F398964

General Info

Members Datasets Scaffolds Average Seq Length
307 135 614 238

Family's Representative Sequence

Representative Sequence 3300001990|JGI24737J22298_10001166|JGI24737J22298_100011667
Length 271
Sequence MRYDSLGKQAFTDESCKRHSARYGLRMITSVRNILILTGAGVSAESGLATFRGPDGLWEGHRVEDVATPEAFRRDPALVHAFYDARRAKLGTVAPNEAHKALARLDAEWQGELLLVTQNVDDLHERAGSKRLIHMHGEVTKGWCLACDARFGWTGSMGEGATCPSCGAKGRVRPDIVWFGEMPYEMERIDEALQRCDLFVSIGTSGAVYPAAGFVQTARYCGAKTLEINLEPSLCSYMFDESLTGRAGELVPNWVDEMLAAQSAHSSPISR

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
102 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
103 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
110 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
113 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
114 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
115 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
118 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
135 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 2.61
Rhizosphere 97.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10001166 3300001990 Bacteria 9251
2 JGI24740J21852_10003266 3300001979 Bacteria 7153
3 JGI24737J22298_10000172 3300001990 Bacteria 20869
4 JGI24737J22298_10022654 3300001990 Bacteria 1996
5 JGI24735J21928_10006578 3300002067 Bacteria 3819
6 Ga0065712_10069760 3300005290 Bacteria 6748
7 Ga0065715_10009563 3300005293 Bacteria 2531
8 Ga0070658_10032116 3300005327 Bacteria 4221
9 Ga0070658_10640071 3300005327 Bacteria 922
10 Ga0070676_10116732 3300005328 Bacteria 1669
11 Ga0070670_100005536 3300005331 Bacteria 10652
12 Ga0070670_100022471 3300005331 Bacteria 5429
13 Ga0070677_10069352 3300005333 Bacteria 1479
14 Ga0070680_100001739 3300005336 Bacteria 15996
15 Ga0070680_100128396 3300005336 Bacteria 2119
16 Ga0070680_100216869 3300005336 Bacteria 1615
17 Ga0070660_100001509 3300005339 Bacteria 15957
18 Ga0070660_100002963 3300005339 Bacteria 11679
19 Ga0070660_100004590 3300005339 Bacteria 9547
20 Ga0070689_100170338 3300005340 Bacteria 1764
21 Ga0070661_100004643 3300005344 Bacteria 9459
22 Ga0070661_100009857 3300005344 Bacteria 6627
23 Ga0070661_100266331 3300005344 Bacteria 1326
24 Ga0070692_10009418 3300005345 Bacteria 4404
25 Ga0070668_100039524 3300005347 Bacteria 3607
26 Ga0070675_100029301 3300005354 Bacteria 4439
27 Ga0070671_100002442 3300005355 Bacteria 14371
28 Ga0070671_100004212 3300005355 Bacteria 11379
29 Ga0070671_100016822 3300005355 Bacteria 5913
30 Ga0070671_100027135 3300005355 Bacteria 4711
31 Ga0070671_100047191 3300005355 Bacteria 3583
32 Ga0070671_100571321 3300005355 Bacteria 976
33 Ga0070674_100192808 3300005356 Bacteria 1569
34 Ga0070674_100365429 3300005356 Bacteria 1169
35 Ga0070673_100013048 3300005364 Bacteria 5732
36 Ga0070673_100043226 3300005364 Bacteria 3480
37 Ga0070673_100050349 3300005364 Bacteria 3257
38 Ga0070673_100101996 3300005364 Bacteria 2365
39 Ga0070659_100001907 3300005366 Bacteria 14906
40 Ga0070659_100043273 3300005366 Bacteria 3522
41 Ga0070659_100093707 3300005366 Bacteria 2410
42 Ga0070659_100100408 3300005366 Bacteria 2328
43 Ga0070667_100052724 3300005367 Bacteria 3433
44 Ga0070667_100190402 3300005367 Bacteria 1817
45 Ga0070714_100033266 3300005435 Bacteria 4310
46 Ga0070714_100057544 3300005435 Bacteria 3328
47 Ga0070714_100090706 3300005435 Bacteria 2677
48 Ga0070714_100226847 3300005435 Bacteria 1719
49 Ga0070713_100009377 3300005436 Bacteria 7003
50 Ga0070713_100030545 3300005436 Bacteria 4280
51 Ga0070663_100181160 3300005455 Bacteria 1634
52 Ga0070663_100286572 3300005455 Bacteria 1314
53 Ga0070662_100042139 3300005457 Bacteria 3260
54 Ga0070681_10039758 3300005458 Bacteria 4715
55 Ga0070681_10179378 3300005458 Bacteria 2039
56 Ga0070681_10187549 3300005458 Bacteria 1988
57 Ga0070679_100013900 3300005530 Bacteria 7713
58 Ga0070679_100141060 3300005530 Bacteria 2389
59 Ga0070684_100122904 3300005535 Bacteria 2336
60 Ga0068853_100081322 3300005539 Bacteria 2836
61 Ga0070672_100317806 3300005543 Bacteria 1323
62 Ga0068855_100017599 3300005563 Bacteria 8594
63 Ga0068855_100118336 3300005563 Bacteria 3034
64 Ga0068855_100419946 3300005563 Bacteria 1463
65 Ga0070664_100001781 3300005564 Bacteria 17283
66 Ga0070664_100010943 3300005564 Bacteria 7357
67 Ga0070664_100182218 3300005564 Bacteria 1867
68 Ga0068857_100000424 3300005577 Bacteria 29783
69 Ga0068854_100024096 3300005578 Bacteria 4163
70 Ga0068854_100043496 3300005578 Bacteria 3184
71 Ga0068856_100017156 3300005614 Bacteria 7016
72 Ga0068856_100129507 3300005614 Bacteria 2528
73 Ga0068856_100152622 3300005614 Bacteria 2319
74 Ga0068856_100211504 3300005614 Bacteria 1955
75 Ga0068852_100068618 3300005616 Bacteria 3104
76 Ga0068852_100168958 3300005616 Bacteria 2048
77 Ga0068852_100218673 3300005616 Bacteria 1811
78 Ga0068852_100513150 3300005616 Bacteria 1195
79 Ga0068859_100072815 3300005617 Bacteria 3473
80 Ga0068859_100078898 3300005617 Bacteria 3333
81 Ga0068859_100169700 3300005617 Bacteria 2262
82 Ga0068864_100002309 3300005618 Bacteria 15778
83 Ga0068864_100180144 3300005618 Bacteria 1931
84 Ga0068861_100432592 3300005719 Bacteria 1175
85 Ga0068863_100008769 3300005841 Bacteria 9872
86 Ga0068863_100024415 3300005841 Bacteria 5765
87 Ga0068860_101031227 3300005843 Bacteria 841
88 Ga0068862_100003744 3300005844 Bacteria 12971
89 Ga0081539_10023463 3300005985 Bacteria 4042
90 Ga0070717_10183388 3300006028 Bacteria 1826
91 Ga0075428_100037243 3300006844 Bacteria 5356
92 Ga0097620_100072817 3300006931 Bacteria 3473
93 Ga0097620_100078895 3300006931 Bacteria 3333
94 Ga0097620_100169696 3300006931 Bacteria 2262
95 Ga0105248_10001494 3300009177 Bacteria 26021
96 Ga0105248_10014059 3300009177 Bacteria 8809
97 Ga0105248_10020281 3300009177 Bacteria 7365
98 Ga0157371_10184948 3300013102 Bacteria 1491
99 Ga0157371_10311300 3300013102 Bacteria 1141
100 Ga0157370_10022437 3300013104 Bacteria 6280
101 Ga0157370_10155212 3300013104 Bacteria 2130
102 Ga0157370_10751123 3300013104 Bacteria 889
103 Ga0157369_10010201 3300013105 Bacteria 10718
104 Ga0157369_10258211 3300013105 Bacteria 1817
105 Ga0157369_10464722 3300013105 Bacteria 1310
106 Ga0163162_10104858 3300013306 Bacteria 2922
107 Ga0157375_10071327 3300013308 Bacteria 3487
108 Ga0157375_10337688 3300013308 Bacteria 1672
109 Ga0157375_10699106 3300013308 Bacteria 1168
110 Ga0163163_10211933 3300014325 Bacteria 1986
111 Ga0163163_10931499 3300014325 Bacteria 932
112 Ga0157380_10628900 3300014326 Bacteria 1067
113 Ga0163161_10081421 3300017792 Bacteria 2384
114 Ga0206353_10837267 3300020082 Bacteria 1940
115 Ga0207682_10029020 3300025893 Bacteria 2211
116 Ga0207682_10034223 3300025893 Bacteria 2047
117 Ga0207647_10007265 3300025904 Bacteria 8018
118 Ga0207647_10008146 3300025904 Bacteria 7530
119 Ga0207647_10016285 3300025904 Bacteria 5076
120 Ga0207705_10003821 3300025909 Bacteria 11458
121 Ga0207705_10058661 3300025909 Bacteria 2777
122 Ga0207705_10067496 3300025909 Bacteria 2588
123 Ga0207705_10509033 3300025909 Bacteria 935
124 Ga0207707_10026403 3300025912 Bacteria 5076
125 Ga0207707_10374679 3300025912 Bacteria 1224
126 Ga0207660_10001169 3300025917 Bacteria 17546
127 Ga0207660_10237562 3300025917 Bacteria 1435
128 Ga0207660_10626438 3300025917 Bacteria 877
129 Ga0207657_10000339 3300025919 Bacteria 49518
130 Ga0207657_10001262 3300025919 Bacteria 27027
131 Ga0207657_10009584 3300025919 Bacteria 9721
132 Ga0207657_10076413 3300025919 Bacteria 2825
133 Ga0207657_10077805 3300025919 Bacteria 2795
134 Ga0207657_10214483 3300025919 Bacteria 1543
135 Ga0207649_10130961 3300025920 Bacteria 1703
136 Ga0207649_10152549 3300025920 Bacteria 1593
137 Ga0207649_10382472 3300025920 Bacteria 1049
138 Ga0207652_10026606 3300025921 Bacteria 4820
139 Ga0207652_10092148 3300025921 Bacteria 2665
140 Ga0207652_10366446 3300025921 Bacteria 1300
141 Ga0207650_10009277 3300025925 Bacteria 6722
142 Ga0207650_10034375 3300025925 Bacteria 3676
143 Ga0207650_10155112 3300025925 Bacteria 1810
144 Ga0207659_10001918 3300025926 Bacteria 12330
145 Ga0207659_10081614 3300025926 Bacteria 2391
146 Ga0207700_10034423 3300025928 Bacteria 3636
147 Ga0207664_10065888 3300025929 Bacteria 2901
148 Ga0207664_10118312 3300025929 Bacteria 2213
149 Ga0207644_10000522 3300025931 Bacteria 24894
150 Ga0207644_10000979 3300025931 Bacteria 18243
151 Ga0207644_10025068 3300025931 Bacteria 4098
152 Ga0207690_10002056 3300025932 Bacteria 12329
153 Ga0207690_10024753 3300025932 Bacteria 3762
154 Ga0207690_10109692 3300025932 Bacteria 1985
155 Ga0207690_10579559 3300025932 Bacteria 914
156 Ga0207706_10026505 3300025933 Bacteria 5188
157 Ga0207706_10027284 3300025933 Bacteria 5107
158 Ga0207670_10140889 3300025936 Bacteria 1778
159 Ga0207691_10229042 3300025940 Bacteria 1610
160 Ga0207691_10344416 3300025940 Bacteria 1276
161 Ga0207691_10487745 3300025940 Bacteria 1047
162 Ga0207711_10004166 3300025941 Bacteria 12380
163 Ga0207711_10010222 3300025941 Bacteria 7792
164 Ga0207711_10023076 3300025941 Bacteria 5210
165 Ga0207679_10002771 3300025945 Bacteria 10854
166 Ga0207679_10007318 3300025945 Bacteria 6996
167 Ga0207679_10014848 3300025945 Bacteria 5131
168 Ga0207679_10401142 3300025945 Bacteria 1206
169 Ga0207667_10032951 3300025949 Bacteria 5576
170 Ga0207667_10058482 3300025949 Bacteria 4043
171 Ga0207667_10457838 3300025949 Bacteria 1296
172 Ga0207651_10006065 3300025960 Bacteria 6280
173 Ga0207651_10451374 3300025960 Bacteria 1103
174 Ga0207640_10017868 3300025981 Bacteria 4156
175 Ga0207640_10031155 3300025981 Bacteria 3292
176 Ga0207658_10001945 3300025986 Bacteria 15425
177 Ga0207677_10000014 3300026023 Bacteria 181712
178 Ga0207639_10211302 3300026041 Bacteria 1670
179 Ga0207678_10004098 3300026067 Bacteria 13106
180 Ga0207702_10026464 3300026078 Bacteria 4815
181 Ga0207702_10255916 3300026078 Bacteria 1646
182 Ga0207702_10606618 3300026078 Bacteria 1074
183 Ga0207641_10028017 3300026088 Bacteria 4653
184 Ga0207641_10146363 3300026088 Bacteria 2136
185 Ga0207648_10437267 3300026089 Bacteria 1189
186 Ga0207676_10002624 3300026095 Bacteria 12817
187 Ga0207674_10000725 3300026116 Bacteria 43126
188 Ga0207674_10086819 3300026116 Bacteria 3123
189 Ga0207698_10022821 3300026142 Bacteria 4360
190 Ga0207698_10088858 3300026142 Bacteria 2521
191 Ga0207698_10093763 3300026142 Bacteria 2466
192 Ga0207698_10264743 3300026142 Bacteria 1581
193 Ga0268265_10031047 3300028380 Bacteria 3855
194 Ga0268265_10546527 3300028380 Bacteria 1099
195 Ga0268264_10140215 3300028381 Bacteria 2155
196 Ga0307408_100031459 3300031548 Bacteria 3694
197 Ga0307408_100085424 3300031548 Bacteria 2370
198 Ga0307408_100167031 3300031548 Bacteria 1754
199 Ga0307405_10007498 3300031731 Bacteria 5462
200 Ga0307413_10376426 3300031824 Bacteria 1104
201 Ga0307410_10018981 3300031852 Bacteria 4171
202 Ga0307410_10070921 3300031852 Bacteria 2415
203 Ga0307410_10192797 3300031852 Bacteria 1550
204 Ga0307410_10335974 3300031852 Bacteria 1203
205 Ga0307407_10003199 3300031903 Bacteria 6644
206 Ga0307407_10066385 3300031903 Bacteria 2127
207 Ga0307412_10103442 3300031911 Bacteria 2018
208 Ga0307412_10558845 3300031911 Bacteria 962
209 Ga0307409_100022893 3300031995 Bacteria 4315
210 Ga0307409_100202122 3300031995 Bacteria 1778
211 Ga0307409_100326751 3300031995 Bacteria 1438
212 Ga0307416_100310766 3300032002 Bacteria 1572
213 Ga0307416_100469467 3300032002 Bacteria 1315
214 Ga0307411_10014309 3300032005 Bacteria 4410
215 Ga0307411_10053697 3300032005 Bacteria 2642
216 Ga0307411_10101073 3300032005 Bacteria 2039
217 Ga0307415_100033319 3300032126 Bacteria 3343
218 Ga0373943_0005157 3300035170 Bacteria 5881
219 Ga0373946_0037807 3300035171 Bacteria 1963
220 Ga0373935_0159484 3300035692 Bacteria 1537
221 Ga0395899_0000469 3300037312 Bacteria 45619
222 Ga0395899_0041332 3300037312 Bacteria 3445
223 Ga0395899_0203789 3300037312 Bacteria 1378
224 Ga0395899_0385559 3300037312 Bacteria 930
225 Ga0395900_0000803 3300037418 Bacteria 41506
226 Ga0395900_0002613 3300037418 Bacteria 19679
227 Ga0395900_0016408 3300037418 Bacteria 7551
228 Ga0395900_0027998 3300037418 Bacteria 5770
229 Ga0395900_0091740 3300037418 Bacteria 3121
230 Ga0395900_0169491 3300037418 Bacteria 2223
231 Ga0395900_0228971 3300037418 Bacteria 1870
232 Ga0395900_0251484 3300037418 Bacteria 1769
233 Ga0395900_0258718 3300037418 Bacteria 1739
234 Ga0395900_0279888 3300037418 Bacteria 1660
235 Ga0395900_0287897 3300037418 Bacteria 1632
236 Ga0395898_0002321 3300037466 Bacteria 22734
237 Ga0395898_0030071 3300037466 Bacteria 5439
238 Ga0395898_0079197 3300037466 Bacteria 3170
239 Ga0395898_0124061 3300037466 Bacteria 2474
240 Ga0395898_0163234 3300037466 Bacteria 2131
241 Ga0395898_0280845 3300037466 Bacteria 1588
242 Ga0395905_0000852 3300037471 Bacteria 39836
243 Ga0395905_0003854 3300037471 Bacteria 15814
244 Ga0395905_0004444 3300037471 Bacteria 14575
245 Ga0395905_0014983 3300037471 Bacteria 7394
246 Ga0395905_0017192 3300037471 Bacteria 6870
247 Ga0395905_0031501 3300037471 Bacteria 4993
248 Ga0395905_0047344 3300037471 Bacteria 4030
249 Ga0395905_0110378 3300037471 Bacteria 2583
250 Ga0395905_0205156 3300037471 Bacteria 1847
251 Ga0395905_0219912 3300037471 Bacteria 1777
252 Ga0395905_0246899 3300037471 Bacteria 1668
253 Ga0395905_0264019 3300037471 Bacteria 1607
254 Ga0395905_0387554 3300037471 Bacteria 1292
255 Ga0395905_0403672 3300037471 Bacteria 1262
256 Ga0395901_0001141 3300038443 Bacteria 28157
257 Ga0395901_0001956 3300038443 Bacteria 21217
258 Ga0395901_0017492 3300038443 Bacteria 7318
259 Ga0395901_0058836 3300038443 Bacteria 3998
260 Ga0395901_0099128 3300038443 Bacteria 3055
261 Ga0395901_0107357 3300038443 Bacteria 2930
262 Ga0395901_0142143 3300038443 Bacteria 2522
263 Ga0395901_0242535 3300038443 Bacteria 1879
264 Ga0395901_0301087 3300038443 Bacteria 1662
265 Ga0395901_0356852 3300038443 Bacteria 1508
266 Ga0395901_0591331 3300038443 Bacteria 1120
267 Ga0395901_0664661 3300038443 Bacteria 1043
268 Ga0439448_0004399 3300042005 Bacteria 3976
269 Ga0439458_0000231 3300042157 Bacteria 13292
270 Ga0439458_0000393 3300042157 Bacteria 10965
271 Ga0466972_0018935 3300044658 Bacteria 3440
272 Ga0466972_0081792 3300044658 Bacteria 1537
273 Ga0466972_0262623 3300044658 Bacteria 807
274 Ga0466961_0035302 3300044693 Bacteria 3211
275 Ga0466963_0010351 3300044694 Bacteria 5645
276 Ga0466963_0126507 3300044694 Bacteria 1762
277 Ga0466971_0019207 3300044719 Bacteria 3034
278 Ga0466971_0191517 3300044719 Bacteria 963
279 Ga0466968_0002174 3300044735 Bacteria 7149
280 Ga0466970_0003993 3300044765 Bacteria 7238
281 Ga0466970_0110103 3300044765 Bacteria 1503
282 Ga0466957_0008154 3300044842 Bacteria 5947
283 Ga0466957_0016545 3300044842 Bacteria 4313
284 Ga0466957_0162866 3300044842 Bacteria 1449
285 Ga0466957_0179603 3300044842 Bacteria 1382
286 Ga0466960_0272774 3300044901 Bacteria 946
287 Ga0466959_0143632 3300045049 Bacteria 1685
288 Ga0466958_0006425 3300045836 Bacteria 6396
289 Ga0466958_0250561 3300045836 Bacteria 1133
290 Ga0466967_0041813 3300045976 Bacteria 3956
291 Ga0466967_0106241 3300045976 Bacteria 2573
292 Ga0495598_0037233 3300046537 Bacteria 1402
293 Ga0495647_0188090 3300046681 Bacteria 901
294 Ga0495669_0001570 3300046684 Bacteria 9388
295 Ga0495670_0020133 3300046691 Bacteria 3288
296 Ga0495677_0001639 3300047445 Bacteria 8998
297 Ga0496108_0010568 3300048911 Bacteria 7494
298 Ga0496109_0014399 3300048912 Bacteria 6882
299 Ga0496110_0453171 3300048913 Bacteria 1169
300 Ga0496111_0006964 3300048914 Bacteria 7379
301 Ga0496112_0007469 3300048915 Bacteria 9700
302 Ga0496112_0067078 3300048915 Bacteria 3541
303 Ga0496112_0569337 3300048915 Bacteria 1066
304 Ga0496113_0002378 3300048916 Bacteria 10913
305 Ga0501076_0374809 3300049592 Bacteria 1170
306 Ga0501243_027595 3300049675 Bacteria 959
307 Ga0500658_0002707 3300053134 Bacteria 6817
308 JGI24737J22298_10001166
309 JGI24740J21852_10003266
310 JGI24737J22298_10000172
311 JGI24737J22298_10022654
312 JGI24735J21928_10006578
313 Ga0065712_10069760
314 Ga0065715_10009563
315 Ga0070658_10032116
316 Ga0070658_10640071
317 Ga0070676_10116732
318 Ga0070670_100005536
319 Ga0070670_100022471
320 Ga0070677_10069352
321 Ga0070680_100001739
322 Ga0070680_100128396
323 Ga0070680_100216869
324 Ga0070660_100001509
325 Ga0070660_100002963
326 Ga0070660_100004590
327 Ga0070689_100170338
328 Ga0070661_100004643
329 Ga0070661_100009857
330 Ga0070661_100266331
331 Ga0070692_10009418
332 Ga0070668_100039524
333 Ga0070675_100029301
334 Ga0070671_100002442
335 Ga0070671_100004212
336 Ga0070671_100016822
337 Ga0070671_100027135
338 Ga0070671_100047191
339 Ga0070671_100571321
340 Ga0070674_100192808
341 Ga0070674_100365429
342 Ga0070673_100013048
343 Ga0070673_100043226
344 Ga0070673_100050349
345 Ga0070673_100101996
346 Ga0070659_100001907
347 Ga0070659_100043273
348 Ga0070659_100093707
349 Ga0070659_100100408
350 Ga0070667_100052724
351 Ga0070667_100190402
352 Ga0070714_100033266
353 Ga0070714_100057544
354 Ga0070714_100090706
355 Ga0070714_100226847
356 Ga0070713_100009377
357 Ga0070713_100030545
358 Ga0070663_100181160
359 Ga0070663_100286572
360 Ga0070662_100042139
361 Ga0070681_10039758
362 Ga0070681_10179378
363 Ga0070681_10187549
364 Ga0070679_100013900
365 Ga0070679_100141060
366 Ga0070684_100122904
367 Ga0068853_100081322
368 Ga0070672_100317806
369 Ga0068855_100017599
370 Ga0068855_100118336
371 Ga0068855_100419946
372 Ga0070664_100001781
373 Ga0070664_100010943
374 Ga0070664_100182218
375 Ga0068857_100000424
376 Ga0068854_100024096
377 Ga0068854_100043496
378 Ga0068856_100017156
379 Ga0068856_100129507
380 Ga0068856_100152622
381 Ga0068856_100211504
382 Ga0068852_100068618
383 Ga0068852_100168958
384 Ga0068852_100218673
385 Ga0068852_100513150
386 Ga0068859_100072815
387 Ga0068859_100078898
388 Ga0068859_100169700
389 Ga0068864_100002309
390 Ga0068864_100180144
391 Ga0068861_100432592
392 Ga0068863_100008769
393 Ga0068863_100024415
394 Ga0068860_101031227
395 Ga0068862_100003744
396 Ga0081539_10023463
397 Ga0070717_10183388
398 Ga0075428_100037243
399 Ga0097620_100072817
400 Ga0097620_100078895
401 Ga0097620_100169696
402 Ga0105248_10001494
403 Ga0105248_10014059
404 Ga0105248_10020281
405 Ga0157371_10184948
406 Ga0157371_10311300
407 Ga0157370_10022437
408 Ga0157370_10155212
409 Ga0157370_10751123
410 Ga0157369_10010201
411 Ga0157369_10258211
412 Ga0157369_10464722
413 Ga0163162_10104858
414 Ga0157375_10071327
415 Ga0157375_10337688
416 Ga0157375_10699106
417 Ga0163163_10211933
418 Ga0163163_10931499
419 Ga0157380_10628900
420 Ga0163161_10081421
421 Ga0206353_10837267
422 Ga0207682_10029020
423 Ga0207682_10034223
424 Ga0207647_10007265
425 Ga0207647_10008146
426 Ga0207647_10016285
427 Ga0207705_10003821
428 Ga0207705_10058661
429 Ga0207705_10067496
430 Ga0207705_10509033
431 Ga0207707_10026403
432 Ga0207707_10374679
433 Ga0207660_10001169
434 Ga0207660_10237562
435 Ga0207660_10626438
436 Ga0207657_10000339
437 Ga0207657_10001262
438 Ga0207657_10009584
439 Ga0207657_10076413
440 Ga0207657_10077805
441 Ga0207657_10214483
442 Ga0207649_10130961
443 Ga0207649_10152549
444 Ga0207649_10382472
445 Ga0207652_10026606
446 Ga0207652_10092148
447 Ga0207652_10366446
448 Ga0207650_10009277
449 Ga0207650_10034375
450 Ga0207650_10155112
451 Ga0207659_10001918
452 Ga0207659_10081614
453 Ga0207700_10034423
454 Ga0207664_10065888
455 Ga0207664_10118312
456 Ga0207644_10000522
457 Ga0207644_10000979
458 Ga0207644_10025068
459 Ga0207690_10002056
460 Ga0207690_10024753
461 Ga0207690_10109692
462 Ga0207690_10579559
463 Ga0207706_10026505
464 Ga0207706_10027284
465 Ga0207670_10140889
466 Ga0207691_10229042
467 Ga0207691_10344416
468 Ga0207691_10487745
469 Ga0207711_10004166
470 Ga0207711_10010222
471 Ga0207711_10023076
472 Ga0207679_10002771
473 Ga0207679_10007318
474 Ga0207679_10014848
475 Ga0207679_10401142
476 Ga0207667_10032951
477 Ga0207667_10058482
478 Ga0207667_10457838
479 Ga0207651_10006065
480 Ga0207651_10451374
481 Ga0207640_10017868
482 Ga0207640_10031155
483 Ga0207658_10001945
484 Ga0207677_10000014
485 Ga0207639_10211302
486 Ga0207678_10004098
487 Ga0207702_10026464
488 Ga0207702_10255916
489 Ga0207702_10606618
490 Ga0207641_10028017
491 Ga0207641_10146363
492 Ga0207648_10437267
493 Ga0207676_10002624
494 Ga0207674_10000725
495 Ga0207674_10086819
496 Ga0207698_10022821
497 Ga0207698_10088858
498 Ga0207698_10093763
499 Ga0207698_10264743
500 Ga0268265_10031047
501 Ga0268265_10546527
502 Ga0268264_10140215
503 Ga0307408_100031459
504 Ga0307408_100085424
505 Ga0307408_100167031
506 Ga0307405_10007498
507 Ga0307413_10376426
508 Ga0307410_10018981
509 Ga0307410_10070921
510 Ga0307410_10192797
511 Ga0307410_10335974
512 Ga0307407_10003199
513 Ga0307407_10066385
514 Ga0307412_10103442
515 Ga0307412_10558845
516 Ga0307409_100022893
517 Ga0307409_100202122
518 Ga0307409_100326751
519 Ga0307416_100310766
520 Ga0307416_100469467
521 Ga0307411_10014309
522 Ga0307411_10053697
523 Ga0307411_10101073
524 Ga0307415_100033319
525 Ga0373943_0005157
526 Ga0373946_0037807
527 Ga0373935_0159484
528 Ga0395899_0000469
529 Ga0395899_0041332
530 Ga0395899_0203789
531 Ga0395899_0385559
532 Ga0395900_0000803
533 Ga0395900_0002613
534 Ga0395900_0016408
535 Ga0395900_0027998
536 Ga0395900_0091740
537 Ga0395900_0169491
538 Ga0395900_0228971
539 Ga0395900_0251484
540 Ga0395900_0258718
541 Ga0395900_0279888
542 Ga0395900_0287897
543 Ga0395898_0002321
544 Ga0395898_0030071
545 Ga0395898_0079197
546 Ga0395898_0124061
547 Ga0395898_0163234
548 Ga0395898_0280845
549 Ga0395905_0000852
550 Ga0395905_0003854
551 Ga0395905_0004444
552 Ga0395905_0014983
553 Ga0395905_0017192
554 Ga0395905_0031501
555 Ga0395905_0047344
556 Ga0395905_0110378
557 Ga0395905_0205156
558 Ga0395905_0219912
559 Ga0395905_0246899
560 Ga0395905_0264019
561 Ga0395905_0387554
562 Ga0395905_0403672
563 Ga0395901_0001141
564 Ga0395901_0001956
565 Ga0395901_0017492
566 Ga0395901_0058836
567 Ga0395901_0099128
568 Ga0395901_0107357
569 Ga0395901_0142143
570 Ga0395901_0242535
571 Ga0395901_0301087
572 Ga0395901_0356852
573 Ga0395901_0591331
574 Ga0395901_0664661
575 Ga0439448_0004399
576 Ga0439458_0000231
577 Ga0439458_0000393
578 Ga0466972_0018935
579 Ga0466972_0081792
580 Ga0466972_0262623
581 Ga0466961_0035302
582 Ga0466963_0010351
583 Ga0466963_0126507
584 Ga0466971_0019207
585 Ga0466971_0191517
586 Ga0466968_0002174
587 Ga0466970_0003993
588 Ga0466970_0110103
589 Ga0466957_0008154
590 Ga0466957_0016545
591 Ga0466957_0162866
592 Ga0466957_0179603
593 Ga0466960_0272774
594 Ga0466959_0143632
595 Ga0466958_0006425
596 Ga0466958_0250561
597 Ga0466967_0041813
598 Ga0466967_0106241
599 Ga0495598_0037233
600 Ga0495647_0188090
601 Ga0495669_0001570
602 Ga0495670_0020133
603 Ga0495677_0001639
604 Ga0496108_0010568
605 Ga0496109_0014399
606 Ga0496110_0453171
607 Ga0496111_0006964
608 Ga0496112_0007469
609 Ga0496112_0067078
610 Ga0496112_0569337
611 Ga0496113_0002378
612 Ga0501076_0374809
613 Ga0501243_027595
614 Ga0500658_0002707

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02146

SIR2

Sir2 family

39

210

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rxl-assembly1.cif.gz_A crystal structure of cobb wt in complex with h4k16-crotonyl peptide 0.9543 4 232
6rxm-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16-acetyl peptide 0.9426 2 234
6rxr-assembly1.cif.gz_A crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.942 2 232
6rxr-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16cr-2'oh-adpr peptide intermediate after co-crystallisation 0.939 2 232
6rxm-assembly4.cif.gz_D crystal structure of cobb ac2 (a76g, i131c, v162g) in complex with h4k16-acetyl peptide 0.9386 2 234
ID Description Score Start End Superfamily
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9762 67 231 3.40.50.1220
1s5pA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9584 2 232 3.40.50.1220
af_A4IAM7_70_238_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.948 67 231 3.40.50.1220
af_P75960_40_271_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9475 2 231 3.40.50.1220
af_P75960_40_271_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.9357 2 231 3.40.50.1220
ID Description Score Start End GO Terms
AF-A0A848SJA8-F1-model_v4 protein acetyllysine N-acetyltransferase (EC 2.3.1.286) 0.9821 1 162 GO:0017136
GO:0046872
GO:0070403
AF-A0A258H6Y7-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9806 1 231 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A1S1HEA0-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9802 2 234 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-T0GFY6-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9802 2 231 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222
AF-A0A430BV31-F1-model_v4 NAD-dependent protein deacylase (EC 2.3.1.286) (Regulatory protein SIR2 homolog) 0.9792 2 231 GO:0005737
GO:0008270
GO:0032041
GO:0036054
GO:0036055
GO:0046969
GO:0046970
GO:0070403
GO:0097372
GO:0140765
GO:0141222

Map