F398283

General Info

Members Datasets Scaffolds Average Seq Length
305 158 610 368

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0022626|Ga0495618_0022626_120_1337
Length 405
Sequence MGIASNLAQRHRRRLRAVAVAAIVSTLVALVSGGAVLASTGSSTAGSVPPDSLRALAAGIGLRVGTAVNPFDLDTPAYTQITADQFSTVTPENEMKWQLVEPTRGTYDWSGGDRLVQFARDHGQLVRGHTLLWHSQLPTWLTDGVANGTISDTELRDLLHKHITDEVTHFKGQIWQWDVANEFFANAWDPHPLPDGVNGDDFWVQHLGEGVIADAFRWAHAADPKALLFYNDFNIAGEDGTNAKADAVYAWVQQQRAAGVPIDGIGDQGHLDTQYGFPTRMRDDLQRYADLGLKVALTEVDVRLFVNNATAQQPTDPLAPYAHAHYYDQMMKACLAVKSCISFTVWEFGDANSWVPGFFVGEGYAGIYDVNLQPKPAYFDLQQDLALGANGAPHRTGIGNQGPNG

Samples

Sample ID Description Type Environment
1 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
74 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
77 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
80 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
81 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
82 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
83 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
86 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
87 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
92 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
93 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
94 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
95 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
100 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
101 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
102 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
103 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
104 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
105 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
109 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
110 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
111 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
112 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
155 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
156 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
157 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
158 2862574272 Streptomyces sp. AcE210 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.72
Metatranscriptomes 2.95
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0.33
Rhizoplane 2.95
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495618_0022626 3300046514 Bacteria 3883
2 Ga0070658_10010336 3300005327 Bacteria 7486
3 Ga0070658_10020332 3300005327 Bacteria 5320
4 Ga0070683_100051314 3300005329 Bacteria 3819
5 Ga0070683_100272580 3300005329 Bacteria 1610
6 Ga0070683_100304779 3300005329 Bacteria 1515
7 Ga0070682_100024129 3300005337 Bacteria 3617
8 Ga0070659_100179099 3300005366 Bacteria 1739
9 Ga0070709_10003754 3300005434 Bacteria 8166
10 Ga0070714_100005615 3300005435 Bacteria 9591
11 Ga0070714_100006127 3300005435 Bacteria 9244
12 Ga0070714_100020311 3300005435 Bacteria 5422
13 Ga0070714_100244574 3300005435 Bacteria 1657
14 Ga0070713_100005290 3300005436 Bacteria 8801
15 Ga0070713_100011073 3300005436 Bacteria 6549
16 Ga0070713_100082114 3300005436 Bacteria 2751
17 Ga0070713_100236689 3300005436 Bacteria 1661
18 Ga0070710_10014230 3300005437 Bacteria 4000
19 Ga0070710_10026707 3300005437 Bacteria 3071
20 Ga0070710_10034878 3300005437 Bacteria 2739
21 Ga0070710_10044614 3300005437 Bacteria 2460
22 Ga0070710_10093996 3300005437 Bacteria 1773
23 Ga0070711_100075990 3300005439 Bacteria 2380
24 Ga0070705_100175761 3300005440 Bacteria 1446
25 Ga0070681_10009947 3300005458 Bacteria 9373
26 Ga0070706_100013861 3300005467 Bacteria 7454
27 Ga0070706_100132009 3300005467 Bacteria 2331
28 Ga0070707_100079596 3300005468 Bacteria 3163
29 Ga0070698_100004988 3300005471 Bacteria 14547
30 Ga0070698_100018808 3300005471 Bacteria 7269
31 Ga0070679_100032155 3300005530 Bacteria 5188
32 Ga0070679_100109128 3300005530 Bacteria 2754
33 Ga0070684_100012258 3300005535 Bacteria 6865
34 Ga0070684_100146494 3300005535 Bacteria 2137
35 Ga0070684_100297771 3300005535 Bacteria 1480
36 Ga0068853_100056938 3300005539 Bacteria 3372
37 Ga0068855_100002851 3300005563 Bacteria 21250
38 Ga0068855_100007821 3300005563 Bacteria 12913
39 Ga0068855_100450934 3300005563 Bacteria 1404
40 Ga0068857_100056508 3300005577 Bacteria 3483
41 Ga0068856_100087008 3300005614 Bacteria 3106
42 Ga0068856_100192880 3300005614 Bacteria 2051
43 Ga0068852_100075470 3300005616 Bacteria 2974
44 Ga0068864_100001124 3300005618 Bacteria 22380
45 Ga0068863_100034974 3300005841 Bacteria 4785
46 Ga0068858_100230063 3300005842 Bacteria 1757
47 Ga0081455_10003369 3300005937 Bacteria 18429
48 Ga0070717_10003715 3300006028 Bacteria 10969
49 Ga0070717_10005566 3300006028 Bacteria 9192
50 Ga0070717_10070276 3300006028 Bacteria 2917
51 Ga0070717_10109124 3300006028 Bacteria 2358
52 Ga0070717_10154461 3300006028 Bacteria 1987
53 Ga0070717_10176621 3300006028 Bacteria 1859
54 Ga0070717_10277527 3300006028 Bacteria 1485
55 Ga0070717_10362057 3300006028 Bacteria 1298
56 Ga0070715_10084050 3300006163 Bacteria 1451
57 Ga0070716_100111687 3300006173 Bacteria 1695
58 Ga0070712_100007461 3300006175 Bacteria 6827
59 Ga0070712_100059454 3300006175 Bacteria 2692
60 Ga0070712_100074024 3300006175 Bacteria 2445
61 Ga0070712_100081004 3300006175 Bacteria 2351
62 Ga0070712_100107905 3300006175 Bacteria 2072
63 Ga0068871_100315667 3300006358 Bacteria 1375
64 Ga0075434_100189948 3300006871 Bacteria 2074
65 Ga0099795_10015953 3300007788 Bacteria 2366
66 Ga0105240_10123996 3300009093 Bacteria 3107
67 Ga0105240_10239608 3300009093 Bacteria 2103
68 Ga0105241_10036461 3300009174 Bacteria 3700
69 Ga0105248_10080607 3300009177 Bacteria 3658
70 Ga0105248_10094245 3300009177 Bacteria 3372
71 Ga0105238_10018721 3300009551 Bacteria 7052
72 Ga0157370_10031950 3300013104 Bacteria 5144
73 Ga0157369_10008150 3300013105 Bacteria 12018
74 Ga0157374_10069681 3300013296 Bacteria 3312
75 Ga0157372_10423935 3300013307 Bacteria 1551
76 Ga0163163_10004518 3300014325 Bacteria 11870
77 Ga0197907_11117598 3300020069 Bacteria 3112
78 Ga0206350_10282795 3300020080 Bacteria 2336
79 Ga0206354_11133994 3300020081 Bacteria 2199
80 Ga0206353_10501875 3300020082 Bacteria 2448
81 Ga0206353_11534432 3300020082 Bacteria 2363
82 Ga0206353_11628414 3300020082 Bacteria 1616
83 Ga0213875_10000193 3300021388 Bacteria 62624
84 Ga0213875_10023934 3300021388 Bacteria 2914
85 Ga0224712_10002007 3300022467 Bacteria 4929
86 Ga0224712_10019534 3300022467 Bacteria 2286
87 Ga0224712_10081693 3300022467 Bacteria 1335
88 Ga0207692_10020033 3300025898 Bacteria 3034
89 Ga0207692_10047158 3300025898 Bacteria 2162
90 Ga0207647_10007666 3300025904 Bacteria 7778
91 Ga0207647_10173124 3300025904 Bacteria 1256
92 Ga0207685_10059008 3300025905 Bacteria 1511
93 Ga0207699_10028771 3300025906 Bacteria 3092
94 Ga0207699_10055513 3300025906 Bacteria 2357
95 Ga0207699_10067694 3300025906 Bacteria 2172
96 Ga0207705_10008297 3300025909 Bacteria 7586
97 Ga0207684_10002131 3300025910 Bacteria 20280
98 Ga0207684_10110573 3300025910 Bacteria 2352
99 Ga0207654_10037213 3300025911 Bacteria 2723
100 Ga0207707_10027527 3300025912 Bacteria 4971
101 Ga0207707_10229362 3300025912 Bacteria 1616
102 Ga0207695_10012717 3300025913 Bacteria 10077
103 Ga0207695_10151136 3300025913 Bacteria 2261
104 Ga0207671_10003668 3300025914 Bacteria 15143
105 Ga0207693_10070337 3300025915 Bacteria 2738
106 Ga0207693_10080128 3300025915 Bacteria 2556
107 Ga0207693_10082272 3300025915 Bacteria 2521
108 Ga0207693_10088433 3300025915 Bacteria 2428
109 Ga0207663_10035945 3300025916 Bacteria 2976
110 Ga0207646_10087492 3300025922 Bacteria 2788
111 Ga0207694_10005661 3300025924 Bacteria 9587
112 Ga0207700_10017316 3300025928 Bacteria 4812
113 Ga0207700_10102578 3300025928 Bacteria 2285
114 Ga0207700_10115029 3300025928 Bacteria 2171
115 Ga0207700_10229894 3300025928 Bacteria 1576
116 Ga0207700_10234312 3300025928 Bacteria 1562
117 Ga0207664_10004323 3300025929 Bacteria 9624
118 Ga0207664_10014542 3300025929 Bacteria 5688
119 Ga0207664_10038052 3300025929 Bacteria 3728
120 Ga0207664_10042468 3300025929 Bacteria 3549
121 Ga0207665_10022396 3300025939 Bacteria 4156
122 Ga0207661_10006672 3300025944 Bacteria 8165
123 Ga0207667_10155086 3300025949 Bacteria 2356
124 Ga0207639_10075299 3300026041 Bacteria 2654
125 Ga0207678_10178504 3300026067 Bacteria 1813
126 Ga0207702_10078286 3300026078 Bacteria 2862
127 Ga0207702_10295957 3300026078 Bacteria 1535
128 Ga0207674_10021130 3300026116 Bacteria 7017
129 Ga0207674_10044783 3300026116 Bacteria 4557
130 Ga0207674_10045449 3300026116 Bacteria 4517
131 Ga0207698_10084873 3300026142 Bacteria 2569
132 Ga0265339_10028478 3300031249 Bacteria 3176
133 Ga0307510_10173620 3300033180 Bacteria 1730
134 Ga0373926_0024227 3300035083 Bacteria 2112
135 Ga0373934_0005594 3300035086 Bacteria 4652
136 Ga0373934_0020473 3300035086 Bacteria 2542
137 Ga0373944_0003201 3300035089 Bacteria 4208
138 Ga0373923_0006961 3300035111 Bacteria 3946
139 Ga0373936_0015289 3300035113 Bacteria 2940
140 Ga0373936_0015391 3300035113 Bacteria 2931
141 Ga0373945_0009639 3300035116 Bacteria 3166
142 Ga0373953_0003994 3300035117 Bacteria 4655
143 Ga0373943_0000369 3300035170 Bacteria 19137
144 Ga0373943_0002889 3300035170 Bacteria 7800
145 Ga0373946_0020428 3300035171 Bacteria 2559
146 Ga0373955_0048625 3300035172 Bacteria 2300
147 Ga0373935_0067810 3300035692 Bacteria 2295
148 Ga0373927_0002935 3300035695 Bacteria 12386
149 Ga0373927_0041966 3300035695 Bacteria 2966
150 Ga0373947_0004926 3300035725 Bacteria 7807
151 Ga0373937_0003276 3300036401 Bacteria 13580
152 Ga0373937_0035101 3300036401 Bacteria 4562
153 Ga0373925_0000444 3300037068 Bacteria 41788
154 Ga0373925_0002185 3300037068 Bacteria 15914
155 Ga0373925_0026788 3300037068 Bacteria 4220
156 Ga0373925_0044308 3300037068 Bacteria 3303
157 Ga0395898_0025107 3300037466 Bacteria 6008
158 Ga0395898_0049813 3300037466 Bacteria 4103
159 Ga0436364_0211873 3300037853 Bacteria 1922
160 Ga0436364_0573315 3300037853 Bacteria 4687
161 Ga0436364_0778608 3300037853 Bacteria 59985
162 Ga0466969_0002447 3300044656 Bacteria 9902
163 Ga0466969_0068578 3300044656 Bacteria 1708
164 Ga0466965_0059689 3300044683 Bacteria 1904
165 Ga0466966_0070838 3300044684 Bacteria 2185
166 Ga0466961_0005158 3300044693 Bacteria 8220
167 Ga0466963_0018728 3300044694 Bacteria 4333
168 Ga0466963_0027210 3300044694 Bacteria 3660
169 Ga0466963_0076895 3300044694 Bacteria 2254
170 Ga0466963_0165251 3300044694 Bacteria 1542
171 Ga0466963_0322288 3300044694 Bacteria 1087
172 Ga0466971_0003050 3300044719 Bacteria 7116
173 Ga0466971_0027453 3300044719 Bacteria 2550
174 Ga0466959_0004202 3300045049 Bacteria 9596
175 Ga0466959_0010551 3300045049 Bacteria 6611
176 Ga0466959_0206018 3300045049 Bacteria 1368
177 Ga0466967_0125221 3300045976 Bacteria 2379
178 Ga0466967_0177421 3300045976 Bacteria 2007
179 Ga0466967_0184490 3300045976 Bacteria 1969
180 Ga0466967_0373793 3300045976 Bacteria 1383
181 Ga0495592_0022645 3300046454 Bacteria 4779
182 Ga0495592_0096120 3300046454 Bacteria 2117
183 Ga0495592_0225515 3300046454 Bacteria 1250
184 Ga0495603_0000656 3300046455 Bacteria 19572
185 Ga0495603_0001973 3300046455 Bacteria 12097
186 Ga0495603_0015055 3300046455 Bacteria 4676
187 Ga0495603_0085434 3300046455 Bacteria 1847
188 Ga0495629_0139049 3300046459 Bacteria 1690
189 Ga0495641_0007185 3300046461 Bacteria 7023
190 Ga0495641_0019396 3300046461 Bacteria 3481
191 Ga0495651_0001132 3300046462 Bacteria 20594
192 Ga0495651_0004450 3300046462 Bacteria 10732
193 Ga0495651_0008370 3300046462 Bacteria 7928
194 Ga0495651_0036210 3300046462 Bacteria 3842
195 Ga0495651_0046584 3300046462 Bacteria 3355
196 Ga0495653_0027749 3300046463 Bacteria 4532
197 Ga0495653_0029677 3300046463 Bacteria 4362
198 Ga0495653_0042789 3300046463 Bacteria 3524
199 Ga0495653_0199140 3300046463 Bacteria 1360
200 Ga0495580_0039476 3300046472 Bacteria 3377
201 Ga0495582_0022699 3300046473 Bacteria 3433
202 Ga0495582_0055547 3300046473 Bacteria 2182
203 Ga0495662_0006725 3300046476 Bacteria 5728
204 Ga0495664_0003017 3300046477 Bacteria 9114
205 Ga0495664_0015475 3300046477 Bacteria 4336
206 Ga0495664_0031036 3300046477 Bacteria 3131
207 Ga0495664_0070872 3300046477 Bacteria 2081
208 Ga0495585_0046208 3300046492 Bacteria 2429
209 Ga0495594_0173074 3300046499 Bacteria 1228
210 Ga0495608_0010473 3300046511 Bacteria 6471
211 Ga0495608_0141339 3300046511 Unclassified 1536
212 Ga0495608_0156727 3300046511 Bacteria 1449
213 Ga0495608_0165429 3300046511 Bacteria 1405
214 Ga0495618_0028214 3300046514 Bacteria 3498
215 Ga0495618_0062478 3300046514 Bacteria 2363
216 Ga0495628_0002682 3300046516 Bacteria 15916
217 Ga0495630_0001428 3300046517 Bacteria 16548
218 Ga0495630_0193066 3300046517 Bacteria 1553
219 Ga0495652_0010836 3300046529 Bacteria 8260
220 Ga0495652_0025381 3300046529 Bacteria 5244
221 Ga0495652_0054150 3300046529 Bacteria 3417
222 Ga0495652_0147598 3300046529 Unclassified 1841
223 Ga0495665_0005169 3300046531 Bacteria 7035
224 Ga0495665_0020908 3300046531 Bacteria 3516
225 Ga0495640_0018447 3300046533 Bacteria 5171
226 Ga0495640_0024184 3300046533 Bacteria 4420
227 Ga0495587_0014833 3300046536 Bacteria 4875
228 Ga0495587_0017957 3300046536 Bacteria 4387
229 Ga0495587_0042092 3300046536 Bacteria 2724
230 Ga0495645_0143760 3300046543 Bacteria 1662
231 Ga0495667_0001716 3300046559 Bacteria 14540
232 Ga0495667_0011189 3300046559 Bacteria 6074
233 Ga0495667_0034388 3300046559 Bacteria 3389
234 Ga0495667_0042483 3300046559 Bacteria 3014
235 Ga0495634_0007727 3300046642 Bacteria 8045
236 Ga0495634_0013367 3300046642 Bacteria 5932
237 Ga0495634_0027165 3300046642 Bacteria 3983
238 Ga0495625_0070389 3300046660 Bacteria 2456
239 Ga0495635_0004665 3300046663 Bacteria 9516
240 Ga0495635_0013623 3300046663 Bacteria 5691
241 Ga0495635_0044127 3300046663 Bacteria 3076
242 Ga0495635_0046506 3300046663 Bacteria 2993
243 Ga0495635_0090221 3300046663 Bacteria 2096
244 Ga0495588_0119334 3300046674 Bacteria 1390
245 Ga0495657_0012656 3300046675 Bacteria 6259
246 Ga0495657_0035373 3300046675 Bacteria 3462
247 Ga0495657_0107264 3300046675 Bacteria 1772
248 Ga0495657_0142271 3300046675 Bacteria 1494
249 Ga0495599_0013429 3300046678 Bacteria 5059
250 Ga0495599_0019582 3300046678 Bacteria 4218
251 Ga0495623_0075850 3300046679 Bacteria 2087
252 Ga0495646_0032572 3300046680 Bacteria 3244
253 Ga0495646_0044138 3300046680 Bacteria 2727
254 Ga0495646_0049088 3300046680 Bacteria 2562
255 Ga0495658_0174012 3300046683 Bacteria 1333
256 Ga0495613_0002265 3300046689 Bacteria 14556
257 Ga0495624_0042547 3300046690 Bacteria 2902
258 Ga0495670_0027256 3300046691 Bacteria 2830
259 Ga0495600_0033837 3300046809 Bacteria 3318
260 Ga0495600_0052947 3300046809 Bacteria 2650
261 Ga0495581_0007939 3300047315 Bacteria 6146
262 Ga0495604_0031569 3300047317 Bacteria 4201
263 Ga0495604_0054609 3300047317 Bacteria 3082
264 Ga0495636_0025714 3300047318 Bacteria 2391
265 Ga0495674_0002166 3300047319 Bacteria 19296
266 Ga0495674_0023315 3300047319 Bacteria 5707
267 Ga0495674_0036736 3300047319 Bacteria 4407
268 Ga0495674_0046545 3300047319 Bacteria 3849
269 Ga0495674_0070407 3300047319 Bacteria 3022
270 Ga0495676_0018946 3300047321 Bacteria 6062
271 Ga0495676_0039777 3300047321 Bacteria 3890
272 Ga0495676_0057890 3300047321 Bacteria 3053
273 Ga0495680_0001184 3300047322 Bacteria 28620
274 Ga0495680_0004365 3300047322 Bacteria 13548
275 Ga0495680_0012200 3300047322 Bacteria 7578
276 Ga0495680_0012408 3300047322 Bacteria 7498
277 Ga0495680_0048626 3300047322 Bacteria 3329
278 Ga0495680_0053242 3300047322 Bacteria 3150
279 Ga0495675_0032171 3300047444 Bacteria 3347
280 Ga0495685_023024 3300047447 Bacteria 2143
281 Ga0495684_0001685 3300047471 Bacteria 17756
282 Ga0495684_0010022 3300047471 Bacteria 7327
283 Ga0495593_0049266 3300047673 Bacteria 2236
284 Ga0495602_0026543 3300048088 Bacteria 5583
285 Ga0495602_0089380 3300048088 Bacteria 2561
286 Ga0495602_0112206 3300048088 Bacteria 2213
287 Ga0496104_0045471 3300048907 Bacteria 4129
288 Ga0496105_0013049 3300048908 Bacteria 6585
289 Ga0496105_0029282 3300048908 Bacteria 4507
290 Ga0496108_0015614 3300048911 Bacteria 6195
291 Ga0496108_0335727 3300048911 Bacteria 1318
292 Ga0496109_0017481 3300048912 Bacteria 6289
293 Ga0496112_0064480 3300048915 Bacteria 3615
294 Ga0496113_0212954 3300048916 Bacteria 1539
295 Ga0496115_0275214 3300048918 Bacteria 1383
296 Ga0496126_0195954 3300048929 Bacteria 1708
297 nmdc:mga0n895_308820_c1 3300050512 Bacteria 1603
298 Ga0495601_0053957 3300053077 Bacteria 2542
299 Ga0495601_0062499 3300053077 Bacteria 2365
300 Ga0495612_0011233 3300053078 Bacteria 3613
301 Ga0495612_0031230 3300053078 Bacteria 2147
302 Ga0495619_0006767 3300053085 Bacteria 7250
303 Ga0495619_0201280 3300053085 Bacteria 1378
304 Ga0500646_0000196 3300053090 Bacteria 18220
305 2862583910 2862574272 Bacteria 10567477
306 Ga0495618_0022626
307 Ga0070658_10010336
308 Ga0070658_10020332
309 Ga0070683_100051314
310 Ga0070683_100272580
311 Ga0070683_100304779
312 Ga0070682_100024129
313 Ga0070659_100179099
314 Ga0070709_10003754
315 Ga0070714_100005615
316 Ga0070714_100006127
317 Ga0070714_100020311
318 Ga0070714_100244574
319 Ga0070713_100005290
320 Ga0070713_100011073
321 Ga0070713_100082114
322 Ga0070713_100236689
323 Ga0070710_10014230
324 Ga0070710_10026707
325 Ga0070710_10034878
326 Ga0070710_10044614
327 Ga0070710_10093996
328 Ga0070711_100075990
329 Ga0070705_100175761
330 Ga0070681_10009947
331 Ga0070706_100013861
332 Ga0070706_100132009
333 Ga0070707_100079596
334 Ga0070698_100004988
335 Ga0070698_100018808
336 Ga0070679_100032155
337 Ga0070679_100109128
338 Ga0070684_100012258
339 Ga0070684_100146494
340 Ga0070684_100297771
341 Ga0068853_100056938
342 Ga0068855_100002851
343 Ga0068855_100007821
344 Ga0068855_100450934
345 Ga0068857_100056508
346 Ga0068856_100087008
347 Ga0068856_100192880
348 Ga0068852_100075470
349 Ga0068864_100001124
350 Ga0068863_100034974
351 Ga0068858_100230063
352 Ga0081455_10003369
353 Ga0070717_10003715
354 Ga0070717_10005566
355 Ga0070717_10070276
356 Ga0070717_10109124
357 Ga0070717_10154461
358 Ga0070717_10176621
359 Ga0070717_10277527
360 Ga0070717_10362057
361 Ga0070715_10084050
362 Ga0070716_100111687
363 Ga0070712_100007461
364 Ga0070712_100059454
365 Ga0070712_100074024
366 Ga0070712_100081004
367 Ga0070712_100107905
368 Ga0068871_100315667
369 Ga0075434_100189948
370 Ga0099795_10015953
371 Ga0105240_10123996
372 Ga0105240_10239608
373 Ga0105241_10036461
374 Ga0105248_10080607
375 Ga0105248_10094245
376 Ga0105238_10018721
377 Ga0157370_10031950
378 Ga0157369_10008150
379 Ga0157374_10069681
380 Ga0157372_10423935
381 Ga0163163_10004518
382 Ga0197907_11117598
383 Ga0206350_10282795
384 Ga0206354_11133994
385 Ga0206353_10501875
386 Ga0206353_11534432
387 Ga0206353_11628414
388 Ga0213875_10000193
389 Ga0213875_10023934
390 Ga0224712_10002007
391 Ga0224712_10019534
392 Ga0224712_10081693
393 Ga0207692_10020033
394 Ga0207692_10047158
395 Ga0207647_10007666
396 Ga0207647_10173124
397 Ga0207685_10059008
398 Ga0207699_10028771
399 Ga0207699_10055513
400 Ga0207699_10067694
401 Ga0207705_10008297
402 Ga0207684_10002131
403 Ga0207684_10110573
404 Ga0207654_10037213
405 Ga0207707_10027527
406 Ga0207707_10229362
407 Ga0207695_10012717
408 Ga0207695_10151136
409 Ga0207671_10003668
410 Ga0207693_10070337
411 Ga0207693_10080128
412 Ga0207693_10082272
413 Ga0207693_10088433
414 Ga0207663_10035945
415 Ga0207646_10087492
416 Ga0207694_10005661
417 Ga0207700_10017316
418 Ga0207700_10102578
419 Ga0207700_10115029
420 Ga0207700_10229894
421 Ga0207700_10234312
422 Ga0207664_10004323
423 Ga0207664_10014542
424 Ga0207664_10038052
425 Ga0207664_10042468
426 Ga0207665_10022396
427 Ga0207661_10006672
428 Ga0207667_10155086
429 Ga0207639_10075299
430 Ga0207678_10178504
431 Ga0207702_10078286
432 Ga0207702_10295957
433 Ga0207674_10021130
434 Ga0207674_10044783
435 Ga0207674_10045449
436 Ga0207698_10084873
437 Ga0265339_10028478
438 Ga0307510_10173620
439 Ga0373926_0024227
440 Ga0373934_0005594
441 Ga0373934_0020473
442 Ga0373944_0003201
443 Ga0373923_0006961
444 Ga0373936_0015289
445 Ga0373936_0015391
446 Ga0373945_0009639
447 Ga0373953_0003994
448 Ga0373943_0000369
449 Ga0373943_0002889
450 Ga0373946_0020428
451 Ga0373955_0048625
452 Ga0373935_0067810
453 Ga0373927_0002935
454 Ga0373927_0041966
455 Ga0373947_0004926
456 Ga0373937_0003276
457 Ga0373937_0035101
458 Ga0373925_0000444
459 Ga0373925_0002185
460 Ga0373925_0026788
461 Ga0373925_0044308
462 Ga0395898_0025107
463 Ga0395898_0049813
464 Ga0436364_0211873
465 Ga0436364_0573315
466 Ga0436364_0778608
467 Ga0466969_0002447
468 Ga0466969_0068578
469 Ga0466965_0059689
470 Ga0466966_0070838
471 Ga0466961_0005158
472 Ga0466963_0018728
473 Ga0466963_0027210
474 Ga0466963_0076895
475 Ga0466963_0165251
476 Ga0466963_0322288
477 Ga0466971_0003050
478 Ga0466971_0027453
479 Ga0466959_0004202
480 Ga0466959_0010551
481 Ga0466959_0206018
482 Ga0466967_0125221
483 Ga0466967_0177421
484 Ga0466967_0184490
485 Ga0466967_0373793
486 Ga0495592_0022645
487 Ga0495592_0096120
488 Ga0495592_0225515
489 Ga0495603_0000656
490 Ga0495603_0001973
491 Ga0495603_0015055
492 Ga0495603_0085434
493 Ga0495629_0139049
494 Ga0495641_0007185
495 Ga0495641_0019396
496 Ga0495651_0001132
497 Ga0495651_0004450
498 Ga0495651_0008370
499 Ga0495651_0036210
500 Ga0495651_0046584
501 Ga0495653_0027749
502 Ga0495653_0029677
503 Ga0495653_0042789
504 Ga0495653_0199140
505 Ga0495580_0039476
506 Ga0495582_0022699
507 Ga0495582_0055547
508 Ga0495662_0006725
509 Ga0495664_0003017
510 Ga0495664_0015475
511 Ga0495664_0031036
512 Ga0495664_0070872
513 Ga0495585_0046208
514 Ga0495594_0173074
515 Ga0495608_0010473
516 Ga0495608_0141339
517 Ga0495608_0156727
518 Ga0495608_0165429
519 Ga0495618_0028214
520 Ga0495618_0062478
521 Ga0495628_0002682
522 Ga0495630_0001428
523 Ga0495630_0193066
524 Ga0495652_0010836
525 Ga0495652_0025381
526 Ga0495652_0054150
527 Ga0495652_0147598
528 Ga0495665_0005169
529 Ga0495665_0020908
530 Ga0495640_0018447
531 Ga0495640_0024184
532 Ga0495587_0014833
533 Ga0495587_0017957
534 Ga0495587_0042092
535 Ga0495645_0143760
536 Ga0495667_0001716
537 Ga0495667_0011189
538 Ga0495667_0034388
539 Ga0495667_0042483
540 Ga0495634_0007727
541 Ga0495634_0013367
542 Ga0495634_0027165
543 Ga0495625_0070389
544 Ga0495635_0004665
545 Ga0495635_0013623
546 Ga0495635_0044127
547 Ga0495635_0046506
548 Ga0495635_0090221
549 Ga0495588_0119334
550 Ga0495657_0012656
551 Ga0495657_0035373
552 Ga0495657_0107264
553 Ga0495657_0142271
554 Ga0495599_0013429
555 Ga0495599_0019582
556 Ga0495623_0075850
557 Ga0495646_0032572
558 Ga0495646_0044138
559 Ga0495646_0049088
560 Ga0495658_0174012
561 Ga0495613_0002265
562 Ga0495624_0042547
563 Ga0495670_0027256
564 Ga0495600_0033837
565 Ga0495600_0052947
566 Ga0495581_0007939
567 Ga0495604_0031569
568 Ga0495604_0054609
569 Ga0495636_0025714
570 Ga0495674_0002166
571 Ga0495674_0023315
572 Ga0495674_0036736
573 Ga0495674_0046545
574 Ga0495674_0070407
575 Ga0495676_0018946
576 Ga0495676_0039777
577 Ga0495676_0057890
578 Ga0495680_0001184
579 Ga0495680_0004365
580 Ga0495680_0012200
581 Ga0495680_0012408
582 Ga0495680_0048626
583 Ga0495680_0053242
584 Ga0495675_0032171
585 Ga0495685_023024
586 Ga0495684_0001685
587 Ga0495684_0010022
588 Ga0495593_0049266
589 Ga0495602_0026543
590 Ga0495602_0089380
591 Ga0495602_0112206
592 Ga0496104_0045471
593 Ga0496105_0013049
594 Ga0496105_0029282
595 Ga0496108_0015614
596 Ga0496108_0335727
597 Ga0496109_0017481
598 Ga0496112_0064480
599 Ga0496113_0212954
600 Ga0496115_0275214
601 Ga0496126_0195954
602 nmdc:mga0n895_308820_c1
603 Ga0495601_0053957
604 Ga0495601_0062499
605 Ga0495612_0011233
606 Ga0495612_0031230
607 Ga0495619_0006767
608 Ga0495619_0201280
609 Ga0500646_0000196
610 2862583910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00331

Glyco_hydro_10

Glycosyl hydrolase family 10

52

384

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2his-assembly1.cif.gz_A cellulomonas fimi xylanase/cellulase double mutant e127a/h205n with covalent cellobiose 0.9563 31 362
3cuj-assembly1.cif.gz_A cellulomonas fimi xylanase/cellulase cex (cf xyn10a) in complex with sulfur substituted beta-1,4 xylopentaose. 0.9521 31 364
3wue-assembly1.cif.gz_A the wild type crystal structure of b-1,4-xylanase (xynas9) with xylobiose from streptomyces sp. 9 0.9489 31 363
3wug-assembly1.cif.gz_A the mutant crystal structure of b-1,4-xylanase (xynas9_v43p/g44e) with xylobiose from streptomyces sp. 9 0.9481 31 363
2his-assembly1.cif.gz_A cellulomonas fimi xylanase/cellulase double mutant e127a/h205n with covalent cellobiose 0.9444 31 362
ID Description Score Start End Superfamily
1v6yA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9375 31 364 3.20.20.80
1vbrA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9343 31 363 3.20.20.80
1ta3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9246 31 363 3.20.20.80
1v6yA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9233 31 364 3.20.20.80
1ta3B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.9158 31 363 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A6P0T1S3-F1-model_v4 Beta-xylanase (EC 3.2.1.8) 0.9628 31 227 GO:0031176
GO:0045493
AF-A0A0Q0CCW8-F1-model_v4 endo-1,4-beta-xylanase (EC 3.2.1.8) 0.9628 31 154 GO:0000272
GO:0004553
AF-A0A6M4ET26-F1-model_v4 Beta-xylanase (EC 3.2.1.8) 0.9562 31 363 GO:0031176
GO:0045493
AF-A0A3D3NW57-F1-model_v4 Beta-xylanase (EC 3.2.1.8) 0.9531 31 363 GO:0016020
GO:0031176
GO:0045493
AF-A0A2G4FTL4-F1-model_v4 Beta-xylanase (EC 3.2.1.8) 0.9519 31 364 GO:0000272
GO:0031176

Map