddc from yersinia pseudotuberculosis 0.8778 2 240
4y7u-assembly1.cif.gz_A structural analysis of muru 0.8669 1 246
4y7v-assembly1.cif.gz_A structural analysis of muru 0.8591 1 246
7d74-assembly1.cif.gz_G cryo-em structure of gmppa/gmppb complex bound to gtp (state ii) 0.856 1 263
7d72-assembly1.cif.gz_F cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose 0.8539 1 263
ID Description Score Start End Superfamily
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9123 2 246 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8867 2 246 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8852 1 249 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8735 1 231 3.90.550.10
af_Q58501_1_209_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8697 1 231 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7X8EAW9-F1-model_v4 NDP-sugar synthase 0.9379 1 263 GO:0005525
GO:0009058
AF-A0A7C6LAE7-F1-model_v4 NTP transferase domain-containing protein 0.9344 1 263 GO:0005525
GO:0005975
GO:0009058
GO:0016740
GO:0016868
AF-A5N6V6-F1-model_v4 Predicted glucose-1-phosphate nucleotidyltransferase containing an additional conserved domain 0.934 1 263 GO:0005525
GO:0005975
GO:0009058
GO:0016740
GO:0016868
AF-A0A7C4F6P4-F1-model_v4 Nucleotidyl transferase domain-containing protein 0.9321 1 263 GO:0005525
GO:0009058
GO:0016868
AF-A0A7C3ZTT6-F1-model_v4 NDP-sugar synthase 0.9311 1 264 GO:0005525
GO:0009058

Feature Viewer

pLDDT pTM Quality
82.07 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map