F396982

General Info

Members Datasets Scaffolds Average Seq Length
303 186 606 158

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10047873|Ga0114129_100478734
Length 179
Sequence MIASAQRLLVKEDSMRTRNVLVFVVSFVLATAVLAQGSGEAKAKSAPKAGASQPVFMPAGDLKWTDLDPKGAPGVKIADVWGNHAKGAWGAFIKFPAGFAAPLHTHTNAFKIVVLSGTFIQGPEGKPEVRLGPGSYLNQPGDGYRHTTSCDQASECLFFAQSNGKFDLKPVAGKAPAKK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
131 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
141 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
161 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
162 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
165 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
170 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.65
Nodule 0
Rhizoplane 0.66
Rhizosphere 97.69
Stem 0
Stem Tuber 0
Unclassified 39.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10047873 3300009147 Bacteria 6006
2 Ga0065712_10322734 3300005290 Unclassified 811
3 Ga0065715_10044903 3300005293 Bacteria 1299
4 Ga0065715_10912881 3300005293 Bacteria 571
5 Ga0070690_100676390 3300005330 Unclassified 790
6 Ga0070670_100006310 3300005331 Bacteria 10038
7 Ga0070670_100283171 3300005331 Bacteria 1448
8 Ga0070677_10158566 3300005333 Unclassified 1060
9 Ga0070677_10167097 3300005333 Unclassified 1037
10 Ga0070666_10112049 3300005335 Bacteria 1887
11 Ga0070666_10211809 3300005335 Bacteria 1365
12 Ga0068868_100386836 3300005338 Unclassified 1204
13 Ga0068868_101868653 3300005338 Unclassified 568
14 Ga0070689_101132884 3300005340 Unclassified 700
15 Ga0070691_10288334 3300005341 Unclassified 893
16 Ga0070687_100237868 3300005343 Bacteria 1124
17 Ga0070661_100386683 3300005344 Bacteria 1104
18 Ga0070692_10383368 3300005345 Unclassified 883
19 Ga0070668_100255948 3300005347 Bacteria 1454
20 Ga0070669_100176559 3300005353 Unclassified 1669
21 Ga0070669_100209590 3300005353 Bacteria 1537
22 Ga0070675_100031685 3300005354 Bacteria 4276
23 Ga0070675_100156224 3300005354 Bacteria 1958
24 Ga0070675_100464226 3300005354 Unclassified 1137
25 Ga0070671_100850663 3300005355 Unclassified 796
26 Ga0070674_100282144 3300005356 Bacteria 1317
27 Ga0070673_100460804 3300005364 Bacteria 1145
28 Ga0070673_100957621 3300005364 Unclassified 795
29 Ga0070688_100021814 3300005365 Bacteria 3745
30 Ga0070659_100574659 3300005366 Unclassified 967
31 Ga0070667_100088946 3300005367 Bacteria 2652
32 Ga0070667_101366783 3300005367 Unclassified 664
33 Ga0070701_10029257 3300005438 Unclassified 2715
34 Ga0070705_100019921 3300005440 Unclassified 3539
35 Ga0070700_100096156 3300005441 Unclassified 1943
36 Ga0070700_100673819 3300005441 Bacteria 819
37 Ga0070694_100098893 3300005444 Unclassified 2061
38 Ga0070708_100035733 3300005445 Bacteria 4330
39 Ga0070708_100105175 3300005445 Unclassified 2589
40 Ga0070678_100524242 3300005456 Bacteria 1049
41 Ga0070678_101066266 3300005456 Bacteria 745
42 Ga0070678_101508830 3300005456 Unclassified 629
43 Ga0070662_100118510 3300005457 Unclassified 2026
44 Ga0068867_100877325 3300005459 Bacteria 806
45 Ga0070685_10817448 3300005466 Unclassified 688
46 Ga0070706_100017136 3300005467 Bacteria 6694
47 Ga0070706_100019461 3300005467 Bacteria 6260
48 Ga0070706_100021040 3300005467 Bacteria 6005
49 Ga0070706_100033611 3300005467 Bacteria 4734
50 Ga0070706_100187016 3300005467 Bacteria 1935
51 Ga0070707_100028721 3300005468 Bacteria 5293
52 Ga0070707_100047552 3300005468 Bacteria 4107
53 Ga0070707_100107437 3300005468 Unclassified 2707
54 Ga0070707_100405202 3300005468 Bacteria 1324
55 Ga0070707_100450596 3300005468 Bacteria 1247
56 Ga0070707_100494167 3300005468 Bacteria 1185
57 Ga0070707_100575575 3300005468 Bacteria 1088
58 Ga0070698_100000807 3300005471 Bacteria 34196
59 Ga0070698_100772837 3300005471 Bacteria 904
60 Ga0070699_100021437 3300005518 Bacteria 5572
61 Ga0070699_100817745 3300005518 Bacteria 853
62 Ga0070697_100061532 3300005536 Bacteria 3062
63 Ga0070697_100079553 3300005536 Bacteria 2699
64 Ga0070697_100831151 3300005536 Bacteria 818
65 Ga0070697_100838877 3300005536 Bacteria 814
66 Ga0070672_100071650 3300005543 Unclassified 2757
67 Ga0070695_100223539 3300005545 Bacteria 1358
68 Ga0070696_100362099 3300005546 Unclassified 1126
69 Ga0070696_100516493 3300005546 Unclassified 952
70 Ga0070696_100690681 3300005546 Unclassified 831
71 Ga0070696_101260052 3300005546 Bacteria 626
72 Ga0070665_100080140 3300005548 Bacteria 3270
73 Ga0070665_100856626 3300005548 Unclassified 922
74 Ga0070664_100642655 3300005564 Unclassified 986
75 Ga0070702_100016832 3300005615 Bacteria 3760
76 Ga0068859_100408668 3300005617 Unclassified 1453
77 Ga0068859_100928267 3300005617 Bacteria 954
78 Ga0068864_100012756 3300005618 Bacteria 6947
79 Ga0068864_100555783 3300005618 Unclassified 1110
80 Ga0068866_10054917 3300005718 Unclassified 2043
81 Ga0068861_100141720 3300005719 Bacteria 1962
82 Ga0068861_100386464 3300005719 Bacteria 1238
83 Ga0068861_100760930 3300005719 Unclassified 906
84 Ga0068851_10735338 3300005834 Unclassified 609
85 Ga0068870_10109574 3300005840 Bacteria 1574
86 Ga0068863_100002065 3300005841 Bacteria 19913
87 Ga0068863_100027208 3300005841 Bacteria 5453
88 Ga0068858_100587539 3300005842 Unclassified 1080
89 Ga0068858_100636542 3300005842 Unclassified 1036
90 Ga0068858_101187547 3300005842 Bacteria 750
91 Ga0068860_100851120 3300005843 Unclassified 927
92 Ga0068860_101557231 3300005843 Unclassified 683
93 Ga0068862_100093389 3300005844 Bacteria 2624
94 Ga0068862_100325092 3300005844 Unclassified 1421
95 Ga0075368_10063331 3300006042 Bacteria 1483
96 Ga0075363_100308451 3300006048 Bacteria 919
97 Ga0075364_10021433 3300006051 Bacteria 4072
98 Ga0075367_10003117 3300006178 Bacteria 7798
99 Ga0075366_10345959 3300006195 Bacteria 912
100 Ga0097621_100499230 3300006237 Unclassified 1102
101 Ga0097621_101041435 3300006237 Unclassified 767
102 Ga0068871_100295865 3300006358 Unclassified 1420
103 Ga0075428_100201797 3300006844 Bacteria 2150
104 Ga0075430_100196521 3300006846 Bacteria 1676
105 Ga0075433_10012557 3300006852 Bacteria 6848
106 Ga0075433_10021576 3300006852 Bacteria 5402
107 Ga0075433_10423075 3300006852 Bacteria 1175
108 Ga0075433_10924937 3300006852 Unclassified 760
109 Ga0075434_100022689 3300006871 Bacteria 6112
110 Ga0075434_100027214 3300006871 Bacteria 5612
111 Ga0075434_100107153 3300006871 Bacteria 2805
112 Ga0075434_100151557 3300006871 Bacteria 2339
113 Ga0075429_100266588 3300006880 Bacteria 1500
114 Ga0068865_100602191 3300006881 Bacteria 929
115 Ga0075436_100176300 3300006914 Bacteria 1510
116 Ga0075436_100385324 3300006914 Bacteria 1014
117 Ga0075436_100709736 3300006914 Unclassified 745
118 Ga0097620_100408686 3300006931 Unclassified 1453
119 Ga0097620_100928145 3300006931 Bacteria 954
120 Ga0075435_100004747 3300007076 Bacteria 9384
121 Ga0075435_100020301 3300007076 Bacteria 5087
122 Ga0075435_100675303 3300007076 Unclassified 897
123 Ga0075435_101111333 3300007076 Unclassified 691
124 Ga0111539_10847895 3300009094 Bacteria 1063
125 Ga0114129_10000778 3300009147 Bacteria 40766
126 Ga0114129_10017196 3300009147 Bacteria 10301
127 Ga0114129_10022998 3300009147 Bacteria 8843
128 Ga0114129_10053329 3300009147 Bacteria 5672
129 Ga0114129_11074582 3300009147 Bacteria 1009
130 Ga0114129_12589035 3300009147 Unclassified 605
131 Ga0105243_10128632 3300009148 Unclassified 2146
132 Ga0105241_10199697 3300009174 Unclassified 1670
133 Ga0105242_10058285 3300009176 Bacteria 3165
134 Ga0105249_10140044 3300009553 Bacteria 2319
135 Ga0105249_10636988 3300009553 Unclassified 1123
136 Ga0157373_10222644 3300013100 Unclassified 1331
137 Ga0157374_11910384 3300013296 Bacteria 619
138 Ga0157378_10094514 3300013297 Unclassified 2722
139 Ga0163162_10549551 3300013306 Bacteria 1283
140 Ga0157375_10017187 3300013308 Bacteria 6521
141 Ga0157375_10513033 3300013308 Bacteria 1362
142 Ga0163163_10044771 3300014325 Bacteria 4342
143 Ga0163163_10144656 3300014325 Bacteria 2421
144 Ga0163163_10787670 3300014325 Bacteria 1014
145 Ga0157377_10350474 3300014745 Bacteria 990
146 Ga0157377_11121311 3300014745 Unclassified 604
147 Ga0157379_11057962 3300014968 Unclassified 776
148 Ga0163161_10244636 3300017792 Unclassified 1396
149 Ga0207697_10491293 3300025315 Unclassified 542
150 Ga0207656_10265506 3300025321 Unclassified 844
151 Ga0207642_10028193 3300025899 Unclassified 2309
152 Ga0207688_10093311 3300025901 Unclassified 1731
153 Ga0207688_10432660 3300025901 Bacteria 819
154 Ga0207680_10117980 3300025903 Bacteria 1731
155 Ga0207680_10181488 3300025903 Unclassified 1423
156 Ga0207645_10051823 3300025907 Unclassified 2623
157 Ga0207684_10016942 3300025910 Bacteria 6260
158 Ga0207684_10018898 3300025910 Bacteria 5894
159 Ga0207684_10044406 3300025910 Bacteria 3768
160 Ga0207684_10227433 3300025910 Bacteria 1609
161 Ga0207684_10309367 3300025910 Unclassified 1362
162 Ga0207707_11225168 3300025912 Unclassified 606
163 Ga0207662_10036389 3300025918 Unclassified 2877
164 Ga0207646_10024793 3300025922 Bacteria 5490
165 Ga0207646_10134789 3300025922 Unclassified 2223
166 Ga0207646_10304055 3300025922 Bacteria 1441
167 Ga0207646_10421097 3300025922 Archaea 1205
168 Ga0207646_10534881 3300025922 Bacteria 1054
169 Ga0207646_10859561 3300025922 Unclassified 806
170 Ga0207681_10810231 3300025923 Unclassified 782
171 Ga0207650_10195144 3300025925 Bacteria 1619
172 Ga0207687_10121793 3300025927 Unclassified 1952
173 Ga0207644_10939564 3300025931 Unclassified 725
174 Ga0207706_10059991 3300025933 Unclassified 3350
175 Ga0207706_10187024 3300025933 Unclassified 1818
176 Ga0207686_10534604 3300025934 Unclassified 914
177 Ga0207709_10064071 3300025935 Unclassified 2306
178 Ga0207669_10189375 3300025937 Viruses 1483
179 Ga0207669_10325041 3300025937 Bacteria 1179
180 Ga0207704_10338284 3300025938 Unclassified 1167
181 Ga0207704_11500460 3300025938 Unclassified 578
182 Ga0207691_10035355 3300025940 Bacteria 4638
183 Ga0207711_10210862 3300025941 Unclassified 1774
184 Ga0207689_10365674 3300025942 Unclassified 1200
185 Ga0207689_10881824 3300025942 Unclassified 755
186 Ga0207679_10757642 3300025945 Bacteria 883
187 Ga0207651_10037978 3300025960 Unclassified 3159
188 Ga0207668_10052605 3300025972 Unclassified 2818
189 Ga0207658_10238045 3300025986 Unclassified 1540
190 Ga0207658_11968754 3300025986 Unclassified 532
191 Ga0207703_10422046 3300026035 Unclassified 1241
192 Ga0207703_11088484 3300026035 Unclassified 768
193 Ga0207678_10604364 3300026067 Unclassified 962
194 Ga0207708_10100162 3300026075 Unclassified 2242
195 Ga0207708_10242832 3300026075 Bacteria 1449
196 Ga0207641_10014445 3300026088 Bacteria 6469
197 Ga0207641_10022400 3300026088 Bacteria 5201
198 Ga0207648_10019635 3300026089 Bacteria 6098
199 Ga0207676_10245201 3300026095 Bacteria 1610
200 Ga0207675_100036692 3300026118 Unclassified 4572
201 Ga0207675_100562592 3300026118 Unclassified 1140
202 Ga0207683_10004293 3300026121 Bacteria 12310
203 Ga0207683_10981642 3300026121 Unclassified 784
204 Ga0207698_10659156 3300026142 Bacteria 1037
205 Ga0268266_10164732 3300028379 Bacteria 2007
206 Ga0268265_10160186 3300028380 Bacteria 1910
207 Ga0268265_10235233 3300028380 Unclassified 1613
208 Ga0268264_10438878 3300028381 Bacteria 1262
209 Ga0265330_10063841 3300031235 Unclassified 1600
210 Ga0265328_10023822 3300031239 Bacteria 2319
211 Ga0265329_10019795 3300031242 Unclassified 2280
212 Ga0265340_10314931 3300031247 Unclassified 693
213 Ga0265339_10043626 3300031249 Bacteria 2479
214 Ga0265331_10047867 3300031250 Unclassified 2057
215 Ga0265316_10100966 3300031344 Unclassified 2193
216 Ga0307408_100247038 3300031548 Bacteria 1470
217 Ga0307408_100731588 3300031548 Bacteria 892
218 Ga0265342_10048658 3300031712 Bacteria 2541
219 Ga0373932_0232522 3300035112 Unclassified 667
220 Ga0373945_0010267 3300035116 Bacteria 3081
221 Ga0373956_0235010 3300035119 Bacteria 871
222 Ga0373943_0024096 3300035170 Unclassified 2836
223 Ga0373955_0229643 3300035172 Unclassified 1110
224 Ga0373935_0043168 3300035692 Unclassified 2837
225 Ga0373933_0023001 3300035724 Bacteria 3555
226 Ga0373947_0453680 3300035725 Bacteria 868
227 Ga0373937_0058333 3300036401 Bacteria 3546
228 Ga0373937_0064742 3300036401 Bacteria 3363
229 Ga0373937_0592663 3300036401 Viruses 1052
230 Ga0373925_0142582 3300037068 Bacteria 1876
231 Ga0373925_0443901 3300037068 Bacteria 1062
232 Ga0450908_001015 3300042184 Bacteria 5434
233 Ga0450918_006984 3300042531 Unclassified 2007
234 Ga0451577_1314285 3300042876 Unclassified 643
235 Ga0453683_0273619 3300044673 Unclassified 1078
236 Ga0451576_2356945 3300045051 Bacteria 545
237 Ga0495580_0001850 3300046472 Bacteria 18606
238 Ga0495580_0595308 3300046472 Unclassified 731
239 Ga0495580_0674105 3300046472 Bacteria 678
240 Ga0495582_0265454 3300046473 Bacteria 985
241 Ga0495639_0152064 3300046475 Bacteria 1117
242 Ga0495662_0032759 3300046476 Bacteria 2511
243 Ga0495585_0108356 3300046492 Bacteria 1480
244 Ga0495594_0156043 3300046499 Bacteria 1296
245 Ga0495618_0216303 3300046514 Bacteria 1210
246 Ga0495665_0481764 3300046531 Bacteria 626
247 Ga0495667_0340640 3300046559 Unclassified 948
248 Ga0495634_0445527 3300046642 Bacteria 765
249 Ga0495634_0555926 3300046642 Unclassified 669
250 Ga0495623_0270746 3300046679 Bacteria 948
251 Ga0495647_0006638 3300046681 Unclassified 3842
252 Ga0495658_0018494 3300046683 Unclassified 3624
253 Ga0495658_0073820 3300046683 Bacteria 1986
254 Ga0495604_0262928 3300047317 Viruses 1172
255 Ga0495674_0665025 3300047319 Unclassified 820
256 Ga0495679_121854 3300047446 Bacteria 712
257 Ga0495684_0055584 3300047471 Bacteria 3019
258 Ga0495684_0958870 3300047471 Unclassified 546
259 Ga0495614_0523753 3300048089 Bacteria 565
260 Ga0496105_1237580 3300048908 Unclassified 548
261 Ga0496114_1215438 3300048917 Bacteria 640
262 Ga0501031_0161886 3300049568 Bacteria 1463
263 Ga0501067_0075235 3300049583 Bacteria 1871
264 Ga0501071_0009187 3300049587 Bacteria 6573
265 Ga0501072_0160819 3300049588 Unclassified 1791
266 Ga0501074_0202798 3300049590 Bacteria 1413
267 Ga0501075_0120582 3300049591 Bacteria 1996
268 Ga0501077_0056323 3300049593 Unclassified 2495
269 Ga0501079_0184080 3300049741 Bacteria 1630
270 Ga0501081_0087916 3300049743 Bacteria 2183
271 Ga0501045_0014944 3300049824 Bacteria 5508
272 Ga0501045_1155166 3300049824 Unclassified 566
273 nmdc:mga05p37_1131607_c1 3300050507 Bacteria 816
274 nmdc:mga05p37_165569_c1 3300050507 Bacteria 2698
275 nmdc:mga05p37_1716438_c1 3300050507 Bacteria 611
276 nmdc:mga05p37_20140_c1 3300050507 Bacteria 8073
277 nmdc:mga05p37_21310_c1 3300050507 Bacteria 7846
278 nmdc:mga05p37_44579_c1 3300050507 Bacteria 4819
279 nmdc:mga05p37_561_c1 3300050507 Bacteria 40854
280 nmdc:mga09592_287302_c1 3300050508 Bacteria 1426
281 nmdc:mga0qj67_306363_c1 3300050509 Bacteria 1287
282 nmdc:mga0qj67_429177_c1 3300050509 Bacteria 1065
283 nmdc:mga06r32_199230_c1 3300050510 Bacteria 1990
284 nmdc:mga06r32_606121_c1 3300050510 Bacteria 1066
285 nmdc:mga08y16_1158565_c1 3300050511 Bacteria 745
286 nmdc:mga0n895_130005_c1 3300050512 Bacteria 2543
287 nmdc:mga0n895_255574_c1 3300050512 Bacteria 1778
288 nmdc:mga0n895_34534_c1 3300050512 Bacteria 4869
289 nmdc:mga0n895_6520_c1 3300050512 Bacteria 9928
290 nmdc:mga0rr50_1339284_c1 3300050513 Unclassified 607
291 nmdc:mga0rr50_22256_c1 3300050513 Bacteria 4347
292 nmdc:mga0rr50_94351_c1 3300050513 Bacteria 2336
293 nmdc:mga0rr50_9807_c1 3300050513 Bacteria 6046
294 nmdc:mga08x19_277886_c1 3300050514 Bacteria 1160
295 nmdc:mga08x19_594441_c1 3300050514 Unclassified 784
296 nmdc:mga08x19_759608_c1 3300050514 Unclassified 688
297 nmdc:mga0a205_123133_c1 3300050515 Bacteria 2493
298 nmdc:mga0a205_21698_c1 3300050515 Bacteria 6071
299 nmdc:mga0a205_260113_c1 3300050515 Bacteria 1613
300 nmdc:mga0a205_35354_c1 3300050515 Bacteria 4797
301 Ga0495595_0080377 3300053084 Bacteria 1552
302 Ga0495619_0749704 3300053085 Unclassified 662
303 Ga0501084_0182774 3300054114 Bacteria 1770
304 Ga0114129_10047873
305 Ga0065712_10322734
306 Ga0065715_10044903
307 Ga0065715_10912881
308 Ga0070690_100676390
309 Ga0070670_100006310
310 Ga0070670_100283171
311 Ga0070677_10158566
312 Ga0070677_10167097
313 Ga0070666_10112049
314 Ga0070666_10211809
315 Ga0068868_100386836
316 Ga0068868_101868653
317 Ga0070689_101132884
318 Ga0070691_10288334
319 Ga0070687_100237868
320 Ga0070661_100386683
321 Ga0070692_10383368
322 Ga0070668_100255948
323 Ga0070669_100176559
324 Ga0070669_100209590
325 Ga0070675_100031685
326 Ga0070675_100156224
327 Ga0070675_100464226
328 Ga0070671_100850663
329 Ga0070674_100282144
330 Ga0070673_100460804
331 Ga0070673_100957621
332 Ga0070688_100021814
333 Ga0070659_100574659
334 Ga0070667_100088946
335 Ga0070667_101366783
336 Ga0070701_10029257
337 Ga0070705_100019921
338 Ga0070700_100096156
339 Ga0070700_100673819
340 Ga0070694_100098893
341 Ga0070708_100035733
342 Ga0070708_100105175
343 Ga0070678_100524242
344 Ga0070678_101066266
345 Ga0070678_101508830
346 Ga0070662_100118510
347 Ga0068867_100877325
348 Ga0070685_10817448
349 Ga0070706_100017136
350 Ga0070706_100019461
351 Ga0070706_100021040
352 Ga0070706_100033611
353 Ga0070706_100187016
354 Ga0070707_100028721
355 Ga0070707_100047552
356 Ga0070707_100107437
357 Ga0070707_100405202
358 Ga0070707_100450596
359 Ga0070707_100494167
360 Ga0070707_100575575
361 Ga0070698_100000807
362 Ga0070698_100772837
363 Ga0070699_100021437
364 Ga0070699_100817745
365 Ga0070697_100061532
366 Ga0070697_100079553
367 Ga0070697_100831151
368 Ga0070697_100838877
369 Ga0070672_100071650
370 Ga0070695_100223539
371 Ga0070696_100362099
372 Ga0070696_100516493
373 Ga0070696_100690681
374 Ga0070696_101260052
375 Ga0070665_100080140
376 Ga0070665_100856626
377 Ga0070664_100642655
378 Ga0070702_100016832
379 Ga0068859_100408668
380 Ga0068859_100928267
381 Ga0068864_100012756
382 Ga0068864_100555783
383 Ga0068866_10054917
384 Ga0068861_100141720
385 Ga0068861_100386464
386 Ga0068861_100760930
387 Ga0068851_10735338
388 Ga0068870_10109574
389 Ga0068863_100002065
390 Ga0068863_100027208
391 Ga0068858_100587539
392 Ga0068858_100636542
393 Ga0068858_101187547
394 Ga0068860_100851120
395 Ga0068860_101557231
396 Ga0068862_100093389
397 Ga0068862_100325092
398 Ga0075368_10063331
399 Ga0075363_100308451
400 Ga0075364_10021433
401 Ga0075367_10003117
402 Ga0075366_10345959
403 Ga0097621_100499230
404 Ga0097621_101041435
405 Ga0068871_100295865
406 Ga0075428_100201797
407 Ga0075430_100196521
408 Ga0075433_10012557
409 Ga0075433_10021576
410 Ga0075433_10423075
411 Ga0075433_10924937
412 Ga0075434_100022689
413 Ga0075434_100027214
414 Ga0075434_100107153
415 Ga0075434_100151557
416 Ga0075429_100266588
417 Ga0068865_100602191
418 Ga0075436_100176300
419 Ga0075436_100385324
420 Ga0075436_100709736
421 Ga0097620_100408686
422 Ga0097620_100928145
423 Ga0075435_100004747
424 Ga0075435_100020301
425 Ga0075435_100675303
426 Ga0075435_101111333
427 Ga0111539_10847895
428 Ga0114129_10000778
429 Ga0114129_10017196
430 Ga0114129_10022998
431 Ga0114129_10053329
432 Ga0114129_11074582
433 Ga0114129_12589035
434 Ga0105243_10128632
435 Ga0105241_10199697
436 Ga0105242_10058285
437 Ga0105249_10140044
438 Ga0105249_10636988
439 Ga0157373_10222644
440 Ga0157374_11910384
441 Ga0157378_10094514
442 Ga0163162_10549551
443 Ga0157375_10017187
444 Ga0157375_10513033
445 Ga0163163_10044771
446 Ga0163163_10144656
447 Ga0163163_10787670
448 Ga0157377_10350474
449 Ga0157377_11121311
450 Ga0157379_11057962
451 Ga0163161_10244636
452 Ga0207697_10491293
453 Ga0207656_10265506
454 Ga0207642_10028193
455 Ga0207688_10093311
456 Ga0207688_10432660
457 Ga0207680_10117980
458 Ga0207680_10181488
459 Ga0207645_10051823
460 Ga0207684_10016942
461 Ga0207684_10018898
462 Ga0207684_10044406
463 Ga0207684_10227433
464 Ga0207684_10309367
465 Ga0207707_11225168
466 Ga0207662_10036389
467 Ga0207646_10024793
468 Ga0207646_10134789
469 Ga0207646_10304055
470 Ga0207646_10421097
471 Ga0207646_10534881
472 Ga0207646_10859561
473 Ga0207681_10810231
474 Ga0207650_10195144
475 Ga0207687_10121793
476 Ga0207644_10939564
477 Ga0207706_10059991
478 Ga0207706_10187024
479 Ga0207686_10534604
480 Ga0207709_10064071
481 Ga0207669_10189375
482 Ga0207669_10325041
483 Ga0207704_10338284
484 Ga0207704_11500460
485 Ga0207691_10035355
486 Ga0207711_10210862
487 Ga0207689_10365674
488 Ga0207689_10881824
489 Ga0207679_10757642
490 Ga0207651_10037978
491 Ga0207668_10052605
492 Ga0207658_10238045
493 Ga0207658_11968754
494 Ga0207703_10422046
495 Ga0207703_11088484
496 Ga0207678_10604364
497 Ga0207708_10100162
498 Ga0207708_10242832
499 Ga0207641_10014445
500 Ga0207641_10022400
501 Ga0207648_10019635
502 Ga0207676_10245201
503 Ga0207675_100036692
504 Ga0207675_100562592
505 Ga0207683_10004293
506 Ga0207683_10981642
507 Ga0207698_10659156
508 Ga0268266_10164732
509 Ga0268265_10160186
510 Ga0268265_10235233
511 Ga0268264_10438878
512 Ga0265330_10063841
513 Ga0265328_10023822
514 Ga0265329_10019795
515 Ga0265340_10314931
516 Ga0265339_10043626
517 Ga0265331_10047867
518 Ga0265316_10100966
519 Ga0307408_100247038
520 Ga0307408_100731588
521 Ga0265342_10048658
522 Ga0373932_0232522
523 Ga0373945_0010267
524 Ga0373956_0235010
525 Ga0373943_0024096
526 Ga0373955_0229643
527 Ga0373935_0043168
528 Ga0373933_0023001
529 Ga0373947_0453680
530 Ga0373937_0058333
531 Ga0373937_0064742
532 Ga0373937_0592663
533 Ga0373925_0142582
534 Ga0373925_0443901
535 Ga0450908_001015
536 Ga0450918_006984
537 Ga0451577_1314285
538 Ga0453683_0273619
539 Ga0451576_2356945
540 Ga0495580_0001850
541 Ga0495580_0595308
542 Ga0495580_0674105
543 Ga0495582_0265454
544 Ga0495639_0152064
545 Ga0495662_0032759
546 Ga0495585_0108356
547 Ga0495594_0156043
548 Ga0495618_0216303
549 Ga0495665_0481764
550 Ga0495667_0340640
551 Ga0495634_0445527
552 Ga0495634_0555926
553 Ga0495623_0270746
554 Ga0495647_0006638
555 Ga0495658_0018494
556 Ga0495658_0073820
557 Ga0495604_0262928
558 Ga0495674_0665025
559 Ga0495679_121854
560 Ga0495684_0055584
561 Ga0495684_0958870
562 Ga0495614_0523753
563 Ga0496105_1237580
564 Ga0496114_1215438
565 Ga0501031_0161886
566 Ga0501067_0075235
567 Ga0501071_0009187
568 Ga0501072_0160819
569 Ga0501074_0202798
570 Ga0501075_0120582
571 Ga0501077_0056323
572 Ga0501079_0184080
573 Ga0501081_0087916
574 Ga0501045_0014944
575 Ga0501045_1155166
576 nmdc:mga05p37_1131607_c1
577 nmdc:mga05p37_165569_c1
578 nmdc:mga05p37_1716438_c1
579 nmdc:mga05p37_20140_c1
580 nmdc:mga05p37_21310_c1
581 nmdc:mga05p37_44579_c1
582 nmdc:mga05p37_561_c1
583 nmdc:mga09592_287302_c1
584 nmdc:mga0qj67_306363_c1
585 nmdc:mga0qj67_429177_c1
586 nmdc:mga06r32_199230_c1
587 nmdc:mga06r32_606121_c1
588 nmdc:mga08y16_1158565_c1
589 nmdc:mga0n895_130005_c1
590 nmdc:mga0n895_255574_c1
591 nmdc:mga0n895_34534_c1
592 nmdc:mga0n895_6520_c1
593 nmdc:mga0rr50_1339284_c1
594 nmdc:mga0rr50_22256_c1
595 nmdc:mga0rr50_94351_c1
596 nmdc:mga0rr50_9807_c1
597 nmdc:mga08x19_277886_c1
598 nmdc:mga08x19_594441_c1
599 nmdc:mga08x19_759608_c1
600 nmdc:mga0a205_123133_c1
601 nmdc:mga0a205_21698_c1
602 nmdc:mga0a205_260113_c1
603 nmdc:mga0a205_35354_c1
604 Ga0495595_0080377
605 Ga0495619_0749704
606 Ga0501084_0182774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12973

Cupin_7

ChrR Cupin-like domain

52

164

0.86

PF14499

DUF4437

Domain of unknown function (DUF4437)

56

177

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.8775 73 149
1o5u-assembly2.cif.gz_B crystal structure of a duf861 family protein (tm1112) from thermotoga maritima at 1.83 a resolution 0.8738 78 146
7zvy-assembly1.cif.gz_G thermococcus kadokarensis phosphomannose isomerase 0.8567 73 151
8e8w-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 mononuclear fe(ii) structure on the hdo cofactor assembly pathway 0.8388 74 151
6vzy-assembly1.cif.gz_B crystal structure of sznf from streptomyces achromogenes var. streptozoticus nrrl 2697 with a diiron(ii) central domain cofactor 0.8325 72 151
ID Description Score Start End Superfamily
af_O48852_32_133_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8844 78 146 2.60.120.10
1o5uB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8738 78 146 2.60.120.10
af_Q05212_199_307_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8611 56 158 2.60.120.10
af_O94286_1_176_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8513 88 159 2.60.120.10
af_Q4CVG3_87_274_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8473 88 147 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8G3H1-F1-model_v4 Cupin 0.948 42 146
AF-A0A1Q4HS60-F1-model_v4 Cupin 0.946 61 155
AF-A0A2U2I4M1-F1-model_v4 Cupin domain-containing protein 0.9321 60 157
AF-A0A2V8G3H1-F1-model_v4 Cupin 0.9305 42 146
AF-A0A1J4SVS4-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9185 37 157

Map