F398187

General Info

Members Datasets Scaffolds Average Seq Length
305 162 610 112

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10019010|Ga0307513_100190106
Length 126
Sequence MAAAFATRIRGIRMNDPVSGIALGVVIVGLALSTFVTRTSFLIAGARLRLSHRVEVALRYAPVCTLAAIIVPDILLHGPNATLDLSPLNPRLIGALATGLWLCWSRNIFGCLAAGMAAYSLARLYL

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
110 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
111 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
112 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
113 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
114 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
115 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
116 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
117 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
118 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
119 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
120 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
121 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
130 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
131 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
132 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
138 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
160 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
161 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
162 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 3.28
Rhizosphere 90.16
Stem 0
Stem Tuber 0
Unclassified 26.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10019010 3300031456 Bacteria 8192
2 rootL2_10131626 3300003322 Bacteria 2010
3 rootH1_10129146 3300003323 Bacteria 1611
4 Ga0070676_10153935 3300005328 Bacteria 1474
5 Ga0070676_10499485 3300005328 Bacteria 863
6 Ga0070690_100044780 3300005330 Bacteria 2810
7 Ga0070670_100214466 3300005331 Unclassified 1674
8 Ga0070670_100802892 3300005331 Bacteria 850
9 Ga0070677_10002821 3300005333 Bacteria 5566
10 Ga0068869_100136447 3300005334 Unclassified 1891
11 Ga0068869_100168849 3300005334 Bacteria 1708
12 Ga0070682_100020343 3300005337 Bacteria 3904
13 Ga0070682_100135874 3300005337 Bacteria 1670
14 Ga0070682_100338223 3300005337 Bacteria 1118
15 Ga0070682_102017961 3300005337 Unclassified 507
16 Ga0070689_100006209 3300005340 Bacteria 8246
17 Ga0070689_100276912 3300005340 Bacteria 1391
18 Ga0070689_101021121 3300005340 Unclassified 736
19 Ga0070692_10603044 3300005345 Unclassified 727
20 Ga0070668_100211447 3300005347 Bacteria 1596
21 Ga0070668_101197039 3300005347 Unclassified 688
22 Ga0070669_100101722 3300005353 Bacteria 2169
23 Ga0070669_100278119 3300005353 Unclassified 1340
24 Ga0070669_100646872 3300005353 Bacteria 889
25 Ga0070675_100018477 3300005354 Bacteria 5550
26 Ga0070675_100044822 3300005354 Bacteria 3617
27 Ga0070675_100066807 3300005354 Bacteria 2975
28 Ga0070675_101473857 3300005354 Unclassified 628
29 Ga0070671_101174375 3300005355 Bacteria 675
30 Ga0070674_100266672 3300005356 Bacteria 1351
31 Ga0070674_100279241 3300005356 Bacteria 1323
32 Ga0070673_100080261 3300005364 Bacteria 2643
33 Ga0070673_100599316 3300005364 Bacteria 1005
34 Ga0070673_101664099 3300005364 Bacteria 604
35 Ga0070688_100265278 3300005365 Unclassified 1228
36 Ga0070688_100699330 3300005365 Bacteria 785
37 Ga0070667_100587891 3300005367 Bacteria 1025
38 Ga0070667_100896384 3300005367 Unclassified 825
39 Ga0070701_10418241 3300005438 Unclassified 853
40 Ga0070700_100045405 3300005441 Bacteria 2710
41 Ga0070700_100048485 3300005441 Bacteria 2632
42 Ga0070700_100080437 3300005441 Bacteria 2102
43 Ga0070700_100194463 3300005441 Bacteria 1421
44 Ga0070694_100043677 3300005444 Bacteria 2997
45 Ga0070694_100423127 3300005444 Bacteria 1047
46 Ga0070663_100598226 3300005455 Bacteria 927
47 Ga0070663_100730271 3300005455 Bacteria 844
48 Ga0070678_100199201 3300005456 Bacteria 1651
49 Ga0070678_100603474 3300005456 Unclassified 980
50 Ga0070678_101590797 3300005456 Unclassified 613
51 Ga0068867_100175889 3300005459 Bacteria 1698
52 Ga0068867_100191620 3300005459 Bacteria 1632
53 Ga0068867_100407631 3300005459 Bacteria 1148
54 Ga0068867_100750552 3300005459 Bacteria 866
55 Ga0070685_10059212 3300005466 Unclassified 2235
56 Ga0070685_10858467 3300005466 Unclassified 673
57 Ga0070685_11031089 3300005466 Bacteria 619
58 Ga0068853_100534633 3300005539 Unclassified 1109
59 Ga0070672_100018533 3300005543 Bacteria 5035
60 Ga0070672_100025571 3300005543 Bacteria 4381
61 Ga0070672_100058151 3300005543 Bacteria 3037
62 Ga0070672_100664818 3300005543 Unclassified 910
63 Ga0070672_102122834 3300005543 Unclassified 506
64 Ga0070686_100014735 3300005544 Bacteria 4511
65 Ga0070686_100145824 3300005544 Bacteria 1653
66 Ga0070686_100816250 3300005544 Unclassified 753
67 Ga0070686_100951107 3300005544 Bacteria 702
68 Ga0070695_100492207 3300005545 Bacteria 947
69 Ga0070696_100016862 3300005546 Bacteria 4927
70 Ga0070693_100267679 3300005547 Bacteria 1139
71 Ga0070693_100358076 3300005547 Bacteria 1000
72 Ga0070664_101928952 3300005564 Bacteria 560
73 Ga0068857_100056415 3300005577 Bacteria 3486
74 Ga0070702_100347329 3300005615 Bacteria 1044
75 Ga0070702_100521420 3300005615 Bacteria 876
76 Ga0070702_100603207 3300005615 Bacteria 823
77 Ga0070702_100984937 3300005615 Unclassified 666
78 Ga0070702_101185862 3300005615 Unclassified 615
79 Ga0068859_100089833 3300005617 Bacteria 3122
80 Ga0068859_100124620 3300005617 Bacteria 2645
81 Ga0068859_101176505 3300005617 Bacteria 844
82 Ga0068859_102084809 3300005617 Unclassified 626
83 Ga0068864_100630453 3300005618 Unclassified 1042
84 Ga0068864_101903219 3300005618 Unclassified 600
85 Ga0068866_10654215 3300005718 Bacteria 716
86 Ga0068861_100016305 3300005719 Bacteria 5255
87 Ga0068861_100029221 3300005719 Bacteria 4031
88 Ga0068861_100813484 3300005719 Bacteria 878
89 Ga0068861_101953632 3300005719 Archaea 584
90 Ga0068861_102217107 3300005719 Unclassified 550
91 Ga0068870_10752205 3300005840 Unclassified 677
92 Ga0068863_100058965 3300005841 Bacteria 3632
93 Ga0068863_100094614 3300005841 Bacteria 2836
94 Ga0068863_100314638 3300005841 Bacteria 1520
95 Ga0068863_100459514 3300005841 Bacteria 1250
96 Ga0068858_100171769 3300005842 Bacteria 2044
97 Ga0068860_100448944 3300005843 Bacteria 1282
98 Ga0068860_101824734 3300005843 Bacteria 630
99 Ga0068862_100038112 3300005844 Unclassified 4076
100 Ga0068862_100194455 3300005844 Bacteria 1827
101 Ga0068862_100509099 3300005844 Unclassified 1144
102 Ga0068862_102002940 3300005844 Unclassified 590
103 Ga0068862_102221357 3300005844 Bacteria 560
104 Ga0097621_100150097 3300006237 Bacteria 1998
105 Ga0097621_100169627 3300006237 Bacteria 1880
106 Ga0068871_100003635 3300006358 Bacteria 10596
107 Ga0068871_100055145 3300006358 Bacteria 3226
108 Ga0068871_100868992 3300006358 Unclassified 834
109 Ga0068865_100092322 3300006881 Bacteria 2199
110 Ga0068865_100111410 3300006881 Bacteria 2019
111 Ga0068865_100165558 3300006881 Bacteria 1690
112 Ga0068865_100259901 3300006881 Bacteria 1374
113 Ga0068865_100724842 3300006881 Unclassified 852
114 Ga0097620_100089834 3300006931 Bacteria 3122
115 Ga0097620_100124615 3300006931 Bacteria 2645
116 Ga0097620_101176636 3300006931 Bacteria 844
117 Ga0097620_102084290 3300006931 Unclassified 626
118 Ga0111539_10026261 3300009094 Bacteria 7123
119 Ga0111539_10470198 3300009094 Bacteria 1464
120 Ga0111539_10828777 3300009094 Bacteria 1076
121 Ga0105245_10910931 3300009098 Unclassified 921
122 Ga0105243_11549708 3300009148 Bacteria 688
123 Ga0105242_10334197 3300009176 Unclassified 1394
124 Ga0105242_12767959 3300009176 Unclassified 541
125 Ga0105238_11027744 3300009551 Bacteria 845
126 Ga0105249_10483826 3300009553 Bacteria 1281
127 Ga0105249_11166900 3300009553 Unclassified 841
128 Ga0157374_10225313 3300013296 Unclassified 1841
129 Ga0157378_10240381 3300013297 Bacteria 1729
130 Ga0163162_11527637 3300013306 Bacteria 761
131 Ga0157375_10030177 3300013308 Bacteria 5109
132 Ga0157375_11334357 3300013308 Bacteria 844
133 Ga0157375_12301256 3300013308 Unclassified 642
134 Ga0163163_10656447 3300014325 Unclassified 1112
135 Ga0163163_10710515 3300014325 Bacteria 1069
136 Ga0163163_11081866 3300014325 Bacteria 865
137 Ga0157380_10006415 3300014326 Bacteria 8281
138 Ga0157380_10132920 3300014326 Unclassified 2126
139 Ga0157380_10636492 3300014326 Unclassified 1061
140 Ga0157380_11650156 3300014326 Bacteria 698
141 Ga0157380_11909924 3300014326 Unclassified 654
142 Ga0157380_12829710 3300014326 Unclassified 552
143 Ga0157377_10329161 3300014745 Unclassified 1018
144 Ga0157377_10480883 3300014745 Bacteria 864
145 Ga0157379_10013253 3300014968 Bacteria 7220
146 Ga0163161_10344755 3300017792 Unclassified 1183
147 Ga0207682_10001146 3300025893 Bacteria 12278
148 Ga0207682_10093486 3300025893 Unclassified 1307
149 Ga0207699_10835810 3300025906 Bacteria 678
150 Ga0207645_10166825 3300025907 Bacteria 1442
151 Ga0207645_10250077 3300025907 Bacteria 1173
152 Ga0207643_10012643 3300025908 Bacteria 4560
153 Ga0207643_10526770 3300025908 Unclassified 757
154 Ga0207681_10075951 3300025923 Bacteria 2358
155 Ga0207681_10534652 3300025923 Bacteria 963
156 Ga0207650_10464881 3300025925 Unclassified 1054
157 Ga0207659_10115061 3300025926 Bacteria 2051
158 Ga0207644_10932406 3300025931 Bacteria 728
159 Ga0207706_10354648 3300025933 Bacteria 1275
160 Ga0207706_10954826 3300025933 Bacteria 722
161 Ga0207670_10025092 3300025936 Bacteria 3736
162 Ga0207669_10034921 3300025937 Bacteria 2855
163 Ga0207669_10111945 3300025937 Bacteria 1831
164 Ga0207669_10278130 3300025937 Bacteria 1261
165 Ga0207704_10005201 3300025938 Bacteria 5989
166 Ga0207704_10104210 3300025938 Bacteria 1899
167 Ga0207704_10143995 3300025938 Unclassified 1671
168 Ga0207691_10004327 3300025940 Bacteria 13790
169 Ga0207691_10012176 3300025940 Bacteria 8247
170 Ga0207691_10034832 3300025940 Bacteria 4678
171 Ga0207691_10148523 3300025940 Bacteria 2062
172 Ga0207711_10650573 3300025941 Unclassified 983
173 Ga0207689_10024691 3300025942 Bacteria 5039
174 Ga0207689_10577967 3300025942 Bacteria 945
175 Ga0207689_11418426 3300025942 Unclassified 582
176 Ga0207689_11777912 3300025942 Unclassified 509
177 Ga0207651_10022280 3300025960 Bacteria 3870
178 Ga0207651_10212513 3300025960 Bacteria 1558
179 Ga0207712_10661220 3300025961 Bacteria 909
180 Ga0207712_10868115 3300025961 Bacteria 796
181 Ga0207668_10153495 3300025972 Bacteria 1786
182 Ga0207658_10480621 3300025986 Bacteria 1104
183 Ga0207658_10956664 3300025986 Bacteria 781
184 Ga0207703_10101675 3300026035 Bacteria 2438
185 Ga0207639_10473716 3300026041 Bacteria 1140
186 Ga0207678_10335929 3300026067 Unclassified 1301
187 Ga0207708_10014958 3300026075 Bacteria 5812
188 Ga0207708_10042127 3300026075 Bacteria 3481
189 Ga0207708_10087563 3300026075 Bacteria 2398
190 Ga0207708_10164677 3300026075 Bacteria 1753
191 Ga0207641_10017637 3300026088 Bacteria 5846
192 Ga0207641_10074030 3300026088 Bacteria 2937
193 Ga0207641_10775394 3300026088 Bacteria 947
194 Ga0207648_10019788 3300026089 Bacteria 6073
195 Ga0207648_10195680 3300026089 Bacteria 1792
196 Ga0207648_10672998 3300026089 Bacteria 958
197 Ga0207676_10047135 3300026095 Bacteria 3338
198 Ga0207676_10446811 3300026095 Unclassified 1218
199 Ga0207674_10166672 3300026116 Bacteria 2157
200 Ga0207675_100005010 3300026118 Bacteria 12758
201 Ga0207675_100045712 3300026118 Bacteria 4091
202 Ga0207675_100050371 3300026118 Bacteria 3886
203 Ga0207675_100410283 3300026118 Bacteria 1336
204 Ga0207683_10023359 3300026121 Bacteria 5319
205 Ga0207428_10737509 3300027907 Bacteria 703
206 Ga0268265_10016679 3300028380 Bacteria 5053
207 Ga0268265_10374366 3300028380 Unclassified 1308
208 Ga0268265_10637851 3300028380 Bacteria 1022
209 Ga0268265_11690185 3300028380 Bacteria 639
210 Ga0268264_10184533 3300028381 Bacteria 1897
211 Ga0307513_10017928 3300031456 Bacteria 8477
212 Ga0307513_10019740 3300031456 Bacteria 8011
213 Ga0307513_10032079 3300031456 Bacteria 5932
214 Ga0307513_10099119 3300031456 Bacteria 2943
215 Ga0307513_10246208 3300031456 Unclassified 1588
216 Ga0307509_10010026 3300031507 Bacteria 11693
217 Ga0307509_10181592 3300031507 Bacteria 1968
218 Ga0307408_100162340 3300031548 Bacteria 1776
219 Ga0307413_10033724 3300031824 Unclassified 2918
220 Ga0307410_10086163 3300031852 Bacteria 2218
221 Ga0307406_11568988 3300031901 Unclassified 581
222 Ga0307407_10022631 3300031903 Bacteria 3265
223 Ga0307409_100012963 3300031995 Bacteria 5340
224 Ga0307409_101073826 3300031995 Bacteria 825
225 Ga0307409_102954962 3300031995 Bacteria 502
226 Ga0307416_100123279 3300032002 Bacteria 2316
227 Ga0307411_10006751 3300032005 Bacteria 5771
228 Ga0307411_10337881 3300032005 Bacteria 1223
229 Ga0307415_100512698 3300032126 Bacteria 1051
230 Ga0373957_0035607 3300035120 Unclassified 1851
231 Ga0373933_0785154 3300035724 Unclassified 627
232 Ga0373947_0380821 3300035725 Unclassified 950
233 Ga0451791_0214656 3300041451 Unclassified 985
234 Ga0451791_1099545 3300041451 Unclassified 2969
235 Ga0451793_1027453 3300041452 Unclassified 724
236 Ga0451800_1109256 3300041459 Bacteria 927
237 Ga0451802_0003145 3300041460 Bacteria 965
238 Ga0451802_0528915 3300041460 Bacteria 614
239 Ga0451802_0649794 3300041460 Unclassified 526
240 Ga0451807_0174921 3300041486 Bacteria 703
241 Ga0451807_0224114 3300041486 Bacteria 632
242 Ga0451807_0426531 3300041486 Bacteria 3108
243 Ga0451833_0989137 3300041491 Bacteria 1191
244 Ga0451835_0734021 3300041492 Unclassified 520
245 Ga0451837_0567630 3300041494 Bacteria 3858
246 Ga0451845_0729224 3300041501 Unclassified 740
247 Ga0451847_0609521 3300041503 Bacteria 633
248 Ga0451849_0094283 3300041505 Bacteria 1114
249 Ga0451843_0839990 3300041509 Bacteria 1872
250 Ga0451855_1828463 3300041511 Bacteria 706
251 Ga0451853_0860059 3300041512 Unclassified 2053
252 Ga0495603_0082045 3300046455 Bacteria 1889
253 Ga0495590_0047558 3300046457 Bacteria 1496
254 Ga0495638_0003825 3300046460 Bacteria 11683
255 Ga0495638_0050908 3300046460 Bacteria 2586
256 Ga0495638_0590748 3300046460 Unclassified 547
257 Ga0495641_0277146 3300046461 Unclassified 755
258 Ga0495584_0108166 3300046491 Bacteria 1406
259 Ga0495585_0182084 3300046492 Bacteria 1079
260 Ga0495596_0360942 3300046500 Unclassified 566
261 Ga0495616_0006572 3300046513 Bacteria 7023
262 Ga0495616_0027423 3300046513 Bacteria 3022
263 Ga0495632_0143829 3300046519 Bacteria 1105
264 Ga0495632_0170978 3300046519 Bacteria 998
265 Ga0495632_0393479 3300046519 Bacteria 606
266 Ga0495637_0294963 3300046520 Bacteria 576
267 Ga0495667_0481815 3300046559 Unclassified 778
268 Ga0495668_0017193 3300046616 Bacteria 4200
269 Ga0495611_0319950 3300046648 Bacteria 714
270 Ga0495625_0010426 3300046660 Bacteria 7691
271 Ga0495625_0030951 3300046660 Bacteria 3986
272 Ga0495625_0053182 3300046660 Bacteria 2898
273 Ga0495649_0002890 3300046694 Bacteria 11907
274 Ga0495649_0444371 3300046694 Bacteria 648
275 Ga0495589_0155397 3300046794 Bacteria 1091
276 Ga0495680_0336448 3300047322 Unclassified 1054
277 Ga0495681_0300811 3300047470 Unclassified 621
278 Ga0495686_0207707 3300047472 Unclassified 1120
279 Ga0495686_0232624 3300047472 Unclassified 1043
280 Ga0501039_1476528 3300049575 Bacteria 523
281 Ga0501040_0425790 3300049576 Bacteria 954
282 Ga0501042_0354185 3300049578 Bacteria 1062
283 Ga0501042_0675072 3300049578 Bacteria 751
284 Ga0501067_0045999 3300049583 Unclassified 2422
285 Ga0501068_0003685 3300049584 Bacteria 8289
286 Ga0501068_0151878 3300049584 Bacteria 1456
287 Ga0501070_0058028 3300049586 Bacteria 3209
288 Ga0501070_0226597 3300049586 Bacteria 1532
289 Ga0501071_0474426 3300049587 Unclassified 958
290 Ga0501073_0018851 3300049589 Bacteria 4986
291 Ga0501074_0047060 3300049590 Bacteria 3118
292 Ga0501075_0240220 3300049591 Unclassified 1381
293 Ga0501076_0781141 3300049592 Bacteria 788
294 Ga0501077_0032072 3300049593 Bacteria 3343
295 Ga0501079_0001111 3300049741 Bacteria 18700
296 Ga0501079_0851285 3300049741 Unclassified 718
297 Ga0501080_0265689 3300049742 Bacteria 1562
298 Ga0501080_1427007 3300049742 Unclassified 590
299 Ga0501081_0687068 3300049743 Bacteria 768
300 Ga0501083_0013752 3300049744 Bacteria 5659
301 nmdc:mga08y16_120507_c1 3300050511 Bacteria 2730
302 Ga0500611_023861 3300053727 Bacteria 1195
303 Ga0501084_0120036 3300054114 Bacteria 2210
304 Ga0501082_0075194 3300060353 Bacteria 2910
305 Ga0530510_1561434 3300061734 Bacteria 507
306 Ga0307513_10019010
307 rootL2_10131626
308 rootH1_10129146
309 Ga0070676_10153935
310 Ga0070676_10499485
311 Ga0070690_100044780
312 Ga0070670_100214466
313 Ga0070670_100802892
314 Ga0070677_10002821
315 Ga0068869_100136447
316 Ga0068869_100168849
317 Ga0070682_100020343
318 Ga0070682_100135874
319 Ga0070682_100338223
320 Ga0070682_102017961
321 Ga0070689_100006209
322 Ga0070689_100276912
323 Ga0070689_101021121
324 Ga0070692_10603044
325 Ga0070668_100211447
326 Ga0070668_101197039
327 Ga0070669_100101722
328 Ga0070669_100278119
329 Ga0070669_100646872
330 Ga0070675_100018477
331 Ga0070675_100044822
332 Ga0070675_100066807
333 Ga0070675_101473857
334 Ga0070671_101174375
335 Ga0070674_100266672
336 Ga0070674_100279241
337 Ga0070673_100080261
338 Ga0070673_100599316
339 Ga0070673_101664099
340 Ga0070688_100265278
341 Ga0070688_100699330
342 Ga0070667_100587891
343 Ga0070667_100896384
344 Ga0070701_10418241
345 Ga0070700_100045405
346 Ga0070700_100048485
347 Ga0070700_100080437
348 Ga0070700_100194463
349 Ga0070694_100043677
350 Ga0070694_100423127
351 Ga0070663_100598226
352 Ga0070663_100730271
353 Ga0070678_100199201
354 Ga0070678_100603474
355 Ga0070678_101590797
356 Ga0068867_100175889
357 Ga0068867_100191620
358 Ga0068867_100407631
359 Ga0068867_100750552
360 Ga0070685_10059212
361 Ga0070685_10858467
362 Ga0070685_11031089
363 Ga0068853_100534633
364 Ga0070672_100018533
365 Ga0070672_100025571
366 Ga0070672_100058151
367 Ga0070672_100664818
368 Ga0070672_102122834
369 Ga0070686_100014735
370 Ga0070686_100145824
371 Ga0070686_100816250
372 Ga0070686_100951107
373 Ga0070695_100492207
374 Ga0070696_100016862
375 Ga0070693_100267679
376 Ga0070693_100358076
377 Ga0070664_101928952
378 Ga0068857_100056415
379 Ga0070702_100347329
380 Ga0070702_100521420
381 Ga0070702_100603207
382 Ga0070702_100984937
383 Ga0070702_101185862
384 Ga0068859_100089833
385 Ga0068859_100124620
386 Ga0068859_101176505
387 Ga0068859_102084809
388 Ga0068864_100630453
389 Ga0068864_101903219
390 Ga0068866_10654215
391 Ga0068861_100016305
392 Ga0068861_100029221
393 Ga0068861_100813484
394 Ga0068861_101953632
395 Ga0068861_102217107
396 Ga0068870_10752205
397 Ga0068863_100058965
398 Ga0068863_100094614
399 Ga0068863_100314638
400 Ga0068863_100459514
401 Ga0068858_100171769
402 Ga0068860_100448944
403 Ga0068860_101824734
404 Ga0068862_100038112
405 Ga0068862_100194455
406 Ga0068862_100509099
407 Ga0068862_102002940
408 Ga0068862_102221357
409 Ga0097621_100150097
410 Ga0097621_100169627
411 Ga0068871_100003635
412 Ga0068871_100055145
413 Ga0068871_100868992
414 Ga0068865_100092322
415 Ga0068865_100111410
416 Ga0068865_100165558
417 Ga0068865_100259901
418 Ga0068865_100724842
419 Ga0097620_100089834
420 Ga0097620_100124615
421 Ga0097620_101176636
422 Ga0097620_102084290
423 Ga0111539_10026261
424 Ga0111539_10470198
425 Ga0111539_10828777
426 Ga0105245_10910931
427 Ga0105243_11549708
428 Ga0105242_10334197
429 Ga0105242_12767959
430 Ga0105238_11027744
431 Ga0105249_10483826
432 Ga0105249_11166900
433 Ga0157374_10225313
434 Ga0157378_10240381
435 Ga0163162_11527637
436 Ga0157375_10030177
437 Ga0157375_11334357
438 Ga0157375_12301256
439 Ga0163163_10656447
440 Ga0163163_10710515
441 Ga0163163_11081866
442 Ga0157380_10006415
443 Ga0157380_10132920
444 Ga0157380_10636492
445 Ga0157380_11650156
446 Ga0157380_11909924
447 Ga0157380_12829710
448 Ga0157377_10329161
449 Ga0157377_10480883
450 Ga0157379_10013253
451 Ga0163161_10344755
452 Ga0207682_10001146
453 Ga0207682_10093486
454 Ga0207699_10835810
455 Ga0207645_10166825
456 Ga0207645_10250077
457 Ga0207643_10012643
458 Ga0207643_10526770
459 Ga0207681_10075951
460 Ga0207681_10534652
461 Ga0207650_10464881
462 Ga0207659_10115061
463 Ga0207644_10932406
464 Ga0207706_10354648
465 Ga0207706_10954826
466 Ga0207670_10025092
467 Ga0207669_10034921
468 Ga0207669_10111945
469 Ga0207669_10278130
470 Ga0207704_10005201
471 Ga0207704_10104210
472 Ga0207704_10143995
473 Ga0207691_10004327
474 Ga0207691_10012176
475 Ga0207691_10034832
476 Ga0207691_10148523
477 Ga0207711_10650573
478 Ga0207689_10024691
479 Ga0207689_10577967
480 Ga0207689_11418426
481 Ga0207689_11777912
482 Ga0207651_10022280
483 Ga0207651_10212513
484 Ga0207712_10661220
485 Ga0207712_10868115
486 Ga0207668_10153495
487 Ga0207658_10480621
488 Ga0207658_10956664
489 Ga0207703_10101675
490 Ga0207639_10473716
491 Ga0207678_10335929
492 Ga0207708_10014958
493 Ga0207708_10042127
494 Ga0207708_10087563
495 Ga0207708_10164677
496 Ga0207641_10017637
497 Ga0207641_10074030
498 Ga0207641_10775394
499 Ga0207648_10019788
500 Ga0207648_10195680
501 Ga0207648_10672998
502 Ga0207676_10047135
503 Ga0207676_10446811
504 Ga0207674_10166672
505 Ga0207675_100005010
506 Ga0207675_100045712
507 Ga0207675_100050371
508 Ga0207675_100410283
509 Ga0207683_10023359
510 Ga0207428_10737509
511 Ga0268265_10016679
512 Ga0268265_10374366
513 Ga0268265_10637851
514 Ga0268265_11690185
515 Ga0268264_10184533
516 Ga0307513_10017928
517 Ga0307513_10019740
518 Ga0307513_10032079
519 Ga0307513_10099119
520 Ga0307513_10246208
521 Ga0307509_10010026
522 Ga0307509_10181592
523 Ga0307408_100162340
524 Ga0307413_10033724
525 Ga0307410_10086163
526 Ga0307406_11568988
527 Ga0307407_10022631
528 Ga0307409_100012963
529 Ga0307409_101073826
530 Ga0307409_102954962
531 Ga0307416_100123279
532 Ga0307411_10006751
533 Ga0307411_10337881
534 Ga0307415_100512698
535 Ga0373957_0035607
536 Ga0373933_0785154
537 Ga0373947_0380821
538 Ga0451791_0214656
539 Ga0451791_1099545
540 Ga0451793_1027453
541 Ga0451800_1109256
542 Ga0451802_0003145
543 Ga0451802_0528915
544 Ga0451802_0649794
545 Ga0451807_0174921
546 Ga0451807_0224114
547 Ga0451807_0426531
548 Ga0451833_0989137
549 Ga0451835_0734021
550 Ga0451837_0567630
551 Ga0451845_0729224
552 Ga0451847_0609521
553 Ga0451849_0094283
554 Ga0451843_0839990
555 Ga0451855_1828463
556 Ga0451853_0860059
557 Ga0495603_0082045
558 Ga0495590_0047558
559 Ga0495638_0003825
560 Ga0495638_0050908
561 Ga0495638_0590748
562 Ga0495641_0277146
563 Ga0495584_0108166
564 Ga0495585_0182084
565 Ga0495596_0360942
566 Ga0495616_0006572
567 Ga0495616_0027423
568 Ga0495632_0143829
569 Ga0495632_0170978
570 Ga0495632_0393479
571 Ga0495637_0294963
572 Ga0495667_0481815
573 Ga0495668_0017193
574 Ga0495611_0319950
575 Ga0495625_0010426
576 Ga0495625_0030951
577 Ga0495625_0053182
578 Ga0495649_0002890
579 Ga0495649_0444371
580 Ga0495589_0155397
581 Ga0495680_0336448
582 Ga0495681_0300811
583 Ga0495686_0207707
584 Ga0495686_0232624
585 Ga0501039_1476528
586 Ga0501040_0425790
587 Ga0501042_0354185
588 Ga0501042_0675072
589 Ga0501067_0045999
590 Ga0501068_0003685
591 Ga0501068_0151878
592 Ga0501070_0058028
593 Ga0501070_0226597
594 Ga0501071_0474426
595 Ga0501073_0018851
596 Ga0501074_0047060
597 Ga0501075_0240220
598 Ga0501076_0781141
599 Ga0501077_0032072
600 Ga0501079_0001111
601 Ga0501079_0851285
602 Ga0501080_0265689
603 Ga0501080_1427007
604 Ga0501081_0687068
605 Ga0501083_0013752
606 nmdc:mga08y16_120507_c1
607 Ga0500611_023861
608 Ga0501084_0120036
609 Ga0501082_0075194
610 Ga0530510_1561434

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05437

AzlD

Branched-chain amino acid transport protein (AzlD)

23

123

0.93

Map