F397142

General Info

Members Datasets Scaffolds Average Seq Length
303 168 606 694

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0002358|Ga0395899_0002358_9515_11806
Length 763
Sequence LVRLAALYILGSLLVAGAWLRLESGGIPWEKVALMIALGLLPTVAVTVGRRWSAAGIGVAALLAATAEAFAVPVTDARLGGEHDFFGPVLGSFKEGFLNFYDTNLPFRPDDFPLMHSVVLIAIFVFCAAMGVLLAADRPVAAAVALVFAVGWPATLVPGGRPLAVGVLALVGVLAVLFLFRAGARPTRGLLQGAAVAIVLVXXXSLASTSNAVAKGAFLSWQGWDPYDRPDEPVGVRYVWNSHYLGIQFPKKKTTVFRVRIPGPQRNLYWRATTLDDYTGSGWQEDLDLSEAAQREQLDVPGLNARARDQSNWVRQDITVEALRDNHLMASAQPVRWRPPSDAEVQDENGDIVVLPRALHQGQRFTVWSFVPRAKPSDLAKAGTDYPRSIDRYLQVIQGDGEVPAFGTPDREALMRGFFDATWKDDFLMQANKPLYDRARPIVRGAKTPYEATVALVTWFRRDGGFRYDQQPPPPGPNEPALAAFVTRTKRGYCQHYAGAMALMLRFLGVPARVAAGFTSGSYDADKHEWKVTDHEAHDWVEVYFPGWGWMPFDPTPGRGLLNAAYDPSSPAFDNRDTSFLRGTTNDTLGSILREAERSQGRPGLESVSGAGNTGSGSGGSTVVRDKGPSIVGLAFLVLAAAVVLVVGLKAVLRALRFAGRDPRALASACRKDLVGFLADQGHELPPSATLPEVARALDRFYAVDAKSFARWAAIARFARPDEAEDAVARARRELKRVRRDLRHQLSAISRFKGAISLRSLTV

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
83 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
84 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
85 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
86 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
87 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
97 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
106 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
112 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
128 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
129 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
130 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
131 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
132 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
133 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
134 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
135 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
154 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
155 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
166 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
167 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
168 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 12.54
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 5.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0002358 3300037312 Bacteria 15375
2 Ga0070683_100029576 3300005329 Bacteria 4961
3 Ga0070680_100031846 3300005336 Bacteria 4240
4 Ga0068868_100051385 3300005338 Unclassified 3242
5 Ga0070660_100053754 3300005339 Unclassified 3107
6 Ga0070661_100053606 3300005344 Bacteria 2953
7 Ga0070709_10003184 3300005434 Bacteria 8803
8 Ga0070709_10013230 3300005434 Bacteria 4632
9 Ga0070714_100015222 3300005435 Bacteria 6187
10 Ga0070714_100021822 3300005435 Bacteria 5242
11 Ga0070714_100041922 3300005435 Bacteria 3864
12 Ga0070713_100005933 3300005436 Bacteria 8398
13 Ga0070713_100019288 3300005436 Bacteria 5203
14 Ga0070713_100020617 3300005436 Bacteria 5057
15 Ga0070713_100033831 3300005436 Bacteria 4099
16 Ga0070710_10008830 3300005437 Bacteria 4915
17 Ga0070663_100044515 3300005455 Bacteria 3130
18 Ga0070681_10021802 3300005458 Bacteria 6423
19 Ga0070681_10061639 3300005458 Bacteria 3724
20 Ga0070681_10111171 3300005458 Bacteria 2679
21 Ga0070707_100018998 3300005468 Bacteria 6472
22 Ga0070698_100010868 3300005471 Bacteria 9685
23 Ga0070698_100025914 3300005471 Bacteria 6108
24 Ga0070698_100027034 3300005471 Bacteria 5967
25 Ga0070699_100082263 3300005518 Bacteria 2806
26 Ga0070684_100002170 3300005535 Bacteria 14480
27 Ga0070686_100040663 3300005544 Bacteria 2901
28 Ga0070695_100012956 3300005545 Bacteria 5006
29 Ga0070695_100036995 3300005545 Bacteria 3074
30 Ga0070696_100038424 3300005546 Bacteria 3303
31 Ga0070704_100012359 3300005549 Bacteria 5272
32 Ga0068855_100016388 3300005563 Bacteria 8909
33 Ga0068855_100036908 3300005563 Bacteria 5814
34 Ga0068857_100010450 3300005577 Bacteria 8069
35 Ga0068856_100006515 3300005614 Bacteria 11449
36 Ga0068861_100003224 3300005719 Bacteria 10792
37 Ga0068861_100083983 3300005719 Bacteria 2499
38 Ga0068858_100065919 3300005842 Bacteria 3351
39 Ga0081455_10004258 3300005937 Bacteria 16131
40 Ga0081455_10007410 3300005937 Bacteria 11557
41 Ga0081455_10008732 3300005937 Bacteria 10492
42 Ga0081455_10017206 3300005937 Bacteria 6939
43 Ga0081538_10000057 3300005981 Bacteria 102521
44 Ga0081538_10001522 3300005981 Bacteria 23789
45 Ga0081538_10014935 3300005981 Bacteria 6046
46 Ga0081538_10021533 3300005981 Bacteria 4701
47 Ga0081538_10026144 3300005981 Bacteria 4091
48 Ga0081540_1001396 3300005983 Bacteria 20924
49 Ga0081540_1011085 3300005983 Bacteria 6052
50 Ga0081540_1013265 3300005983 Bacteria 5368
51 Ga0081539_10005546 3300005985 Bacteria 12791
52 Ga0081539_10015440 3300005985 Bacteria 5549
53 Ga0070717_10016162 3300006028 Bacteria 5782
54 Ga0070717_10028303 3300006028 Bacteria 4484
55 Ga0070717_10038509 3300006028 Bacteria 3887
56 Ga0070716_100040150 3300006173 Bacteria 2602
57 Ga0070712_100005466 3300006175 Bacteria 7868
58 Ga0068871_100018185 3300006358 Bacteria 5337
59 Ga0075428_100000374 3300006844 Bacteria 44299
60 Ga0075428_100127625 3300006844 Unclassified 2767
61 Ga0075428_100157700 3300006844 Bacteria 2464
62 Ga0075433_10026150 3300006852 Bacteria 4938
63 Ga0075434_100006545 3300006871 Bacteria 10683
64 Ga0075434_100041379 3300006871 Bacteria 4566
65 Ga0075436_100020052 3300006914 Bacteria 4588
66 Ga0075436_100026414 3300006914 Bacteria 3998
67 Ga0075435_100005410 3300007076 Bacteria 8907
68 Ga0075435_100007426 3300007076 Bacteria 7807
69 Ga0111539_10003521 3300009094 Bacteria 20636
70 Ga0111539_10009951 3300009094 Bacteria 11990
71 Ga0105245_10012378 3300009098 Bacteria 7424
72 Ga0105245_10024631 3300009098 Bacteria 5286
73 Ga0105245_10045847 3300009098 Bacteria 3906
74 Ga0114129_10014549 3300009147 Bacteria 11213
75 Ga0114129_10054005 3300009147 Bacteria 5634
76 Ga0105241_10052450 3300009174 Bacteria 3114
77 Ga0105242_10097365 3300009176 Bacteria 2487
78 Ga0105249_10017488 3300009553 Bacteria 6366
79 Ga0157370_10022819 3300013104 Bacteria 6223
80 Ga0157369_10009528 3300013105 Bacteria 11104
81 Ga0163162_10090059 3300013306 Bacteria 3149
82 Ga0157372_10135790 3300013307 Bacteria 2832
83 Ga0182008_10003934 3300014497 Bacteria 8793
84 Ga0157377_10014843 3300014745 Unclassified 3973
85 Ga0157376_10004722 3300014969 Bacteria 9493
86 Ga0182007_10011868 3300015262 Bacteria 3372
87 Ga0163161_10015833 3300017792 Bacteria 5259
88 Ga0206356_10456611 3300020070 Bacteria 2639
89 Ga0207653_10011108 3300025885 Unclassified 2812
90 Ga0207685_10001983 3300025905 Bacteria 4543
91 Ga0207699_10041518 3300025906 Bacteria 2658
92 Ga0207643_10012009 3300025908 Bacteria 4677
93 Ga0207693_10000417 3300025915 Bacteria 38685
94 Ga0207693_10008441 3300025915 Bacteria 8429
95 Ga0207693_10010088 3300025915 Bacteria 7673
96 Ga0207693_10010248 3300025915 Bacteria 7609
97 Ga0207693_10015003 3300025915 Bacteria 6220
98 Ga0207663_10036596 3300025916 Bacteria 2954
99 Ga0207657_10010546 3300025919 Bacteria 9214
100 Ga0207657_10017685 3300025919 Bacteria 6829
101 Ga0207646_10051716 3300025922 Bacteria 3675
102 Ga0207700_10000006 3300025928 Bacteria 348187
103 Ga0207664_10003007 3300025929 Bacteria 11203
104 Ga0207664_10011573 3300025929 Bacteria 6281
105 Ga0207664_10057112 3300025929 Bacteria 3102
106 Ga0207664_10114280 3300025929 Bacteria 2249
107 Ga0207706_10006862 3300025933 Bacteria 10527
108 Ga0207706_10024807 3300025933 Bacteria 5374
109 Ga0207706_10046832 3300025933 Bacteria 3828
110 Ga0207665_10001319 3300025939 Bacteria 16733
111 Ga0207665_10004275 3300025939 Bacteria 9492
112 Ga0207665_10004558 3300025939 Bacteria 9195
113 Ga0207665_10010515 3300025939 Bacteria 6079
114 Ga0207689_10053837 3300025942 Bacteria 3315
115 Ga0207677_10010513 3300026023 Bacteria 5241
116 Ga0207677_10023274 3300026023 Bacteria 3823
117 Ga0207703_10046200 3300026035 Bacteria 3507
118 Ga0207678_10010343 3300026067 Bacteria 8189
119 Ga0207708_10016596 3300026075 Bacteria 5539
120 Ga0207708_10025060 3300026075 Bacteria 4511
121 Ga0207708_10081345 3300026075 Unclassified 2490
122 Ga0207648_10016194 3300026089 Bacteria 6823
123 Ga0207674_10004135 3300026116 Bacteria 17554
124 Ga0207675_100002156 3300026118 Bacteria 19554
125 Ga0207675_100011844 3300026118 Bacteria 8150
126 Ga0207683_10039149 3300026121 Bacteria 4135
127 Ga0207698_10092688 3300026142 Bacteria 2477
128 Ga0207428_10051499 3300027907 Unclassified 3291
129 Ga0307405_10022723 3300031731 Bacteria 3551
130 Ga0307413_10001651 3300031824 Bacteria 8655
131 Ga0307406_10003782 3300031901 Bacteria 8236
132 Ga0307412_10002177 3300031911 Bacteria 10877
133 Ga0307409_100002133 3300031995 Bacteria 10192
134 Ga0307409_100029860 3300031995 Bacteria 3908
135 Ga0307416_100002165 3300032002 Bacteria 11126
136 Ga0307416_100005708 3300032002 Bacteria 7696
137 Ga0307415_100013517 3300032126 Bacteria 4768
138 Ga0373949_0001938 3300035090 Bacteria 5578
139 Ga0373939_0003511 3300035114 Bacteria 3682
140 Ga0373943_0011501 3300035170 Bacteria 3983
141 Ga0373947_0029070 3300035725 Bacteria 3241
142 Ga0395899_0004794 3300037312 Bacteria 10539
143 Ga0395899_0009876 3300037312 Bacteria 7318
144 Ga0395899_0018013 3300037312 Bacteria 5374
145 Ga0395899_0030455 3300037312 Bacteria 4059
146 Ga0395899_0032146 3300037312 Bacteria 3942
147 Ga0395899_0064502 3300037312 Unclassified 2693
148 Ga0395900_0003631 3300037418 Bacteria 16591
149 Ga0395900_0006420 3300037418 Bacteria 12254
150 Ga0395900_0007753 3300037418 Bacteria 11072
151 Ga0395900_0012678 3300037418 Bacteria 8618
152 Ga0395900_0037304 3300037418 Bacteria 5012
153 Ga0395900_0048839 3300037418 Bacteria 4358
154 Ga0395900_0054115 3300037418 Bacteria 4132
155 Ga0395900_0134535 3300037418 Unclassified 2532
156 Ga0395898_0001851 3300037466 Bacteria 27144
157 Ga0395898_0004517 3300037466 Bacteria 15202
158 Ga0395898_0005363 3300037466 Bacteria 13852
159 Ga0395898_0007080 3300037466 Bacteria 11915
160 Ga0395898_0011341 3300037466 Bacteria 9261
161 Ga0395898_0014409 3300037466 Bacteria 8123
162 Ga0395905_0004039 3300037471 Bacteria 15402
163 Ga0395905_0011109 3300037471 Bacteria 8710
164 Ga0395901_0001425 3300038443 Bacteria 24931
165 Ga0395901_0005245 3300038443 Bacteria 13085
166 Ga0395901_0007447 3300038443 Bacteria 11045
167 Ga0395901_0019853 3300038443 Bacteria 6874
168 Ga0395901_0024740 3300038443 Bacteria 6165
169 Ga0395901_0041831 3300038443 Bacteria 4750
170 Ga0395901_0043161 3300038443 Bacteria 4678
171 Ga0395901_0082464 3300038443 Bacteria 3360
172 Ga0395901_0124701 3300038443 Bacteria 2706
173 Ga0439439_0002455 3300041406 Bacteria 3944
174 Ga0439448_0007575 3300042005 Bacteria 3151
175 Ga0450920_002547 3300042122 Bacteria 3110
176 Ga0466961_0001130 3300044693 Bacteria 16358
177 Ga0466963_0012009 3300044694 Bacteria 5290
178 Ga0466963_0060346 3300044694 Bacteria 2532
179 Ga0466964_0001028 3300044706 Bacteria 9291
180 Ga0466957_0005496 3300044842 Bacteria 7112
181 Ga0466957_0060047 3300044842 Bacteria 2331
182 Ga0466959_0000579 3300045049 Bacteria 21316
183 Ga0466959_0042974 3300045049 Bacteria 3333
184 Ga0451576_0009765 3300045051 Bacteria 11093
185 Ga0466958_0009304 3300045836 Bacteria 5473
186 Ga0466967_0004940 3300045976 Bacteria 9119
187 Ga0466967_0015502 3300045976 Bacteria 5975
188 Ga0466967_0019549 3300045976 Bacteria 5449
189 Ga0466967_0025016 3300045976 Bacteria 4916
190 Ga0466967_0030354 3300045976 Bacteria 4535
191 Ga0495603_0002966 3300046455 Bacteria 10037
192 Ga0495641_0005756 3300046461 Bacteria 8237
193 Ga0495641_0007685 3300046461 Bacteria 6690
194 Ga0495582_0015210 3300046473 Bacteria 4231
195 Ga0495639_0009477 3300046475 Bacteria 4176
196 Ga0495594_0036658 3300046499 Bacteria 2674
197 Ga0495608_0038080 3300046511 Bacteria 3232
198 Ga0495630_0007394 3300046517 Bacteria 7848
199 Ga0495640_0014354 3300046533 Bacteria 5998
200 Ga0495667_0045118 3300046559 Bacteria 2919
201 Ga0495588_0023512 3300046674 Bacteria 3052
202 Ga0495647_0009274 3300046681 Unclassified 3328
203 Ga0495613_0008070 3300046689 Bacteria 7828
204 Ga0495624_0015216 3300046690 Bacteria 5203
205 Ga0495671_0049780 3300046692 Bacteria 2088
206 Ga0495604_0027114 3300047317 Bacteria 4558
207 Ga0495674_0010972 3300047319 Bacteria 8560
208 Ga0495674_0036793 3300047319 Unclassified 4402
209 Ga0495680_0024955 3300047322 Bacteria 4951
210 Ga0496100_0024288 3300048903 Bacteria 3696
211 Ga0496101_0062188 3300048904 Bacteria 2714
212 Ga0496101_0078002 3300048904 Bacteria 2442
213 Ga0496102_0082950 3300048905 Bacteria 2957
214 Ga0496104_0001575 3300048907 Bacteria 19621
215 Ga0496104_0009467 3300048907 Bacteria 8667
216 Ga0496104_0016981 3300048907 Bacteria 6621
217 Ga0496105_0000705 3300048908 Bacteria 22625
218 Ga0496105_0001189 3300048908 Bacteria 18104
219 Ga0496106_0010212 3300048909 Bacteria 6938
220 Ga0496106_0021406 3300048909 Bacteria 4802
221 Ga0496107_0002732 3300048910 Bacteria 11587
222 Ga0496107_0038969 3300048910 Bacteria 3409
223 Ga0496107_0054765 3300048910 Bacteria 2880
224 Ga0496108_0006577 3300048911 Bacteria 9429
225 Ga0496108_0010896 3300048911 Bacteria 7380
226 Ga0496108_0029455 3300048911 Bacteria 4546
227 Ga0496109_0007519 3300048912 Bacteria 9229
228 Ga0496109_0078603 3300048912 Bacteria 3038
229 Ga0496109_0087038 3300048912 Bacteria 2885
230 Ga0496110_0000833 3300048913 Bacteria 21672
231 Ga0496110_0005683 3300048913 Bacteria 9793
232 Ga0496110_0032787 3300048913 Bacteria 4490
233 Ga0496111_0000238 3300048914 Bacteria 26361
234 Ga0496111_0000437 3300048914 Bacteria 21122
235 Ga0496111_0002075 3300048914 Bacteria 11944
236 Ga0496111_0016612 3300048914 Bacteria 5075
237 Ga0496111_0029268 3300048914 Unclassified 3911
238 Ga0496111_0049274 3300048914 Unclassified 3037
239 Ga0496112_0001299 3300048915 Bacteria 18983
240 Ga0496112_0001552 3300048915 Bacteria 17758
241 Ga0496112_0014630 3300048915 Bacteria 7291
242 Ga0496112_0030423 3300048915 Bacteria 5225
243 Ga0496113_0000174 3300048916 Bacteria 28582
244 Ga0496113_0001819 3300048916 Bacteria 12122
245 Ga0496113_0031544 3300048916 Bacteria 3846
246 Ga0496115_0005373 3300048918 Bacteria 9322
247 Ga0496115_0010212 3300048918 Bacteria 7005
248 Ga0501031_0002104 3300049568 Bacteria 12555
249 Ga0501031_0002166 3300049568 Bacteria 12396
250 Ga0501031_0010671 3300049568 Bacteria 5984
251 Ga0501033_0001810 3300049570 Bacteria 18675
252 Ga0501034_0070291 3300049571 Bacteria 3512
253 Ga0501036_0032247 3300049572 Bacteria 4426
254 Ga0501037_0010542 3300049573 Bacteria 6789
255 Ga0501038_0001738 3300049574 Bacteria 20249
256 Ga0501038_0034228 3300049574 Bacteria 4469
257 Ga0501038_0046089 3300049574 Bacteria 3781
258 Ga0501038_0053924 3300049574 Bacteria 3459
259 Ga0501039_0028199 3300049575 Bacteria 4320
260 Ga0501040_0002160 3300049576 Bacteria 12700
261 Ga0501040_0018718 3300049576 Bacteria 4599
262 Ga0501040_0055406 3300049576 Bacteria 2718
263 Ga0501042_0005142 3300049578 Bacteria 8397
264 Ga0501043_0003871 3300049579 Bacteria 12297
265 Ga0501048_0036146 3300049582 Bacteria 3551
266 Ga0501067_0003649 3300049583 Bacteria 8482
267 Ga0501068_0002625 3300049584 Bacteria 9515
268 Ga0501068_0009076 3300049584 Bacteria 5550
269 Ga0501068_0013383 3300049584 Bacteria 4667
270 Ga0501070_0010797 3300049586 Bacteria 7715
271 Ga0501071_0002739 3300049587 Bacteria 10807
272 Ga0501072_0013343 3300049588 Bacteria 6290
273 Ga0501072_0042855 3300049588 Bacteria 3555
274 Ga0501072_0073064 3300049588 Bacteria 2711
275 Ga0501072_0107084 3300049588 Unclassified 2223
276 Ga0501073_0009024 3300049589 Bacteria 7361
277 Ga0501074_0006380 3300049590 Bacteria 8515
278 Ga0501074_0037179 3300049590 Bacteria 3529
279 Ga0501075_0005898 3300049591 Bacteria 8379
280 Ga0501075_0016535 3300049591 Bacteria 5316
281 Ga0501076_0018749 3300049592 Bacteria 5281
282 Ga0501077_0000973 3300049593 Bacteria 17237
283 Ga0501077_0018563 3300049593 Bacteria 4398
284 Ga0501079_0016912 3300049741 Bacteria 5570
285 Ga0501079_0040189 3300049741 Bacteria 3608
286 Ga0501080_0069332 3300049742 Bacteria 3279
287 Ga0501044_0023145 3300049823 Bacteria 6612
288 Ga0501044_0047735 3300049823 Bacteria 4428
289 Ga0501045_0001798 3300049824 Bacteria 14481
290 nmdc:mga00v17_38829_c1 3300050491 Bacteria 2849
291 nmdc:mga05p37_10213_c1 3300050507 Bacteria 11149
292 nmdc:mga05p37_155420_c1 3300050507 Unclassified 2796
293 nmdc:mga0n895_106661_c1 3300050512 Unclassified 2814
294 nmdc:mga0n895_38763_c1 3300050512 Bacteria 4618
295 nmdc:mga08x19_21855_c1 3300050514 Bacteria 3955
296 nmdc:mga0a205_31665_c1 3300050515 Bacteria 5069
297 nmdc:mga0a205_4173_c1 3300050515 Bacteria 12947
298 Ga0495619_0011342 3300053085 Bacteria 5611
299 Ga0501084_0011448 3300054114 Bacteria 7346
300 Ga0501084_0016626 3300054114 Bacteria 6109
301 Ga0501084_0017787 3300054114 Bacteria 5915
302 Ga0501082_0024391 3300060353 Bacteria 5214
303 Ga0530510_0004573 3300061734 Bacteria 9571
304 Ga0395899_0002358
305 Ga0070683_100029576
306 Ga0070680_100031846
307 Ga0068868_100051385
308 Ga0070660_100053754
309 Ga0070661_100053606
310 Ga0070709_10003184
311 Ga0070709_10013230
312 Ga0070714_100015222
313 Ga0070714_100021822
314 Ga0070714_100041922
315 Ga0070713_100005933
316 Ga0070713_100019288
317 Ga0070713_100020617
318 Ga0070713_100033831
319 Ga0070710_10008830
320 Ga0070663_100044515
321 Ga0070681_10021802
322 Ga0070681_10061639
323 Ga0070681_10111171
324 Ga0070707_100018998
325 Ga0070698_100010868
326 Ga0070698_100025914
327 Ga0070698_100027034
328 Ga0070699_100082263
329 Ga0070684_100002170
330 Ga0070686_100040663
331 Ga0070695_100012956
332 Ga0070695_100036995
333 Ga0070696_100038424
334 Ga0070704_100012359
335 Ga0068855_100016388
336 Ga0068855_100036908
337 Ga0068857_100010450
338 Ga0068856_100006515
339 Ga0068861_100003224
340 Ga0068861_100083983
341 Ga0068858_100065919
342 Ga0081455_10004258
343 Ga0081455_10007410
344 Ga0081455_10008732
345 Ga0081455_10017206
346 Ga0081538_10000057
347 Ga0081538_10001522
348 Ga0081538_10014935
349 Ga0081538_10021533
350 Ga0081538_10026144
351 Ga0081540_1001396
352 Ga0081540_1011085
353 Ga0081540_1013265
354 Ga0081539_10005546
355 Ga0081539_10015440
356 Ga0070717_10016162
357 Ga0070717_10028303
358 Ga0070717_10038509
359 Ga0070716_100040150
360 Ga0070712_100005466
361 Ga0068871_100018185
362 Ga0075428_100000374
363 Ga0075428_100127625
364 Ga0075428_100157700
365 Ga0075433_10026150
366 Ga0075434_100006545
367 Ga0075434_100041379
368 Ga0075436_100020052
369 Ga0075436_100026414
370 Ga0075435_100005410
371 Ga0075435_100007426
372 Ga0111539_10003521
373 Ga0111539_10009951
374 Ga0105245_10012378
375 Ga0105245_10024631
376 Ga0105245_10045847
377 Ga0114129_10014549
378 Ga0114129_10054005
379 Ga0105241_10052450
380 Ga0105242_10097365
381 Ga0105249_10017488
382 Ga0157370_10022819
383 Ga0157369_10009528
384 Ga0163162_10090059
385 Ga0157372_10135790
386 Ga0182008_10003934
387 Ga0157377_10014843
388 Ga0157376_10004722
389 Ga0182007_10011868
390 Ga0163161_10015833
391 Ga0206356_10456611
392 Ga0207653_10011108
393 Ga0207685_10001983
394 Ga0207699_10041518
395 Ga0207643_10012009
396 Ga0207693_10000417
397 Ga0207693_10008441
398 Ga0207693_10010088
399 Ga0207693_10010248
400 Ga0207693_10015003
401 Ga0207663_10036596
402 Ga0207657_10010546
403 Ga0207657_10017685
404 Ga0207646_10051716
405 Ga0207700_10000006
406 Ga0207664_10003007
407 Ga0207664_10011573
408 Ga0207664_10057112
409 Ga0207664_10114280
410 Ga0207706_10006862
411 Ga0207706_10024807
412 Ga0207706_10046832
413 Ga0207665_10001319
414 Ga0207665_10004275
415 Ga0207665_10004558
416 Ga0207665_10010515
417 Ga0207689_10053837
418 Ga0207677_10010513
419 Ga0207677_10023274
420 Ga0207703_10046200
421 Ga0207678_10010343
422 Ga0207708_10016596
423 Ga0207708_10025060
424 Ga0207708_10081345
425 Ga0207648_10016194
426 Ga0207674_10004135
427 Ga0207675_100002156
428 Ga0207675_100011844
429 Ga0207683_10039149
430 Ga0207698_10092688
431 Ga0207428_10051499
432 Ga0307405_10022723
433 Ga0307413_10001651
434 Ga0307406_10003782
435 Ga0307412_10002177
436 Ga0307409_100002133
437 Ga0307409_100029860
438 Ga0307416_100002165
439 Ga0307416_100005708
440 Ga0307415_100013517
441 Ga0373949_0001938
442 Ga0373939_0003511
443 Ga0373943_0011501
444 Ga0373947_0029070
445 Ga0395899_0004794
446 Ga0395899_0009876
447 Ga0395899_0018013
448 Ga0395899_0030455
449 Ga0395899_0032146
450 Ga0395899_0064502
451 Ga0395900_0003631
452 Ga0395900_0006420
453 Ga0395900_0007753
454 Ga0395900_0012678
455 Ga0395900_0037304
456 Ga0395900_0048839
457 Ga0395900_0054115
458 Ga0395900_0134535
459 Ga0395898_0001851
460 Ga0395898_0004517
461 Ga0395898_0005363
462 Ga0395898_0007080
463 Ga0395898_0011341
464 Ga0395898_0014409
465 Ga0395905_0004039
466 Ga0395905_0011109
467 Ga0395901_0001425
468 Ga0395901_0005245
469 Ga0395901_0007447
470 Ga0395901_0019853
471 Ga0395901_0024740
472 Ga0395901_0041831
473 Ga0395901_0043161
474 Ga0395901_0082464
475 Ga0395901_0124701
476 Ga0439439_0002455
477 Ga0439448_0007575
478 Ga0450920_002547
479 Ga0466961_0001130
480 Ga0466963_0012009
481 Ga0466963_0060346
482 Ga0466964_0001028
483 Ga0466957_0005496
484 Ga0466957_0060047
485 Ga0466959_0000579
486 Ga0466959_0042974
487 Ga0451576_0009765
488 Ga0466958_0009304
489 Ga0466967_0004940
490 Ga0466967_0015502
491 Ga0466967_0019549
492 Ga0466967_0025016
493 Ga0466967_0030354
494 Ga0495603_0002966
495 Ga0495641_0005756
496 Ga0495641_0007685
497 Ga0495582_0015210
498 Ga0495639_0009477
499 Ga0495594_0036658
500 Ga0495608_0038080
501 Ga0495630_0007394
502 Ga0495640_0014354
503 Ga0495667_0045118
504 Ga0495588_0023512
505 Ga0495647_0009274
506 Ga0495613_0008070
507 Ga0495624_0015216
508 Ga0495671_0049780
509 Ga0495604_0027114
510 Ga0495674_0010972
511 Ga0495674_0036793
512 Ga0495680_0024955
513 Ga0496100_0024288
514 Ga0496101_0062188
515 Ga0496101_0078002
516 Ga0496102_0082950
517 Ga0496104_0001575
518 Ga0496104_0009467
519 Ga0496104_0016981
520 Ga0496105_0000705
521 Ga0496105_0001189
522 Ga0496106_0010212
523 Ga0496106_0021406
524 Ga0496107_0002732
525 Ga0496107_0038969
526 Ga0496107_0054765
527 Ga0496108_0006577
528 Ga0496108_0010896
529 Ga0496108_0029455
530 Ga0496109_0007519
531 Ga0496109_0078603
532 Ga0496109_0087038
533 Ga0496110_0000833
534 Ga0496110_0005683
535 Ga0496110_0032787
536 Ga0496111_0000238
537 Ga0496111_0000437
538 Ga0496111_0002075
539 Ga0496111_0016612
540 Ga0496111_0029268
541 Ga0496111_0049274
542 Ga0496112_0001299
543 Ga0496112_0001552
544 Ga0496112_0014630
545 Ga0496112_0030423
546 Ga0496113_0000174
547 Ga0496113_0001819
548 Ga0496113_0031544
549 Ga0496115_0005373
550 Ga0496115_0010212
551 Ga0501031_0002104
552 Ga0501031_0002166
553 Ga0501031_0010671
554 Ga0501033_0001810
555 Ga0501034_0070291
556 Ga0501036_0032247
557 Ga0501037_0010542
558 Ga0501038_0001738
559 Ga0501038_0034228
560 Ga0501038_0046089
561 Ga0501038_0053924
562 Ga0501039_0028199
563 Ga0501040_0002160
564 Ga0501040_0018718
565 Ga0501040_0055406
566 Ga0501042_0005142
567 Ga0501043_0003871
568 Ga0501048_0036146
569 Ga0501067_0003649
570 Ga0501068_0002625
571 Ga0501068_0009076
572 Ga0501068_0013383
573 Ga0501070_0010797
574 Ga0501071_0002739
575 Ga0501072_0013343
576 Ga0501072_0042855
577 Ga0501072_0073064
578 Ga0501072_0107084
579 Ga0501073_0009024
580 Ga0501074_0006380
581 Ga0501074_0037179
582 Ga0501075_0005898
583 Ga0501075_0016535
584 Ga0501076_0018749
585 Ga0501077_0000973
586 Ga0501077_0018563
587 Ga0501079_0016912
588 Ga0501079_0040189
589 Ga0501080_0069332
590 Ga0501044_0023145
591 Ga0501044_0047735
592 Ga0501045_0001798
593 nmdc:mga00v17_38829_c1
594 nmdc:mga05p37_10213_c1
595 nmdc:mga05p37_155420_c1
596 nmdc:mga0n895_106661_c1
597 nmdc:mga0n895_38763_c1
598 nmdc:mga08x19_21855_c1
599 nmdc:mga0a205_31665_c1
600 nmdc:mga0a205_4173_c1
601 Ga0495619_0011342
602 Ga0501084_0011448
603 Ga0501084_0016626
604 Ga0501084_0017787
605 Ga0501082_0024391
606 Ga0530510_0004573

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01841

Transglut_core

Transglutaminase-like superfamily

436

555

0.88

PF11992

TgpA_N

TgpA N-terminal domain

250

376

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6g49-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa 0.7878 238 545
6g4h-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa bound to ethylmercury 0.7109 234 545
6g49-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa 0.7009 238 545
6g4h-assembly1.cif.gz_A crystal structure of the periplasmic domain of tgpa from pseudomonas aeruginosa bound to ethylmercury 0.6837 234 545
1kv3-assembly3.cif.gz_E human tissue transglutaminase in gdp bound form 0.6744 443 547
ID Description Score Start End Superfamily
af_O53920_94_280_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.8108 426 546 3.10.620.30
af_Q54IX2_591_772_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7792 441 546 3.10.620.30
af_Q54IX2_1026_1205_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6952 415 546 3.10.620.30
af_Q556I6_323_487_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.6795 415 546 3.10.620.30
af_Q54U55_1_62_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.6158 10 61 3.30.160.60
ID Description Score Start End GO Terms
AF-A0A3D1ZB82-F1-model_v4 Transglutaminase-like domain-containing protein 0.9069 446 547
AF-A0A7C4KJP7-F1-model_v4 DUF4129 domain-containing protein 0.8589 252 548 GO:0016020
AF-A0A1Q7UUV3-F1-model_v4 Transglutaminase-like domain-containing protein 0.8403 286 547
AF-A0A3B9YEJ0-F1-model_v4 Transglutaminase-like domain-containing protein 0.8349 228 548
AF-A0A1Q7UUV3-F1-model_v4 Transglutaminase-like domain-containing protein 0.7504 286 547

Map