F397813

General Info

Members Datasets Scaffolds Average Seq Length
304 206 608 160

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_252900_c1|nmdc:mga0n895_252900_c1_508_1032
Length 174
Sequence LTIADRDFRLLIEGAVTTDDGRALLRHTLATLAYRGGKAIRDAPSGFSEFRVAETSRTPGQILAHIGDLLDWGLSLAEGAQRWQNSTPLPWPEESQRFFDALKKFDDRLADPTPLASPAEQLFQGPVADSLTHVGQLTMLRRVAGGPIKGENYFRADIVAGRVGADQSAPKREF

Samples

Sample ID Description Type Environment
1 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
142 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
143 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
172 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
180 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
196 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.92
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 36.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0n895_252900_c1 3300050512 Bacteria 1788
2 JGI24034J26672_10006085 3300002239 Bacteria 1739
3 Ga0065712_10000695 3300005290 Bacteria 9164
4 Ga0070658_10086375 3300005327 Bacteria 2580
5 Ga0070683_100007284 3300005329 Bacteria 9332
6 Ga0070683_100195702 3300005329 Unclassified 1919
7 Ga0070683_100745634 3300005329 Unclassified 938
8 Ga0070690_100141646 3300005330 Unclassified 1633
9 Ga0070690_100155225 3300005330 Bacteria 1564
10 Ga0070670_100001152 3300005331 Bacteria 20970
11 Ga0070670_100012675 3300005331 Bacteria 7218
12 Ga0070670_100028406 3300005331 Bacteria 4814
13 Ga0070670_100114305 3300005331 Bacteria 2327
14 Ga0068869_100153148 3300005334 Bacteria 1789
15 Ga0070666_10138001 3300005335 Bacteria 1697
16 Ga0070666_10224606 3300005335 Unclassified 1325
17 Ga0070682_100213190 3300005337 Bacteria 1370
18 Ga0068868_100048017 3300005338 Bacteria 3348
19 Ga0070660_100536331 3300005339 Bacteria 975
20 Ga0070689_100005023 3300005340 Bacteria 8991
21 Ga0070689_100754681 3300005340 Bacteria 853
22 Ga0070691_10671477 3300005341 Unclassified 619
23 Ga0070687_100012637 3300005343 Unclassified 3735
24 Ga0070687_100933960 3300005343 Unclassified 624
25 Ga0070661_100017610 3300005344 Bacteria 5070
26 Ga0070661_100103530 3300005344 Unclassified 2120
27 Ga0070675_100014507 3300005354 Bacteria 6215
28 Ga0070675_100470465 3300005354 Unclassified 1129
29 Ga0070671_100050387 3300005355 Unclassified 3463
30 Ga0070671_100391420 3300005355 Bacteria 1188
31 Ga0070674_100470515 3300005356 Bacteria 1041
32 Ga0070659_100093012 3300005366 Unclassified 2419
33 Ga0070659_101377534 3300005366 Unclassified 626
34 Ga0070714_100118111 3300005435 Bacteria 2356
35 Ga0070713_100000015 3300005436 Bacteria 121525
36 Ga0070701_10123067 3300005438 Unclassified 1464
37 Ga0070711_100002854 3300005439 Bacteria 9941
38 Ga0070705_100015330 3300005440 Bacteria 3961
39 Ga0070708_100000847 3300005445 Bacteria 23031
40 Ga0070708_100003106 3300005445 Bacteria 12929
41 Ga0070708_100513602 3300005445 Bacteria 1130
42 Ga0070708_100582529 3300005445 Bacteria 1055
43 Ga0070663_100008558 3300005455 Bacteria 6302
44 Ga0070663_100591379 3300005455 Unclassified 932
45 Ga0070662_100012306 3300005457 Bacteria 5670
46 Ga0070662_100377794 3300005457 Unclassified 1166
47 Ga0070681_10045595 3300005458 Bacteria 4385
48 Ga0070685_10000447 3300005466 Bacteria 24052
49 Ga0070685_10000730 3300005466 Bacteria 17916
50 Ga0070685_10243491 3300005466 Unclassified 1188
51 Ga0070706_100046627 3300005467 Bacteria 4000
52 Ga0070706_101461704 3300005467 Bacteria 625
53 Ga0070706_102062775 3300005467 Unclassified 516
54 Ga0070707_100009024 3300005468 Bacteria 9249
55 Ga0070707_100211227 3300005468 Bacteria 1891
56 Ga0070698_101456431 3300005471 Unclassified 636
57 Ga0070699_100009134 3300005518 Bacteria 8596
58 Ga0070699_100031323 3300005518 Bacteria 4590
59 Ga0070699_100257772 3300005518 Bacteria 1559
60 Ga0070679_100107450 3300005530 Unclassified 2776
61 Ga0070684_100000515 3300005535 Bacteria 26549
62 Ga0070684_100132553 3300005535 Bacteria 2248
63 Ga0070684_100208216 3300005535 Unclassified 1782
64 Ga0070697_100031408 3300005536 Bacteria 4273
65 Ga0070697_100072836 3300005536 Bacteria 2819
66 Ga0068853_100732051 3300005539 Unclassified 945
67 Ga0070672_101355788 3300005543 Unclassified 636
68 Ga0070686_100150972 3300005544 Unclassified 1627
69 Ga0070695_100107651 3300005545 Unclassified 1887
70 Ga0070695_100132205 3300005545 Bacteria 1721
71 Ga0070693_100069489 3300005547 Bacteria 2070
72 Ga0070693_100843657 3300005547 Bacteria 682
73 Ga0070665_100359853 3300005548 Unclassified 1461
74 Ga0070704_100278986 3300005549 Bacteria 1383
75 Ga0068855_100304452 3300005563 Bacteria 1764
76 Ga0070664_100001660 3300005564 Bacteria 17800
77 Ga0070664_100019448 3300005564 Bacteria 5587
78 Ga0070664_100779259 3300005564 Unclassified 893
79 Ga0068857_100001489 3300005577 Bacteria 18648
80 Ga0068857_100926708 3300005577 Unclassified 836
81 Ga0068854_101262378 3300005578 Unclassified 664
82 Ga0068856_100015985 3300005614 Bacteria 7254
83 Ga0068856_100137950 3300005614 Unclassified 2445
84 Ga0068856_100875491 3300005614 Bacteria 917
85 Ga0070702_100258461 3300005615 Bacteria 1184
86 Ga0068852_100004805 3300005616 Bacteria 9597
87 Ga0068859_100645871 3300005617 Bacteria 1150
88 Ga0068864_101494720 3300005618 Unclassified 678
89 Ga0068866_10157660 3300005718 Bacteria 1320
90 Ga0068851_10008614 3300005834 Unclassified 4719
91 Ga0068863_100020580 3300005841 Bacteria 6306
92 Ga0068858_100006821 3300005842 Bacteria 11107
93 Ga0068860_100294276 3300005843 Unclassified 1589
94 Ga0068860_102082814 3300005843 Unclassified 589
95 Ga0068862_100066571 3300005844 Bacteria 3104
96 Ga0070717_10003308 3300006028 Bacteria 11519
97 Ga0070716_100182211 3300006173 Unclassified 1380
98 Ga0070712_100057766 3300006175 Bacteria 2727
99 Ga0097621_100405401 3300006237 Unclassified 1221
100 Ga0068871_100511046 3300006358 Unclassified 1084
101 Ga0075433_10136409 3300006852 Unclassified 2181
102 Ga0075433_10343319 3300006852 Bacteria 1320
103 Ga0075433_10504594 3300006852 Bacteria 1065
104 Ga0075434_100009513 3300006871 Bacteria 9067
105 Ga0075434_100299802 3300006871 Bacteria 1628
106 Ga0075434_100514461 3300006871 Bacteria 1217
107 Ga0075434_101690497 3300006871 Bacteria 641
108 Ga0097620_100645966 3300006931 Bacteria 1150
109 Ga0105245_10008699 3300009098 Bacteria 8850
110 Ga0114129_10013473 3300009147 Bacteria 11650
111 Ga0105248_10012491 3300009177 Bacteria 9367
112 Ga0105248_10025228 3300009177 Bacteria 6609
113 Ga0105238_10046188 3300009551 Bacteria 4396
114 Ga0105238_12156287 3300009551 Unclassified 592
115 Ga0105249_10221886 3300009553 Unclassified 1860
116 Ga0105239_10109844 3300010375 Bacteria 3057
117 Ga0105246_10290801 3300011119 Bacteria 1315
118 Ga0157373_10006123 3300013100 Bacteria 8996
119 Ga0157373_10499347 3300013100 Unclassified 879
120 Ga0157371_10417298 3300013102 Bacteria 983
121 Ga0157374_10103215 3300013296 Unclassified 2736
122 Ga0157374_10106172 3300013296 Unclassified 2698
123 Ga0157372_10204063 3300013307 Unclassified 2290
124 Ga0157372_10555067 3300013307 Bacteria 1339
125 Ga0157375_10085018 3300013308 Bacteria 3213
126 Ga0157375_11925575 3300013308 Unclassified 702
127 Ga0163163_10005247 3300014325 Bacteria 11173
128 Ga0157377_10263953 3300014745 Unclassified 1121
129 Ga0157376_10464387 3300014969 Unclassified 1237
130 Ga0163161_11744926 3300017792 Unclassified 552
131 Ga0207697_10009946 3300025315 Bacteria 4086
132 Ga0207697_10116167 3300025315 Unclassified 1149
133 Ga0207656_10042769 3300025321 Bacteria 1929
134 Ga0207656_10518304 3300025321 Unclassified 606
135 Ga0207682_10065235 3300025893 Bacteria 1532
136 Ga0207680_10037278 3300025903 Bacteria 2806
137 Ga0207647_10122724 3300025904 Bacteria 1531
138 Ga0207699_10006659 3300025906 Bacteria 5605
139 Ga0207643_10000795 3300025908 Bacteria 19216
140 Ga0207705_10071058 3300025909 Bacteria 2523
141 Ga0207684_10040083 3300025910 Bacteria 3970
142 Ga0207707_10097621 3300025912 Unclassified 2568
143 Ga0207695_10248669 3300025913 Unclassified 1678
144 Ga0207693_10002271 3300025915 Bacteria 16712
145 Ga0207663_10020193 3300025916 Unclassified 3769
146 Ga0207662_10002843 3300025918 Bacteria 8753
147 Ga0207657_10003847 3300025919 Bacteria 15937
148 Ga0207649_10000355 3300025920 Bacteria 34488
149 Ga0207649_11221340 3300025920 Unclassified 594
150 Ga0207646_10079184 3300025922 Bacteria 2938
151 Ga0207646_10132420 3300025922 Unclassified 2244
152 Ga0207694_10000013 3300025924 Bacteria 384823
153 Ga0207650_10000406 3300025925 Bacteria 38605
154 Ga0207650_10014056 3300025925 Bacteria 5558
155 Ga0207650_10064667 3300025925 Bacteria 2739
156 Ga0207650_10085314 3300025925 Unclassified 2402
157 Ga0207687_10000845 3300025927 Bacteria 20686
158 Ga0207700_10002952 3300025928 Bacteria 9809
159 Ga0207664_10000227 3300025929 Bacteria 42512
160 Ga0207664_10089268 3300025929 Bacteria 2524
161 Ga0207690_10157822 3300025932 Unclassified 1688
162 Ga0207706_10048686 3300025933 Bacteria 3748
163 Ga0207706_10159204 3300025933 Unclassified 1985
164 Ga0207670_10002833 3300025936 Bacteria 9149
165 Ga0207670_10854848 3300025936 Bacteria 760
166 Ga0207669_10327588 3300025937 Bacteria 1175
167 Ga0207665_10215981 3300025939 Unclassified 1403
168 Ga0207691_10000983 3300025940 Bacteria 28357
169 Ga0207711_10354497 3300025941 Bacteria 1359
170 Ga0207711_10364046 3300025941 Unclassified 1340
171 Ga0207689_10000442 3300025942 Bacteria 38930
172 Ga0207689_10511908 3300025942 Bacteria 1006
173 Ga0207661_10000913 3300025944 Bacteria 19396
174 Ga0207661_10048584 3300025944 Unclassified 3373
175 Ga0207661_10838949 3300025944 Unclassified 846
176 Ga0207679_10000065 3300025945 Bacteria 97825
177 Ga0207679_10136661 3300025945 Bacteria 1975
178 Ga0207679_10296846 3300025945 Unclassified 1391
179 Ga0207667_10233175 3300025949 Bacteria 1884
180 Ga0207667_10299823 3300025949 Unclassified 1642
181 Ga0207651_10334693 3300025960 Unclassified 1270
182 Ga0207651_11714080 3300025960 Unclassified 566
183 Ga0207668_10633321 3300025972 Bacteria 934
184 Ga0207640_10191649 3300025981 Bacteria 1541
185 Ga0207640_10854877 3300025981 Unclassified 792
186 Ga0207658_10239622 3300025986 Unclassified 1536
187 Ga0207677_10174503 3300026023 Unclassified 1685
188 Ga0207703_10000081 3300026035 Bacteria 111679
189 Ga0207639_10172357 3300026041 Bacteria 1833
190 Ga0207678_10006307 3300026067 Bacteria 10532
191 Ga0207678_10682343 3300026067 Unclassified 903
192 Ga0207708_10254242 3300026075 Bacteria 1417
193 Ga0207702_10144519 3300026078 Unclassified 2157
194 Ga0207641_10001133 3300026088 Bacteria 26765
195 Ga0207648_10000946 3300026089 Bacteria 32833
196 Ga0207676_10001573 3300026095 Bacteria 16787
197 Ga0207676_10553663 3300026095 Bacteria 1099
198 Ga0207674_10000404 3300026116 Bacteria 56025
199 Ga0207674_10188359 3300026116 Unclassified 2013
200 Ga0207683_10519711 3300026121 Unclassified 1100
201 Ga0207683_10804982 3300026121 Unclassified 872
202 Ga0268266_10056943 3300028379 Bacteria 3362
203 Ga0268266_10328565 3300028379 Unclassified 1433
204 Ga0268264_10753858 3300028381 Unclassified 970
205 Ga0265338_10060436 3300028800 Bacteria 3330
206 Ga0265339_10013012 3300031249 Bacteria 5058
207 Ga0265331_10085643 3300031250 Bacteria 1460
208 Ga0265327_10100244 3300031251 Bacteria 1398
209 Ga0307508_10010693 3300031616 Bacteria 8389
210 Ga0265314_10058555 3300031711 Bacteria 2639
211 Ga0307416_100413271 3300032002 Unclassified 1391
212 Ga0373959_0000252 3300034820 Bacteria 11682
213 Ga0373926_0031115 3300035083 Bacteria 1881
214 Ga0373934_0000314 3300035086 Bacteria 16983
215 Ga0373944_0006502 3300035089 Bacteria 3104
216 Ga0373923_0041400 3300035111 Bacteria 1899
217 Ga0373945_0001525 3300035116 Bacteria 7078
218 Ga0373953_0000976 3300035117 Bacteria 8029
219 Ga0373953_0022609 3300035117 Unclassified 2372
220 Ga0373954_0007958 3300035118 Bacteria 4643
221 Ga0373954_0132136 3300035118 Unclassified 1215
222 Ga0373954_0149455 3300035118 Bacteria 1141
223 Ga0373956_0004048 3300035119 Bacteria 5885
224 Ga0373943_0000515 3300035170 Bacteria 16652
225 Ga0373955_0001966 3300035172 Bacteria 8850
226 Ga0373955_0193376 3300035172 Bacteria 1210
227 Ga0373955_0573595 3300035172 Unclassified 690
228 Ga0373924_0110181 3300035410 Unclassified 1189
229 Ga0373935_0005036 3300035692 Bacteria 7780
230 Ga0373927_0000919 3300035695 Bacteria 22348
231 Ga0373927_0013284 3300035695 Bacteria 5474
232 Ga0373933_0214011 3300035724 Unclassified 1235
233 Ga0373947_0005235 3300035725 Bacteria 7581
234 Ga0373937_0000279 3300036401 Bacteria 48780
235 Ga0373937_0020762 3300036401 Bacteria 5891
236 Ga0373937_0065029 3300036401 Unclassified 3356
237 Ga0373937_1185808 3300036401 Bacteria 712
238 Ga0373925_0000313 3300037068 Bacteria 50692
239 Ga0373925_0117167 3300037068 Bacteria 2064
240 Ga0395899_0097747 3300037312 Bacteria 2122
241 Ga0395898_0953593 3300037466 Bacteria 795
242 Ga0395905_0030649 3300037471 Bacteria 5065
243 Ga0395901_0101226 3300038443 Bacteria 3023
244 Ga0439446_0070781 3300042156 Unclassified 1067
245 Ga0439434_0073219 3300042435 Unclassified 1080
246 Ga0451576_0618875 3300045051 Unclassified 1138
247 Ga0495592_0148231 3300046454 Bacteria 1625
248 Ga0495629_0085476 3300046459 Unclassified 2201
249 Ga0495651_0087817 3300046462 Bacteria 2338
250 Ga0495653_0076007 3300046463 Unclassified 2498
251 Ga0495580_0029046 3300046472 Bacteria 4016
252 Ga0495580_0166388 3300046472 Bacteria 1525
253 Ga0495580_0286464 3300046472 Bacteria 1123
254 Ga0495608_0477764 3300046511 Unclassified 756
255 Ga0495628_0175148 3300046516 Unclassified 1625
256 Ga0495652_0179424 3300046529 Unclassified 1627
257 Ga0495665_0171367 3300046531 Unclassified 1130
258 Ga0495587_0268257 3300046536 Unclassified 958
259 Ga0495645_0109267 3300046543 Unclassified 1958
260 Ga0495635_0132120 3300046663 Unclassified 1702
261 Ga0495599_0214166 3300046678 Unclassified 1180
262 Ga0495599_0538606 3300046678 Unclassified 684
263 Ga0495623_0171888 3300046679 Unclassified 1265
264 Ga0495646_0095030 3300046680 Unclassified 1716
265 Ga0495647_0036653 3300046681 Bacteria 1847
266 Ga0495624_0058475 3300046690 Unclassified 2421
267 Ga0495674_0004675 3300047319 Bacteria 13162
268 Ga0495672_0013111 3300047320 Bacteria 5734
269 Ga0495672_0088910 3300047320 Bacteria 1701
270 Ga0495680_0074404 3300047322 Bacteria 2580
271 Ga0495684_0038631 3300047471 Unclassified 3659
272 Ga0495602_0185373 3300048088 Unclassified 1601
273 Ga0496101_0237505 3300048904 Bacteria 1418
274 Ga0496104_0004106 3300048907 Bacteria 12639
275 Ga0496104_1712787 3300048907 Unclassified 531
276 Ga0496108_0000459 3300048911 Bacteria 32612
277 Ga0496108_0069008 3300048911 Unclassified 2982
278 Ga0496109_0000655 3300048912 Bacteria 28687
279 Ga0496109_0003511 3300048912 Bacteria 13099
280 Ga0496109_1724433 3300048912 Unclassified 560
281 Ga0496110_0001127 3300048913 Bacteria 18853
282 Ga0496110_0012863 3300048913 Bacteria 6897
283 Ga0496110_1320424 3300048913 Unclassified 631
284 Ga0496111_0006201 3300048914 Bacteria 7745
285 Ga0496111_0252751 3300048914 Unclassified 1308
286 Ga0496112_0036308 3300048915 Bacteria 4807
287 Ga0496112_0117262 3300048915 Bacteria 2632
288 Ga0496112_0330902 3300048915 Unclassified 1467
289 Ga0496113_0041529 3300048916 Bacteria 3394
290 Ga0496113_0841971 3300048916 Bacteria 727
291 Ga0501031_0311956 3300049568 Bacteria 1019
292 Ga0501036_0364038 3300049572 Unclassified 1207
293 Ga0501038_0320480 3300049574 Bacteria 1213
294 Ga0501039_0117380 3300049575 Bacteria 2084
295 Ga0501068_0059261 3300049584 Bacteria 2325
296 Ga0501072_0048008 3300049588 Bacteria 3362
297 Ga0501072_0511833 3300049588 Unclassified 949
298 Ga0501077_0068379 3300049593 Bacteria 2252
299 Ga0501081_0578859 3300049743 Bacteria 840
300 Ga0501083_0004042 3300049744 Bacteria 10319
301 Ga0501035_0232244 3300049822 Bacteria 1572
302 nmdc:mga0n895_13149_c1 3300050512 Bacteria 7453
303 nmdc:mga0n895_1379930_c1 3300050512 Bacteria 674
304 Ga0495619_0688174 3300053085 Unclassified 696
305 nmdc:mga0n895_252900_c1
306 JGI24034J26672_10006085
307 Ga0065712_10000695
308 Ga0070658_10086375
309 Ga0070683_100007284
310 Ga0070683_100195702
311 Ga0070683_100745634
312 Ga0070690_100141646
313 Ga0070690_100155225
314 Ga0070670_100001152
315 Ga0070670_100012675
316 Ga0070670_100028406
317 Ga0070670_100114305
318 Ga0068869_100153148
319 Ga0070666_10138001
320 Ga0070666_10224606
321 Ga0070682_100213190
322 Ga0068868_100048017
323 Ga0070660_100536331
324 Ga0070689_100005023
325 Ga0070689_100754681
326 Ga0070691_10671477
327 Ga0070687_100012637
328 Ga0070687_100933960
329 Ga0070661_100017610
330 Ga0070661_100103530
331 Ga0070675_100014507
332 Ga0070675_100470465
333 Ga0070671_100050387
334 Ga0070671_100391420
335 Ga0070674_100470515
336 Ga0070659_100093012
337 Ga0070659_101377534
338 Ga0070714_100118111
339 Ga0070713_100000015
340 Ga0070701_10123067
341 Ga0070711_100002854
342 Ga0070705_100015330
343 Ga0070708_100000847
344 Ga0070708_100003106
345 Ga0070708_100513602
346 Ga0070708_100582529
347 Ga0070663_100008558
348 Ga0070663_100591379
349 Ga0070662_100012306
350 Ga0070662_100377794
351 Ga0070681_10045595
352 Ga0070685_10000447
353 Ga0070685_10000730
354 Ga0070685_10243491
355 Ga0070706_100046627
356 Ga0070706_101461704
357 Ga0070706_102062775
358 Ga0070707_100009024
359 Ga0070707_100211227
360 Ga0070698_101456431
361 Ga0070699_100009134
362 Ga0070699_100031323
363 Ga0070699_100257772
364 Ga0070679_100107450
365 Ga0070684_100000515
366 Ga0070684_100132553
367 Ga0070684_100208216
368 Ga0070697_100031408
369 Ga0070697_100072836
370 Ga0068853_100732051
371 Ga0070672_101355788
372 Ga0070686_100150972
373 Ga0070695_100107651
374 Ga0070695_100132205
375 Ga0070693_100069489
376 Ga0070693_100843657
377 Ga0070665_100359853
378 Ga0070704_100278986
379 Ga0068855_100304452
380 Ga0070664_100001660
381 Ga0070664_100019448
382 Ga0070664_100779259
383 Ga0068857_100001489
384 Ga0068857_100926708
385 Ga0068854_101262378
386 Ga0068856_100015985
387 Ga0068856_100137950
388 Ga0068856_100875491
389 Ga0070702_100258461
390 Ga0068852_100004805
391 Ga0068859_100645871
392 Ga0068864_101494720
393 Ga0068866_10157660
394 Ga0068851_10008614
395 Ga0068863_100020580
396 Ga0068858_100006821
397 Ga0068860_100294276
398 Ga0068860_102082814
399 Ga0068862_100066571
400 Ga0070717_10003308
401 Ga0070716_100182211
402 Ga0070712_100057766
403 Ga0097621_100405401
404 Ga0068871_100511046
405 Ga0075433_10136409
406 Ga0075433_10343319
407 Ga0075433_10504594
408 Ga0075434_100009513
409 Ga0075434_100299802
410 Ga0075434_100514461
411 Ga0075434_101690497
412 Ga0097620_100645966
413 Ga0105245_10008699
414 Ga0114129_10013473
415 Ga0105248_10012491
416 Ga0105248_10025228
417 Ga0105238_10046188
418 Ga0105238_12156287
419 Ga0105249_10221886
420 Ga0105239_10109844
421 Ga0105246_10290801
422 Ga0157373_10006123
423 Ga0157373_10499347
424 Ga0157371_10417298
425 Ga0157374_10103215
426 Ga0157374_10106172
427 Ga0157372_10204063
428 Ga0157372_10555067
429 Ga0157375_10085018
430 Ga0157375_11925575
431 Ga0163163_10005247
432 Ga0157377_10263953
433 Ga0157376_10464387
434 Ga0163161_11744926
435 Ga0207697_10009946
436 Ga0207697_10116167
437 Ga0207656_10042769
438 Ga0207656_10518304
439 Ga0207682_10065235
440 Ga0207680_10037278
441 Ga0207647_10122724
442 Ga0207699_10006659
443 Ga0207643_10000795
444 Ga0207705_10071058
445 Ga0207684_10040083
446 Ga0207707_10097621
447 Ga0207695_10248669
448 Ga0207693_10002271
449 Ga0207663_10020193
450 Ga0207662_10002843
451 Ga0207657_10003847
452 Ga0207649_10000355
453 Ga0207649_11221340
454 Ga0207646_10079184
455 Ga0207646_10132420
456 Ga0207694_10000013
457 Ga0207650_10000406
458 Ga0207650_10014056
459 Ga0207650_10064667
460 Ga0207650_10085314
461 Ga0207687_10000845
462 Ga0207700_10002952
463 Ga0207664_10000227
464 Ga0207664_10089268
465 Ga0207690_10157822
466 Ga0207706_10048686
467 Ga0207706_10159204
468 Ga0207670_10002833
469 Ga0207670_10854848
470 Ga0207669_10327588
471 Ga0207665_10215981
472 Ga0207691_10000983
473 Ga0207711_10354497
474 Ga0207711_10364046
475 Ga0207689_10000442
476 Ga0207689_10511908
477 Ga0207661_10000913
478 Ga0207661_10048584
479 Ga0207661_10838949
480 Ga0207679_10000065
481 Ga0207679_10136661
482 Ga0207679_10296846
483 Ga0207667_10233175
484 Ga0207667_10299823
485 Ga0207651_10334693
486 Ga0207651_11714080
487 Ga0207668_10633321
488 Ga0207640_10191649
489 Ga0207640_10854877
490 Ga0207658_10239622
491 Ga0207677_10174503
492 Ga0207703_10000081
493 Ga0207639_10172357
494 Ga0207678_10006307
495 Ga0207678_10682343
496 Ga0207708_10254242
497 Ga0207702_10144519
498 Ga0207641_10001133
499 Ga0207648_10000946
500 Ga0207676_10001573
501 Ga0207676_10553663
502 Ga0207674_10000404
503 Ga0207674_10188359
504 Ga0207683_10519711
505 Ga0207683_10804982
506 Ga0268266_10056943
507 Ga0268266_10328565
508 Ga0268264_10753858
509 Ga0265338_10060436
510 Ga0265339_10013012
511 Ga0265331_10085643
512 Ga0265327_10100244
513 Ga0307508_10010693
514 Ga0265314_10058555
515 Ga0307416_100413271
516 Ga0373959_0000252
517 Ga0373926_0031115
518 Ga0373934_0000314
519 Ga0373944_0006502
520 Ga0373923_0041400
521 Ga0373945_0001525
522 Ga0373953_0000976
523 Ga0373953_0022609
524 Ga0373954_0007958
525 Ga0373954_0132136
526 Ga0373954_0149455
527 Ga0373956_0004048
528 Ga0373943_0000515
529 Ga0373955_0001966
530 Ga0373955_0193376
531 Ga0373955_0573595
532 Ga0373924_0110181
533 Ga0373935_0005036
534 Ga0373927_0000919
535 Ga0373927_0013284
536 Ga0373933_0214011
537 Ga0373947_0005235
538 Ga0373937_0000279
539 Ga0373937_0020762
540 Ga0373937_0065029
541 Ga0373937_1185808
542 Ga0373925_0000313
543 Ga0373925_0117167
544 Ga0395899_0097747
545 Ga0395898_0953593
546 Ga0395905_0030649
547 Ga0395901_0101226
548 Ga0439446_0070781
549 Ga0439434_0073219
550 Ga0451576_0618875
551 Ga0495592_0148231
552 Ga0495629_0085476
553 Ga0495651_0087817
554 Ga0495653_0076007
555 Ga0495580_0029046
556 Ga0495580_0166388
557 Ga0495580_0286464
558 Ga0495608_0477764
559 Ga0495628_0175148
560 Ga0495652_0179424
561 Ga0495665_0171367
562 Ga0495587_0268257
563 Ga0495645_0109267
564 Ga0495635_0132120
565 Ga0495599_0214166
566 Ga0495599_0538606
567 Ga0495623_0171888
568 Ga0495646_0095030
569 Ga0495647_0036653
570 Ga0495624_0058475
571 Ga0495674_0004675
572 Ga0495672_0013111
573 Ga0495672_0088910
574 Ga0495680_0074404
575 Ga0495684_0038631
576 Ga0495602_0185373
577 Ga0496101_0237505
578 Ga0496104_0004106
579 Ga0496104_1712787
580 Ga0496108_0000459
581 Ga0496108_0069008
582 Ga0496109_0000655
583 Ga0496109_0003511
584 Ga0496109_1724433
585 Ga0496110_0001127
586 Ga0496110_0012863
587 Ga0496110_1320424
588 Ga0496111_0006201
589 Ga0496111_0252751
590 Ga0496112_0036308
591 Ga0496112_0117262
592 Ga0496112_0330902
593 Ga0496113_0041529
594 Ga0496113_0841971
595 Ga0501031_0311956
596 Ga0501036_0364038
597 Ga0501038_0320480
598 Ga0501039_0117380
599 Ga0501068_0059261
600 Ga0501072_0048008
601 Ga0501072_0511833
602 Ga0501077_0068379
603 Ga0501081_0578859
604 Ga0501083_0004042
605 Ga0501035_0232244
606 nmdc:mga0n895_13149_c1
607 nmdc:mga0n895_1379930_c1
608 Ga0495619_0688174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3di5-assembly1.cif.gz_A crystal structure of a dinb-like protein (bce_4655) from bacillus cereus atcc 10987 at 2.01 a resolution 0.831 17 130
8fx9-assembly1.cif.gz_A-2 crystal strucutre of mycobacterium tuberculosis mycothiol-s-transferase enzyme 0.8015 7 128
2hkv-assembly1.cif.gz_A-2 crystal structure of a putative member of the dinb family (exig_1237) from exiguobacterium sibiricum 255-15 at 1.70 a resolution 0.7947 3 130
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7623 1 132
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7532 4 133
ID Description Score Start End Superfamily
af_O53728_4_171_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8183 7 129 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7695 4 130 1.20.120.450
af_O05777_10_164_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7477 7 126 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7286 13 126 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7103 4 130 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A317J738-F1-model_v4 DinB-like domain-containing protein 0.9954 11 159
AF-A0A2V9YUY0-F1-model_v4 DinB-like domain-containing protein 0.9948 10 159
AF-A0A1Q8BNA3-F1-model_v4 DinB-like domain-containing protein 0.9939 6 159
AF-A0A2V7V500-F1-model_v4 DinB-like domain-containing protein 0.9919 3 159
AF-A0A538T6B4-F1-model_v4 DinB family protein 0.9878 4 159

Map