F397866

General Info

Members Datasets Scaffolds Average Seq Length
304 271 135 416

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2996887358|2996892322
Length 457
Sequence ILRKTSVSSVSNHAPPQSCHLSASPAQSGRCNCPSGGDTLASRMTSAGVLSLALFSTLAQPSFAGGLDRGGYNIDLLFDQSRFSAQAAVIYVMPQRELKNVKDTNTRSPLLGGDGNLNGRPNHADDTENYAVPYLGLKAGYEDVDCLLDYSEPFGAHTNPGINWAGANNNIETKIETHNYATTCSYKFDVGPGQLRLIGGAFYQEVEGFKERLVSTLPIAMGTGTGVGRLDLADNGWGWRTGIAYEIPEYGVRASLVYNSRVKYDDLSGTVDLTQVPVVPTYGGKVTNVVGSTEAPDSLELKVQSGIAPDWLAFGSVKWTNWSVLQSIALCPTTVTGSCNHSNQLTSLDLLYQDGWTVTGGIGHKFNEQWTGAVSLTWDRGTSHGYGSQTDSWTVGVGAAYNPTDNIEWRVAGALGVLTSGSSGVLVQDGVTYGNDVSYDFGNDLVAAVSTSIKVKF

Samples

Sample ID Description Type Environment
1 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
2 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2512875024 Mesorhizobium loti R88b Isolate Nodule
5 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
6 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
7 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
8 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
9 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
10 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
11 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
12 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
13 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
14 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
15 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
16 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
17 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
18 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
19 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
20 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
21 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
22 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
23 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
24 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
25 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
26 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
27 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
28 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
29 2643221568 Rhizobium sp. Root564 Isolate Unclassified
30 2643221582 Rhizobium sp. Root651 Isolate Unclassified
31 2643221618 Ensifer sp. Root231 Isolate Unclassified
32 2643221626 Ensifer sp. Root31 Isolate Unclassified
33 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
34 2643221655 Ensifer sp. Root1252 Isolate Unclassified
35 2643221659 Ensifer sp. Root127 Isolate Unclassified
36 2643221698 Ensifer sp. Root142 Isolate Unclassified
37 2643221712 Ensifer sp. Root258 Isolate Unclassified
38 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
39 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
40 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
41 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
42 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
43 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
44 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
45 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
46 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
47 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
48 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
49 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
50 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
51 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
52 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
53 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
54 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
55 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
56 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
57 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
58 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
59 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
60 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
61 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
62 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
63 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
64 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
65 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
66 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
67 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
68 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
69 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
70 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
71 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
72 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
73 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
74 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
75 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
76 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
77 2844163670 Ensifer sp. 1H6 Isolate Unclassified
78 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
79 2854911287 Brucella lupini LUP21 Isolate Unclassified
80 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
81 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
82 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
83 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
84 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
85 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
86 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
87 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
88 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
89 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
90 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
91 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
92 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
93 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
94 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
95 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
96 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
97 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
98 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
99 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
100 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
101 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
102 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
103 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
104 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
105 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
106 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
107 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
108 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
109 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
110 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
111 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
112 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
113 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
114 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
115 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
116 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
117 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
118 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
119 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
120 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
121 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
122 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
123 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
124 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
125 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
126 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
127 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
128 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
129 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
130 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
131 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
132 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
133 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
134 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
135 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
136 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
137 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
138 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
139 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
140 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
141 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
142 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
143 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
144 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
145 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
146 2996887358 Rhizobium sp. R711 Isolate Nodule
147 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
148 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
149 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
150 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
151 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
152 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
153 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
154 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
155 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
156 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
157 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
158 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
159 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
160 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
161 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
162 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
163 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
164 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
165 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
166 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
167 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
168 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
169 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
170 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
171 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
172 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
173 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
174 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
175 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
176 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
177 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
178 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
179 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
180 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
181 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
182 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
185 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
192 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
193 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
194 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
195 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
200 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
201 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
202 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
203 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
208 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
209 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
215 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
216 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
240 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
241 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
242 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
243 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
244 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
245 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
246 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
247 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
250 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
251 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
258 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
259 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
260 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
261 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
262 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
263 8005258706 Rhizobium sp. R693 Isolate Nodule
264 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
265 8005321885 Rhizobium sp. R72 Isolate Nodule
266 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
267 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
268 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
269 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
270 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
271 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 44.41
Metatranscriptomes 0
Isolates 55.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.83
Nodule 40.13
Rhizoplane 5.59
Rhizosphere 22.37
Stem 0
Stem Tuber 0
Unclassified 19.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000534 3300002773 Bacteria 21021
2 JGI25152J39213_1002149 3300002773 Bacteria 7738
3 JGI25151J46595_10005113 3300003187 Bacteria 6812
4 Ga0058692_1014040 3300003856 Bacteria 1846
5 Ga0065165_1001907 3300005262 Bacteria 19958
6 Ga0070666_10075944 3300005335 Bacteria 2291
7 Ga0075365_10001830 3300006038 Bacteria 9956
8 Ga0075368_10010398 3300006042 Bacteria 3364
9 Ga0075364_10001918 3300006051 Bacteria 11579
10 Ga0075362_10034981 3300006177 Bacteria 2192
11 Ga0075367_10041785 3300006178 Bacteria 2681
12 Ga0075369_10012808 3300006186 Bacteria 3316
13 Ga0079104_1000129 3300006946 Bacteria 108427
14 Ga0099826_10002926 3300006948 Bacteria 11342
15 Ga0105251_10005584 3300009011 Bacteria 8182
16 Ga0105240_10371165 3300009093 Bacteria 1618
17 Ga0105248_10084896 3300009177 Bacteria 3563
18 Ga0105238_10214831 3300009551 Bacteria 1899
19 Ga0105249_10072201 3300009553 Bacteria 3190
20 Ga0123341_1000001 3300009765 Bacteria 314908
21 Ga0105239_10099019 3300010375 Bacteria 3223
22 Ga0105239_10331212 3300010375 Bacteria 1717
23 Ga0157373_10018033 3300013100 Bacteria 5140
24 Ga0157369_10003763 3300013105 Bacteria 18031
25 Ga0157369_10054752 3300013105 Bacteria 4307
26 Ga0171463_1011 3300013249 Bacteria 230603
27 Ga0157374_10064006 3300013296 Bacteria 3450
28 Ga0182008_10018586 3300014497 Bacteria 3598
29 Ga0183363_1143 3300015690 Bacteria 17948
30 Ga0209673_1016274 3300025273 Bacteria 2788
31 Ga0209025_1000358 3300025294 Bacteria 97655
32 Ga0209025_1000702 3300025294 Bacteria 57061
33 Ga0209025_1011412 3300025294 Bacteria 5858
34 Ga0209758_1005650 3300025297 Bacteria 9476
35 Ga0209758_1017597 3300025297 Bacteria 3548
36 Ga0207426_1000853 3300025302 Bacteria 32038
37 Ga0209051_1007395 3300025303 Bacteria 6010
38 Ga0209281_1000036 3300027111 Bacteria 369415
39 Ga0209281_1000047 3300027111 Bacteria 326514
40 Ga0209371_1000382 3300027312 Bacteria 47344
41 Ga0209371_1002027 3300027312 Bacteria 12116
42 Ga0209282_1000095 3300027666 Bacteria 60099
43 Ga0307515_10036369 3300028794 Bacteria 7967
44 Ga0268256_1015026 3300030500 Bacteria 2275
45 Ga0307412_10002014 3300031911 Bacteria 11279
46 Ga0395905_0106896 3300037471 Bacteria 2627
47 Ga0451833_1340397 3300041491 Bacteria 4765
48 Ga0451839_0095376 3300041496 Bacteria 2531
49 Ga0451841_0999535 3300041498 Bacteria 2896
50 Ga0451851_0592809 3300041507 Bacteria 1921
51 Ga0451843_1187404 3300041509 Bacteria 1499
52 Ga0495638_0000687 3300046460 Bacteria 36753
53 Ga0495638_0030582 3300046460 Bacteria 3465
54 Ga0495638_0062565 3300046460 Bacteria 2297
55 Ga0495650_0052360 3300046471 Bacteria 1676
56 Ga0495605_0000460 3300046474 Bacteria 36596
57 Ga0495605_0062436 3300046474 Bacteria 1780
58 Ga0495607_0010345 3300046501 Bacteria 6276
59 Ga0495583_0047251 3300046506 Bacteria 1981
60 Ga0495606_0053862 3300046507 Bacteria 2608
61 Ga0495616_0034018 3300046513 Bacteria 2650
62 Ga0495620_0028679 3300046515 Bacteria 2584
63 Ga0495631_0006676 3300046518 Bacteria 5933
64 Ga0495643_0006856 3300046522 Bacteria 7423
65 Ga0495648_0109847 3300046524 Bacteria 1503
66 Ga0495597_0010327 3300046542 Bacteria 4570
67 Ga0495656_0055487 3300046615 Bacteria 1709
68 Ga0495668_0005947 3300046616 Bacteria 8104
69 Ga0495668_0058528 3300046616 Bacteria 2126
70 Ga0495625_0014847 3300046660 Bacteria 6196
71 Ga0495625_0025289 3300046660 Bacteria 4504
72 Ga0495588_0001225 3300046674 Bacteria 11061
73 Ga0495660_0059806 3300046810 Bacteria 2048
74 Ga0495672_0028243 3300047320 Bacteria 3552
75 Ga0495687_024395 3300047443 Bacteria 2875
76 Ga0495687_037342 3300047443 Bacteria 2165
77 Ga0495681_0071352 3300047470 Bacteria 1573
78 Ga0495686_0014638 3300047472 Bacteria 5394
79 Ga0496101_0079844 3300048904 Bacteria 2416
80 Ga0496103_0104201 3300048906 Bacteria 1798
81 Ga0496104_0063138 3300048907 Bacteria 3512
82 Ga0496105_0086689 3300048908 Bacteria 2587
83 Ga0496108_0238060 3300048911 Bacteria 1583
84 Ga0496110_0075795 3300048913 Bacteria 2989
85 Ga0496110_0079462 3300048913 Bacteria 2920
86 Ga0496111_0012393 3300048914 Bacteria 5771
87 Ga0496111_0087056 3300048914 Bacteria 2286
88 Ga0496112_0089456 3300048915 Bacteria 3047
89 Ga0496116_0053798 3300048919 Bacteria 2656
90 Ga0496117_0041193 3300048920 Bacteria 3387
91 Ga0496117_0047261 3300048920 Bacteria 3088
92 Ga0496119_0114378 3300048922 Bacteria 1493
93 Ga0496120_0089999 3300048923 Bacteria 1642
94 Ga0496121_0000001 3300048924 Bacteria 1830318
95 Ga0496121_0080968 3300048924 Bacteria 2572
96 Ga0496121_0084249 3300048924 Bacteria 2507
97 Ga0496121_0191944 3300048924 Bacteria 1463
98 Ga0496122_0000957 3300048925 Bacteria 52113
99 Ga0496122_0004590 3300048925 Bacteria 17003
100 Ga0496123_0065932 3300048926 Bacteria 2297
101 Ga0496123_0105818 3300048926 Bacteria 1622
102 Ga0496124_0000112 3300048927 Bacteria 166282
103 Ga0496124_0031480 3300048927 Bacteria 4695
104 Ga0496124_0058158 3300048927 Bacteria 3253
105 Ga0496124_0102291 3300048927 Bacteria 2319
106 Ga0496124_0205371 3300048927 Bacteria 1494
107 Ga0496125_0073167 3300048928 Bacteria 2666
108 Ga0496126_0000397 3300048929 Bacteria 89305
109 Ga0496126_0093003 3300048929 Bacteria 2648
110 Ga0496126_0180184 3300048929 Bacteria 1795
111 Ga0501037_0036686 3300049573 Bacteria 3612
112 Ga0501038_0068279 3300049574 Bacteria 3022
113 Ga0501039_0016368 3300049575 Bacteria 5683
114 Ga0501080_0033394 3300049742 Bacteria 4802
115 nmdc:mga00v17_222_c2 3300050491 Bacteria 26927
116 nmdc:mga06z11_118939_c1 3300050494 Bacteria 1472
117 nmdc:mga0sz30_35166_c1 3300050516 Bacteria 2089
118 Ga0500578_0047569 3300053086 Bacteria 2752
119 Ga0500578_0067775 3300053086 Bacteria 2275
120 Ga0500560_000392 3300053107 Bacteria 5889
121 Ga0500569_001932 3300053109 Bacteria 4010
122 Ga0500569_009347 3300053109 Bacteria 2275
123 Ga0500594_0000647 3300053118 Bacteria 7433
124 Ga0500618_000510 3300053125 Bacteria 24654
125 Ga0500655_005767 3300053133 Bacteria 2228
126 Ga0500658_0001748 3300053134 Bacteria 8573
127 Ga0500659_0056153 3300053135 Bacteria 2110
128 Ga0500568_0004459 3300053139 Bacteria 7476
129 Ga0500573_0003702 3300053140 Bacteria 7954
130 Ga0500616_0028963 3300053153 Bacteria 3049
131 Ga0500624_001949 3300053157 Bacteria 2950
132 Ga0500627_0037035 3300053158 Bacteria 2080
133 Ga0500627_0062071 3300053158 Bacteria 1645
134 Ga0500634_0001576 3300053161 Bacteria 8977
135 Ga0500636_0000019 3300053177 Bacteria 105042

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053135 Ga0500659_0056153 Ga0500659_0056153_976_2091 358
2 iso_pu_bacteria 2869234852 2869235751 370
3 iso_pu_bacteria 2871435913 2871439031 370
4 iso_pu_bacteria 2874109183 2874112754 370
5 iso_pu_bacteria 2878730984 2878737712 370
6 iso_pu_bacteria 2903513507 2903519475 370
7 3300048927 Ga0496124_0205371 Ga0496124_0205371_275_1468 377
8 3300053125 Ga0500618_000510 Ga0500618_000510_22039_23301 378
9 3300047320 Ga0495672_0028243 Ga0495672_0028243_1933_3087 379
10 3300048927 Ga0496124_0000112 Ga0496124_0000112_88076_89305 380
11 iso_pu_bacteria 2854911287 2854911873 381
12 iso_pu_bacteria 2977957713 2977964789 381
13 3300005262 Ga0065165_1001907 Ga0065165_10019078 382
14 3300003187 JGI25151J46595_10005113 JGI25151J46595_100051133 386
15 3300013105 Ga0157369_10054752 Ga0157369_100547524 386
16 3300025294 Ga0209025_1000702 Ga0209025_100070222 386
17 3300037471 Ga0395905_0106896 Ga0395905_0106896_780_2048 386
18 3300006051 Ga0075364_10001918 Ga0075364_100019187 388
19 3300050491 nmdc:mga00v17_222_c2 nmdc:mga00v17_222_c2_535_1821 388
20 iso_pu_bacteria 2687453392 2688598825 389
21 iso_pu_bacteria 2996386984 2996389304 389
22 iso_pu_bacteria 3004232784 3004236533 389
23 iso_pu_bacteria 3004268573 3004268924 389
24 3300053140 Ga0500573_0003702 Ga0500573_0003702_5023_6276 390
25 3300053161 Ga0500634_0001576 Ga0500634_0001576_5033_6271 391
26 iso_pu_bacteria 2512875024 2512958818 391
27 iso_pu_bacteria 2513237164 2514037625 391
28 iso_pu_bacteria 2582581304 2585254261 391
29 iso_pu_bacteria 2791355253 2793279522 391
30 iso_pu_bacteria 2510065059 2510313840 392
31 iso_pu_bacteria 2871451962 2871452823 392
32 iso_pu_bacteria 2924733363 2924739327 392
33 3300025294 Ga0209025_1000358 Ga0209025_100035859 393
34 iso_pu_bacteria 8004695233 8004700754 394
35 3300009093 Ga0105240_10371165 Ga0105240_103711651 396
36 3300009551 Ga0105238_10214831 Ga0105238_102148312 396
37 3300010375 Ga0105239_10099019 Ga0105239_100990192 396
38 3300013296 Ga0157374_10064006 Ga0157374_100640062 396
39 3300014497 Ga0182008_10018586 Ga0182008_100185863 396
40 3300048915 Ga0496112_0089456 Ga0496112_0089456_705_1973 396
41 3300048927 Ga0496124_0058158 Ga0496124_0058158_184_1425 396
42 3300013100 Ga0157373_10018033 Ga0157373_100180334 397
43 3300013105 Ga0157369_10003763 Ga0157369_1000376314 397
44 3300046460 Ga0495638_0030582 Ga0495638_0030582_1585_2862 397
45 3300048913 Ga0496110_0079462 Ga0496110_0079462_581_1798 397
46 3300048914 Ga0496111_0012393 Ga0496111_0012393_3814_5031 397
47 3300048922 Ga0496119_0114378 Ga0496119_0114378_100_1365 397
48 3300048925 Ga0496122_0004590 Ga0496122_0004590_12438_13655 397
49 3300048927 Ga0496124_0031480 Ga0496124_0031480_3055_4272 397
50 iso_pu_bacteria 2513237138 2513869905 397
51 iso_pu_bacteria 2582581867 2585400615 397
52 iso_pu_bacteria 2585427590 2585819827 397
53 iso_pu_bacteria 2600254933 2600375548 397
54 iso_pu_bacteria 2643221568 2643854457 397
55 iso_pu_bacteria 2923556063 2923558253 397
56 iso_pu_bacteria 8005542996 8005544742 397
57 3300009765 Ga0123341_1000001 Ga0123341_1000001177 398
58 3300010375 Ga0105239_10331212 Ga0105239_103312122 399
59 3300048920 Ga0496117_0047261 Ga0496117_0047261_69_1340 399
60 3300013249 Ga0171463_1011 Ga0171463_1011204 400
61 3300015690 Ga0183363_1143 Ga0183363_114312 400
62 3300048926 Ga0496123_0105818 Ga0496123_0105818_74_1348 400
63 3300053133 Ga0500655_005767 Ga0500655_005767_615_1853 400
64 iso_pu_bacteria 2818991461 2819683716 400
65 3300048927 Ga0496124_0102291 Ga0496124_0102291_1023_2264 401
66 iso_pu_bacteria 2582581283 2585168358 401
67 iso_pu_bacteria 2919166419 2919168792 401
68 3300047472 Ga0495686_0014638 Ga0495686_0014638_3548_4807 402
69 3300048929 Ga0496126_0000397 Ga0496126_0000397_39970_41214 402
70 3300003856 Ga0058692_1014040 Ga0058692_10140401 403
71 3300006948 Ga0099826_10002926 Ga0099826_100029266 403
72 3300027312 Ga0209371_1000382 Ga0209371_100038240 403
73 3300027312 Ga0209371_1002027 Ga0209371_10020276 403
74 3300027666 Ga0209282_1000095 Ga0209282_100009558 403
75 3300030500 Ga0268256_1015026 Ga0268256_10150261 403
76 3300046674 Ga0495588_0001225 Ga0495588_0001225_5119_6402 403
77 3300048920 Ga0496117_0041193 Ga0496117_0041193_13_1296 403
78 3300053107 Ga0500560_000392 Ga0500560_000392_1796_3079 403
79 iso_pu_bacteria 2537561587 2537875954 403
80 iso_pu_bacteria 2599185210 2599604184 403
81 iso_pu_bacteria 2599185236 2599721321 403
82 iso_pu_bacteria 2600255279 2601608023 403
83 iso_pu_bacteria 2600255308 2601744798 403
84 iso_pu_bacteria 2643221582 2643919414 403
85 iso_pu_bacteria 2838675328 2838676151 403
86 iso_pu_bacteria 2838714209 2838715033 403
87 iso_pu_bacteria 2838719591 2838721167 403
88 iso_pu_bacteria 2838724970 2838725792 403
89 iso_pu_bacteria 2841846520 2841848124 403
90 iso_pu_bacteria 2841859092 2841859324 403
91 iso_pu_bacteria 2842124991 2842125846 403
92 iso_pu_bacteria 2842130223 2842131045 403
93 iso_pu_bacteria 2842152218 2842153785 403
94 iso_pu_bacteria 2842170452 2842171276 403
95 iso_pu_bacteria 2842175837 2842177405 403
96 iso_pu_bacteria 2842187318 2842188141 403
97 iso_pu_bacteria 2842211629 2842212452 403
98 iso_pu_bacteria 2842224351 2842225929 403
99 iso_pu_bacteria 2842515876 2842516108 403
100 iso_pu_bacteria 2919114240 2919115124 403
101 iso_pu_bacteria 2926754445 2926756169 403
102 iso_pu_bacteria 2933006813 2933008431 403
103 iso_pu_bacteria 2933011516 2933013248 403
104 iso_pu_bacteria 2933594066 2933597937 403
105 iso_pu_bacteria 8054460903 8054462660 403
106 3300048924 Ga0496121_0000001 Ga0496121_0000001_1177112_1178395 404
107 iso_pu_bacteria 3000135777 3000140179 404
108 3300006946 Ga0079104_1000129 Ga0079104_1000129103 405
109 3300027111 Ga0209281_1000036 Ga0209281_1000036146 405
110 3300027111 Ga0209281_1000047 Ga0209281_100004788 405
111 iso_pu_bacteria 2509276018 2509371182 405
112 iso_pu_bacteria 2643221618 2644109470 405
113 iso_pu_bacteria 2643221626 2644145155 405
114 iso_pu_bacteria 2643221655 2644307735 405
115 iso_pu_bacteria 2643221659 2644332511 405
116 iso_pu_bacteria 2643221698 2644544258 405
117 iso_pu_bacteria 2643221712 2644613824 405
118 iso_pu_bacteria 2808606387 2808985307 405
119 iso_pu_bacteria 2844163670 2844170346 405
120 iso_pu_bacteria 2856334872 2856339031 405
121 iso_pu_bacteria 2856349417 2856353898 405
122 iso_pu_bacteria 2856356410 2856356586 405
123 iso_pu_bacteria 2857367948 2857371038 405
124 iso_pu_bacteria 2869249662 2869250834 405
125 iso_pu_bacteria 2869264136 2869271120 405
126 iso_pu_bacteria 2871488783 2871495606 405
127 iso_pu_bacteria 2874131515 2874136189 405
128 iso_pu_bacteria 2878753008 2878757799 405
129 iso_pu_bacteria 2881155292 2881155684 405
130 iso_pu_bacteria 2881845957 2881852124 405
131 iso_pu_bacteria 2881853255 2881855480 405
132 iso_pu_bacteria 2881861095 2881868769 405
133 iso_pu_bacteria 2882912400 2882914065 405
134 iso_pu_bacteria 2885318864 2885325273 405
135 iso_pu_bacteria 2885342637 2885349600 405
136 iso_pu_bacteria 2885350715 2885356507 405
137 iso_pu_bacteria 2903492973 2903506516 405
138 iso_pu_bacteria 2906363423 2906365629 405
139 iso_pu_bacteria 2906370794 2906372351 405
140 iso_pu_bacteria 2906393657 2906394677 405
141 iso_pu_bacteria 2924784321 2924785706 405
142 iso_pu_bacteria 2937868953 2937874199 405
143 iso_pu_bacteria 2941499720 2941499769 405
144 iso_pu_bacteria 2961127735 2961128664 405
145 iso_pu_bacteria 2961170736 2961174342 405
146 iso_pu_bacteria 2965032056 2965035838 405
147 iso_pu_bacteria 2965040258 2965043242 405
148 iso_pu_bacteria 2965089291 2965089320 405
149 iso_pu_bacteria 2967996073 2968000332 405
150 iso_pu_bacteria 2968003550 2968003783 405
151 iso_pu_bacteria 2970503327 2970506929 405
152 iso_pu_bacteria 2977821940 2977822331 405
153 iso_pu_bacteria 2977915119 2977922528 405
154 iso_pu_bacteria 2977950692 2977955183 405
155 iso_pu_bacteria 2979808191 2979812124 405
156 iso_pu_bacteria 3004195979 3004203092 405
157 iso_pu_bacteria 3004334049 3004341289 405
158 iso_pu_bacteria 8003570095 8003571240 405
159 iso_pu_bacteria 8004361976 8004365111 405
160 iso_pu_bacteria 8004374579 8004379310 405
161 3300048924 Ga0496121_0080968 Ga0496121_0080968_470_1750 406
162 iso_pu_bacteria 2821123053 2821129362 406
163 iso_pu_bacteria 2838736955 2838738605 406
164 iso_pu_bacteria 2841840854 2841841026 406
165 iso_pu_bacteria 2842140634 2842140804 406
166 iso_pu_bacteria 2857531043 2857535257 406
167 3300006042 Ga0075368_10010398 Ga0075368_100103982 407
168 3300006178 Ga0075367_10041785 Ga0075367_100417853 407
169 3300025273 Ga0209673_1016274 Ga0209673_10162742 407
170 3300025297 Ga0209758_1005650 Ga0209758_10056502 407
171 3300041491 Ga0451833_1340397 Ga0451833_1340397_3374_4648 407
172 3300041496 Ga0451839_0095376 Ga0451839_0095376_553_1827 407
173 3300041507 Ga0451851_0592809 Ga0451851_0592809_137_1411 407
174 3300041509 Ga0451843_1187404 Ga0451843_1187404_68_1342 407
175 3300046460 Ga0495638_0062565 Ga0495638_0062565_705_1979 407
176 3300046471 Ga0495650_0052360 Ga0495650_0052360_97_1371 407
177 3300046474 Ga0495605_0062436 Ga0495605_0062436_185_1459 407
178 3300046501 Ga0495607_0010345 Ga0495607_0010345_3866_5140 407
179 3300046506 Ga0495583_0047251 Ga0495583_0047251_368_1642 407
180 3300046507 Ga0495606_0053862 Ga0495606_0053862_268_1542 407
181 3300046513 Ga0495616_0034018 Ga0495616_0034018_972_2246 407
182 3300046515 Ga0495620_0028679 Ga0495620_0028679_312_1586 407
183 3300046522 Ga0495643_0006856 Ga0495643_0006856_1764_3038 407
184 3300046524 Ga0495648_0109847 Ga0495648_0109847_147_1421 407
185 3300046542 Ga0495597_0010327 Ga0495597_0010327_2296_3570 407
186 3300046615 Ga0495656_0055487 Ga0495656_0055487_230_1504 407
187 3300046616 Ga0495668_0058528 Ga0495668_0058528_380_1654 407
188 3300046660 Ga0495625_0014847 Ga0495625_0014847_3498_4772 407
189 3300046810 Ga0495660_0059806 Ga0495660_0059806_361_1635 407
190 3300047443 Ga0495687_024395 Ga0495687_024395_1573_2847 407
191 3300048929 Ga0496126_0180184 Ga0496126_0180184_31_1332 407
192 3300050494 nmdc:mga06z11_118939_c1 nmdc:mga06z11_118939_c1_150_1409 407
193 3300053086 Ga0500578_0067775 Ga0500578_0067775_775_2049 407
194 3300053109 Ga0500569_009347 Ga0500569_009347_775_2049 407
195 3300053134 Ga0500658_0001748 Ga0500658_0001748_7087_8361 407
196 3300053157 Ga0500624_001949 Ga0500624_001949_843_2144 407
197 3300053158 Ga0500627_0062071 Ga0500627_0062071_183_1457 407
198 iso_pu_bacteria 2869162929 2869169127 407
199 iso_pu_bacteria 2929138655 2929139800 407
200 3300041498 Ga0451841_0999535 Ga0451841_0999535_980_2254 408
201 3300048924 Ga0496121_0191944 Ga0496121_0191944_136_1365 408
202 iso_pu_bacteria 2765235802 2765464199 409
203 iso_pu_bacteria 2791355123 2792749719 409
204 iso_pu_bacteria 2857349434 2857350658 409
205 iso_pu_bacteria 2874102143 2874105941 409
206 iso_pu_bacteria 2904578770 2904581040 409
207 iso_pu_bacteria 2919119836 2919121167 409
208 iso_pu_bacteria 2919119836 2919121752 409
209 iso_pu_bacteria 2958115193 2958118797 409
210 iso_pu_bacteria 2968091066 2968096613 409
211 iso_pu_bacteria 2987636660 2987637842 409
212 iso_pu_bacteria 3004203850 3004205836 409
213 iso_pu_bacteria 8004703790 8004709699 409
214 3300031911 Ga0307412_10002014 Ga0307412_100020144 410
215 iso_pu_bacteria 637000159 637074204 410
216 3300046460 Ga0495638_0000687 Ga0495638_0000687_33970_35217 411
217 3300046474 Ga0495605_0000460 Ga0495605_0000460_1429_2676 411
218 3300046518 Ga0495631_0006676 Ga0495631_0006676_3453_4700 411
219 3300046616 Ga0495668_0005947 Ga0495668_0005947_1348_2595 411
220 3300046660 Ga0495625_0025289 Ga0495625_0025289_1560_2807 411
221 3300048925 Ga0496122_0000957 Ga0496122_0000957_11128_12384 411
222 3300053086 Ga0500578_0047569 Ga0500578_0047569_801_2048 411
223 3300053109 Ga0500569_001932 Ga0500569_001932_1384_2631 411
224 3300053118 Ga0500594_0000647 Ga0500594_0000647_886_2133 411
225 3300053158 Ga0500627_0037035 Ga0500627_0037035_817_2064 411
226 iso_pu_bacteria 2534681796 2535516068 411
227 3300025294 Ga0209025_1011412 Ga0209025_10114121 412
228 3300025297 Ga0209758_1017597 Ga0209758_10175974 412
229 3300047443 Ga0495687_037342 Ga0495687_037342_323_1567 412
230 3300053139 Ga0500568_0004459 Ga0500568_0004459_5030_6280 412
231 3300053153 Ga0500616_0028963 Ga0500616_0028963_1385_2635 412
232 iso_pu_bacteria 2765235802 2765465057 412
233 iso_pu_bacteria 2996887358 2996892322 412
234 iso_pu_bacteria 8005258706 8005259604 412
235 iso_pu_bacteria 8005321885 8005326849 412
236 iso_pu_bacteria 2513237093 2513632905 414
237 iso_pu_bacteria 2582581299 2585232506 414
238 iso_pu_bacteria 2936367885 2936373331 414
239 iso_pu_bacteria 2936375103 2936378597 414
240 iso_pu_bacteria 8005376324 8005378639 414
241 iso_pu_bacteria 8005563573 8005569451 414
242 iso_pu_bacteria 8024479707 8024485590 414
243 3300053177 Ga0500636_0000019 Ga0500636_0000019_63606_64874 415
244 iso_pu_bacteria 2582581294 2585199786 415
245 iso_pu_bacteria 2643221643 2644238194 415
246 iso_pu_bacteria 2513237085 2513575410 416
247 iso_pu_bacteria 2513237103 2513710363 416
248 iso_pu_bacteria 2515154113 2515634801 416
249 iso_pu_bacteria 2515154134 2515739204 416
250 iso_pu_bacteria 2516653085 2517075885 416
251 iso_pu_bacteria 2529292951 2530645001 416
252 iso_pu_bacteria 2585427526 2585528844 416
253 iso_pu_bacteria 2721755556 2723026450 416
254 iso_pu_bacteria 2728369352 2730107386 416
255 iso_pu_bacteria 2838686498 2838693260 416
256 iso_pu_bacteria 2838729681 2838736122 416
257 iso_pu_bacteria 2838742623 2838748885 416
258 iso_pu_bacteria 2841851746 2841858221 416
259 iso_pu_bacteria 2842156927 2842163060 416
260 iso_pu_bacteria 2842163707 2842165158 416
261 iso_pu_bacteria 2842180545 2842186692 416
262 iso_pu_bacteria 2842229732 2842235985 416
263 iso_pu_bacteria 2842243621 2842249844 416
264 iso_pu_bacteria 2842257432 2842263795 416
265 iso_pu_bacteria 2842271015 2842277728 416
266 iso_pu_bacteria 2842304105 2842310321 416
267 iso_pu_bacteria 2844454524 2844454627 416
268 iso_pu_bacteria 2933570622 2933576761 416
269 iso_pu_bacteria 2935901341 2935904993 416
270 iso_pu_bacteria 8005307578 8005314787 416
271 iso_pu_bacteria 8023680758 8023680817 416
272 3300028794 Ga0307515_10036369 Ga0307515_100363697 418
273 3300047470 Ga0495681_0071352 Ga0495681_0071352_207_1478 418
274 3300049573 Ga0501037_0036686 Ga0501037_0036686_905_2173 418
275 3300049574 Ga0501038_0068279 Ga0501038_0068279_648_1916 418
276 3300049575 Ga0501039_0016368 Ga0501039_0016368_998_2266 418
277 3300049742 Ga0501080_0033394 Ga0501080_0033394_3342_4610 418
278 iso_pu_bacteria 2513237088 2513598040 419
279 3300002773 JGI25152J39213_1000534 JGI25152J39213_100053418 420
280 3300002773 JGI25152J39213_1002149 JGI25152J39213_10021494 420
281 3300005335 Ga0070666_10075944 Ga0070666_100759442 420
282 3300006038 Ga0075365_10001830 Ga0075365_100018307 420
283 3300006177 Ga0075362_10034981 Ga0075362_100349811 420
284 3300006186 Ga0075369_10012808 Ga0075369_100128083 420
285 3300009011 Ga0105251_10005584 Ga0105251_100055846 420
286 3300009177 Ga0105248_10084896 Ga0105248_100848962 420
287 3300009553 Ga0105249_10072201 Ga0105249_100722012 420
288 3300025302 Ga0207426_1000853 Ga0207426_100085324 420
289 3300025303 Ga0209051_1007395 Ga0209051_10073952 420
290 3300048904 Ga0496101_0079844 Ga0496101_0079844_101_1363 420
291 3300048906 Ga0496103_0104201 Ga0496103_0104201_105_1367 420
292 3300048907 Ga0496104_0063138 Ga0496104_0063138_1162_2424 420
293 3300048908 Ga0496105_0086689 Ga0496105_0086689_282_1544 420
294 3300048911 Ga0496108_0238060 Ga0496108_0238060_196_1458 420
295 3300048913 Ga0496110_0075795 Ga0496110_0075795_610_1872 420
296 3300048914 Ga0496111_0087056 Ga0496111_0087056_176_1438 420
297 3300048919 Ga0496116_0053798 Ga0496116_0053798_294_1556 420
298 3300048923 Ga0496120_0089999 Ga0496120_0089999_273_1535 420
299 3300048924 Ga0496121_0084249 Ga0496121_0084249_1075_2337 420
300 3300048926 Ga0496123_0065932 Ga0496123_0065932_869_2131 420
301 3300048928 Ga0496125_0073167 Ga0496125_0073167_1191_2453 420
302 3300048929 Ga0496126_0093003 Ga0496126_0093003_248_1510 420
303 3300050516 nmdc:mga0sz30_35166_c1 nmdc:mga0sz30_35166_c1_47_1309 420
304 iso_pu_bacteria 2510917028 2511181957 420

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03349

Toluene_X

Outer membrane protein transport protein (OMPP1/FadL/TodX)

76

413

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pgs-assembly2.cif.gz_B phe3gly mutant of ecfadl 0.7875 38 419
2r4l-assembly1.cif.gz_A crystal structure of the long-chain fatty acid transporter fadl mutant p34a 0.784 39 419
2r4l-assembly3.cif.gz_C crystal structure of the long-chain fatty acid transporter fadl mutant p34a 0.7832 35 419
2r4l-assembly2.cif.gz_B crystal structure of the long-chain fatty acid transporter fadl mutant p34a 0.7693 39 419
2r4n-assembly2.cif.gz_B crystal structure of the long-chain fatty acid transporter fadl mutant n33a 0.7682 33 419
ID Description Score Start End Superfamily
1t16A00 Mainly Beta;Beta Barrel;Porin;Outer membrane protein transport protein (OMPP1/FadL/TodX) 0.7648 38 419 2.40.160.60
3pgrA00 Mainly Beta;Beta Barrel;Porin;Outer membrane protein transport protein (OMPP1/FadL/TodX) 0.7471 38 419 2.40.160.60
3dwoX00 Mainly Beta;Beta Barrel;Porin;Outer membrane protein transport protein (OMPP1/FadL/TodX) 0.7354 2 419 2.40.160.60
3dwoX00 Mainly Beta;Beta Barrel;Porin;Outer membrane protein transport protein (OMPP1/FadL/TodX) 0.7328 2 419 2.40.160.60
1t16A00 Mainly Beta;Beta Barrel;Porin;Outer membrane protein transport protein (OMPP1/FadL/TodX) 0.6979 38 419 2.40.160.60
ID Description Score Start End GO Terms
AF-A0A2S8U974-F1-model_v4 deleted 0.904 34 419
AF-A0A2S8U974-F1-model_v4 deleted 0.8993 34 419
AF-A0A527ZEQ7-F1-model_v4 TonB-dependent receptor 0.8906 123 280
AF-A0A839ET10-F1-model_v4 Long-chain fatty acid transport protein 0.884 1 419 GO:0009279
GO:0015483
AF-A0A839ET10-F1-model_v4 Long-chain fatty acid transport protein 0.8817 1 419 GO:0009279
GO:0015483

Feature Viewer

pLDDT pTM Quality
86.74 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map