F396866

General Info

Members Datasets Scaffolds Average Seq Length
303 147 606 291

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100062519|Ga0070714_1000625193
Length 301
Sequence VSAADLSLLRRPNDRLRRRRVVNRGMELLAWLAAALAVFFLGIVVWSVARKGASQLSLDLFTKSQPIGQFGTGSEKLGLANAFIGTLVIVGIATAIALPFGILIAIYVNEFAGKRIKNVVSLTLDVLAGVPAIVIGFFVYVLIVVGHGQSGYAAGFALSVLMLPLVSRSTIEVLALVPDSLREAALGVGAPRWRTTLGIVLPQTIGGVLTGATLAVARIAGETAPVLLVCSLVGQGNNWNPAQPLMTVPLAIFELSDQADAPEQALAWAGALVLILFILCTSLLARWLATRSRRKIAQADR

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
22 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
23 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
48 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
51 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
52 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
53 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
54 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
55 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
56 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
57 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
58 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
60 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
61 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
65 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
66 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
67 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
68 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
69 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
73 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
78 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
79 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
83 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
84 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
85 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
86 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
87 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
88 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
89 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
90 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
93 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
96 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
97 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
98 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
99 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
105 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
110 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
111 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
112 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
113 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
114 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
115 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
116 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
120 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
121 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
125 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
126 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
127 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
128 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
129 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
134 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
135 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
139 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
140 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
141 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.67
Metatranscriptomes 0.33
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 14.19
Rhizosphere 85.48
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100062519 3300005435 Bacteria 3200
2 Ga0070658_10147318 3300005327 Bacteria 1969
3 Ga0070680_100069093 3300005336 Bacteria 2900
4 Ga0070660_100016446 3300005339 Bacteria 5369
5 Ga0070691_10056961 3300005341 Bacteria 1874
6 Ga0070673_100340496 3300005364 Unclassified 1329
7 Ga0070659_100095611 3300005366 Bacteria 2386
8 Ga0070709_10008541 3300005434 Bacteria 5629
9 Ga0070709_10016593 3300005434 Bacteria 4207
10 Ga0070714_100033583 3300005435 Bacteria 4290
11 Ga0070714_100164578 3300005435 Bacteria 2009
12 Ga0070714_100254187 3300005435 Bacteria 1626
13 Ga0070714_100471261 3300005435 Unclassified 1195
14 Ga0070713_100033219 3300005436 Bacteria 4130
15 Ga0070713_100062388 3300005436 Bacteria 3122
16 Ga0070710_10017714 3300005437 Bacteria 3651
17 Ga0070710_10081653 3300005437 Bacteria 1888
18 Ga0070711_100026451 3300005439 Bacteria 3803
19 Ga0070711_100033790 3300005439 Bacteria 3407
20 Ga0070708_100367098 3300005445 Bacteria 1357
21 Ga0070681_10128615 3300005458 Bacteria 2465
22 Ga0070707_100003577 3300005468 Bacteria 14661
23 Ga0070707_100161087 3300005468 Bacteria 2186
24 Ga0070707_100320770 3300005468 Bacteria 1506
25 Ga0070698_100195772 3300005471 Bacteria 1958
26 Ga0070699_100559872 3300005518 Bacteria 1041
27 Ga0070684_100140026 3300005535 Bacteria 2187
28 Ga0070684_100393205 3300005535 Unclassified 1278
29 Ga0070695_100000670 3300005545 Bacteria 18279
30 Ga0070693_100081909 3300005547 Bacteria 1926
31 Ga0070693_100101152 3300005547 Bacteria 1756
32 Ga0068852_100089264 3300005616 Bacteria 2754
33 Ga0070717_10018633 3300006028 Bacteria 5427
34 Ga0070717_10031485 3300006028 Bacteria 4268
35 Ga0070717_10032568 3300006028 Bacteria 4201
36 Ga0070717_10144548 3300006028 Bacteria 2054
37 Ga0070717_10179684 3300006028 Bacteria 1844
38 Ga0070712_100021245 3300006175 Bacteria 4260
39 Ga0070712_100046883 3300006175 Bacteria 2989
40 Ga0070712_100253580 3300006175 Bacteria 1407
41 Ga0097621_100399606 3300006237 Bacteria 1230
42 Ga0075433_10001302 3300006852 Bacteria 18258
43 Ga0075434_100000978 3300006871 Bacteria 23072
44 Ga0075434_100015963 3300006871 Bacteria 7215
45 Ga0105240_10085718 3300009093 Bacteria 3859
46 Ga0105248_10035147 3300009177 Bacteria 5606
47 Ga0105237_10020096 3300009545 Bacteria 6894
48 Ga0157369_10036209 3300013105 Bacteria 5408
49 Ga0157374_10023216 3300013296 Bacteria 5544
50 Ga0157372_10086399 3300013307 Bacteria 3558
51 Ga0157372_10097837 3300013307 Bacteria 3347
52 Ga0206356_11907936 3300020070 Bacteria 2548
53 Ga0207692_10004963 3300025898 Bacteria 5295
54 Ga0207695_10015652 3300025913 Bacteria 8921
55 Ga0207671_10018650 3300025914 Bacteria 5317
56 Ga0207693_10000745 3300025915 Bacteria 29290
57 Ga0207693_10031085 3300025915 Bacteria 4218
58 Ga0207693_10044381 3300025915 Bacteria 3494
59 Ga0207693_10151420 3300025915 Bacteria 1825
60 Ga0207693_10203701 3300025915 Bacteria 1556
61 Ga0207663_10071202 3300025916 Unclassified 2243
62 Ga0207663_10086613 3300025916 Bacteria 2066
63 Ga0207657_10002003 3300025919 Bacteria 22017
64 Ga0207646_10000785 3300025922 Bacteria 41163
65 Ga0207646_10102116 3300025922 Bacteria 2571
66 Ga0207646_10165616 3300025922 Bacteria 1995
67 Ga0207700_10002676 3300025928 Bacteria 10263
68 Ga0207700_10020744 3300025928 Bacteria 4471
69 Ga0207664_10008805 3300025929 Bacteria 7059
70 Ga0207664_10020662 3300025929 Bacteria 4885
71 Ga0207664_10079986 3300025929 Bacteria 2655
72 Ga0207690_10022591 3300025932 Bacteria 3915
73 Ga0207665_10001126 3300025939 Bacteria 17976
74 Ga0207665_10147527 3300025939 Bacteria 1682
75 Ga0207679_10397810 3300025945 Unclassified 1211
76 Ga0207702_10482739 3300026078 Bacteria 1206
77 Ga0207698_10143419 3300026142 Bacteria 2061
78 Ga0207428_10154522 3300027907 Bacteria 1745
79 Ga0265334_10002583 3300028573 Bacteria 8448
80 Ga0265338_10017139 3300028800 Bacteria 7828
81 Ga0265324_10007617 3300029957 Bacteria 4368
82 Ga0373926_0034846 3300035083 Bacteria 1783
83 Ga0373944_0063387 3300035089 Bacteria 1190
84 Ga0373936_0065338 3300035113 Bacteria 1492
85 Ga0373954_0119647 3300035118 Bacteria 1278
86 Ga0373943_0000858 3300035170 Bacteria 13395
87 Ga0373946_0014987 3300035171 Bacteria 2932
88 Ga0373931_0046147 3300035691 Bacteria 2303
89 Ga0373935_0016200 3300035692 Bacteria 4511
90 Ga0373927_0050237 3300035695 Bacteria 2696
91 Ga0373947_0000941 3300035725 Bacteria 17705
92 Ga0373937_0002033 3300036401 Bacteria 16891
93 Ga0373925_0000874 3300037068 Bacteria 27529
94 Ga0395898_0278968 3300037466 Bacteria 1594
95 Ga0466965_0058097 3300044683 Bacteria 1929
96 Ga0466965_0080594 3300044683 Bacteria 1645
97 Ga0466965_0087432 3300044683 Bacteria 1582
98 Ga0466966_0104254 3300044684 Bacteria 1752
99 Ga0466961_0144671 3300044693 Bacteria 1487
100 Ga0466963_0000046 3300044694 Bacteria 40452
101 Ga0466963_0000702 3300044694 Bacteria 16334
102 Ga0466963_0001313 3300044694 Bacteria 13223
103 Ga0466963_0013911 3300044694 Bacteria 4954
104 Ga0466963_0029066 3300044694 Bacteria 3554
105 Ga0466963_0095265 3300044694 Bacteria 2031
106 Ga0466963_0148590 3300044694 Bacteria 1627
107 Ga0466964_0012167 3300044706 Bacteria 3254
108 Ga0466964_0013857 3300044706 Bacteria 3061
109 Ga0466964_0081805 3300044706 Bacteria 1387
110 Ga0466971_0001381 3300044719 Bacteria 10181
111 Ga0466968_0011953 3300044735 Bacteria 3390
112 Ga0466968_0012071 3300044735 Bacteria 3374
113 Ga0466968_0022946 3300044735 Bacteria 2539
114 Ga0466968_0031486 3300044735 Bacteria 2201
115 Ga0466957_0001599 3300044842 Bacteria 11892
116 Ga0466957_0011273 3300044842 Bacteria 5150
117 Ga0466957_0083854 3300044842 Bacteria 1989
118 Ga0466960_0015096 3300044901 Bacteria 3325
119 Ga0466959_0002913 3300045049 Bacteria 11034
120 Ga0466958_0001038 3300045836 Bacteria 12693
121 Ga0466958_0003313 3300045836 Bacteria 8340
122 Ga0466967_0000681 3300045976 Bacteria 17225
123 Ga0466967_0001292 3300045976 Bacteria 14262
124 Ga0466967_0004206 3300045976 Bacteria 9648
125 Ga0466967_0006328 3300045976 Bacteria 8360
126 Ga0466967_0020551 3300045976 Bacteria 5341
127 Ga0466967_0064832 3300045976 Bacteria 3250
128 Ga0466967_0084961 3300045976 Bacteria 2864
129 Ga0466967_0109601 3300045976 Bacteria 2535
130 Ga0466967_0182649 3300045976 Bacteria 1979
131 Ga0466967_0183764 3300045976 Bacteria 1973
132 Ga0466967_0739845 3300045976 Bacteria 975
133 Ga0495592_0000378 3300046454 Bacteria 35133
134 Ga0495592_0001903 3300046454 Bacteria 14720
135 Ga0495592_0082508 3300046454 Bacteria 2323
136 Ga0495592_0136235 3300046454 Bacteria 1712
137 Ga0495603_0010800 3300046455 Bacteria 5540
138 Ga0495629_0002124 3300046459 Bacteria 15362
139 Ga0495641_0000259 3300046461 Bacteria 41682
140 Ga0495641_0015306 3300046461 Bacteria 4103
141 Ga0495651_0000004 3300046462 Bacteria 177080
142 Ga0495651_0081508 3300046462 Bacteria 2442
143 Ga0495651_0094786 3300046462 Bacteria 2233
144 Ga0495651_0104091 3300046462 Bacteria 2108
145 Ga0495653_0001654 3300046463 Bacteria 17517
146 Ga0495653_0008346 3300046463 Bacteria 8489
147 Ga0495653_0113944 3300046463 Bacteria 1938
148 Ga0495653_0134066 3300046463 Bacteria 1749
149 Ga0495580_0003916 3300046472 Bacteria 12562
150 Ga0495582_0000869 3300046473 Bacteria 16760
151 Ga0495582_0045153 3300046473 Bacteria 2427
152 Ga0495582_0313413 3300046473 Bacteria 902
153 Ga0495639_0000656 3300046475 Bacteria 15981
154 Ga0495662_0003190 3300046476 Bacteria 8282
155 Ga0495662_0030459 3300046476 Bacteria 2605
156 Ga0495664_0006093 3300046477 Bacteria 6656
157 Ga0495664_0025538 3300046477 Bacteria 3439
158 Ga0495585_0084291 3300046492 Bacteria 1719
159 Ga0495608_0000706 3300046511 Bacteria 23235
160 Ga0495608_0034687 3300046511 Bacteria 3406
161 Ga0495608_0083613 3300046511 Bacteria 2072
162 Ga0495608_0164206 3300046511 Bacteria 1411
163 Ga0495608_0266680 3300046511 Bacteria 1065
164 Ga0495618_0027543 3300046514 Bacteria 3537
165 Ga0495618_0028183 3300046514 Bacteria 3499
166 Ga0495618_0222132 3300046514 Unclassified 1191
167 Ga0495618_0252149 3300046514 Unclassified 1107
168 Ga0495628_0002866 3300046516 Bacteria 15457
169 Ga0495628_0005188 3300046516 Bacteria 11441
170 Ga0495628_0024615 3300046516 Bacteria 4925
171 Ga0495628_0238951 3300046516 Bacteria 1359
172 Ga0495630_0000638 3300046517 Bacteria 25397
173 Ga0495630_0013927 3300046517 Bacteria 5850
174 Ga0495644_0030815 3300046523 Bacteria 2025
175 Ga0495666_0000257 3300046526 Bacteria 22867
176 Ga0495652_0000047 3300046529 Bacteria 121525
177 Ga0495652_0020215 3300046529 Bacteria 5918
178 Ga0495652_0020666 3300046529 Bacteria 5852
179 Ga0495652_0041840 3300046529 Bacteria 3953
180 Ga0495652_0121921 3300046529 Bacteria 2077
181 Ga0495665_0000649 3300046531 Bacteria 17795
182 Ga0495640_0007862 3300046533 Bacteria 8384
183 Ga0495640_0034645 3300046533 Bacteria 3577
184 Ga0495640_0168413 3300046533 Bacteria 1400
185 Ga0495586_0002964 3300046535 Bacteria 9149
186 Ga0495587_0000103 3300046536 Bacteria 64471
187 Ga0495587_0012716 3300046536 Bacteria 5294
188 Ga0495645_0000028 3300046543 Bacteria 113461
189 Ga0495645_0060188 3300046543 Bacteria 2753
190 Ga0495645_0070884 3300046543 Bacteria 2514
191 Ga0495645_0334102 3300046543 Bacteria 980
192 Ga0495667_0078847 3300046559 Bacteria 2141
193 Ga0495667_0085709 3300046559 Bacteria 2044
194 Ga0495634_0005969 3300046642 Bacteria 9306
195 Ga0495635_0008004 3300046663 Bacteria 7384
196 Ga0495635_0041571 3300046663 Bacteria 3175
197 Ga0495657_0011691 3300046675 Bacteria 6549
198 Ga0495657_0094176 3300046675 Bacteria 1916
199 Ga0495599_0000073 3300046678 Bacteria 70685
200 Ga0495599_0182120 3300046678 Unclassified 1294
201 Ga0495623_0000105 3300046679 Bacteria 51809
202 Ga0495623_0024181 3300046679 Bacteria 3918
203 Ga0495646_0010140 3300046680 Bacteria 5990
204 Ga0495646_0038383 3300046680 Bacteria 2958
205 Ga0495647_0000055 3300046681 Bacteria 28891
206 Ga0495647_0006221 3300046681 Bacteria 3945
207 Ga0495647_0012495 3300046681 Bacteria 2926
208 Ga0495658_0001388 3300046683 Bacteria 12706
209 Ga0495613_0005841 3300046689 Bacteria 9208
210 Ga0495613_0014705 3300046689 Bacteria 5808
211 Ga0495624_0002736 3300046690 Bacteria 13257
212 Ga0495624_0038754 3300046690 Bacteria 3060
213 Ga0495600_0014931 3300046809 Bacteria 4903
214 Ga0495581_0003859 3300047315 Bacteria 8624
215 Ga0495581_0041719 3300047315 Bacteria 2656
216 Ga0495604_0000027 3300047317 Bacteria 143025
217 Ga0495604_0168841 3300047317 Bacteria 1540
218 Ga0495674_0005541 3300047319 Bacteria 12112
219 Ga0495674_0090938 3300047319 Bacteria 2607
220 Ga0495674_0141789 3300047319 Bacteria 2020
221 Ga0495674_0272095 3300047319 Bacteria 1389
222 Ga0495676_0003155 3300047321 Bacteria 14909
223 Ga0495676_0111152 3300047321 Bacteria 2010
224 Ga0495680_0002920 3300047322 Bacteria 17172
225 Ga0495680_0003487 3300047322 Bacteria 15443
226 Ga0495680_0272764 3300047322 Unclassified 1194
227 Ga0495680_0336757 3300047322 Bacteria 1053
228 Ga0495675_0002963 3300047444 Bacteria 10191
229 Ga0495684_0015568 3300047471 Bacteria 5854
230 Ga0495684_0017875 3300047471 Bacteria 5462
231 Ga0495684_0259127 3300047471 Bacteria 1262
232 Ga0495593_0000267 3300047673 Bacteria 28295
233 Ga0495602_0000096 3300048088 Bacteria 82587
234 Ga0495602_0025708 3300048088 Bacteria 5692
235 Ga0495614_0000607 3300048089 Bacteria 15036
236 Ga0496100_0025929 3300048903 Bacteria 3588
237 Ga0496100_0041612 3300048903 Bacteria 2930
238 Ga0496101_0028092 3300048904 Bacteria 3924
239 Ga0496102_0035974 3300048905 Bacteria 4459
240 Ga0496102_0242604 3300048905 Bacteria 1699
241 Ga0496103_0023527 3300048906 Bacteria 3716
242 Ga0496103_0056812 3300048906 Bacteria 2430
243 Ga0496104_0029794 3300048907 Bacteria 5065
244 Ga0496104_0037737 3300048907 Bacteria 4517
245 Ga0496104_0091714 3300048907 Bacteria 2904
246 Ga0496104_0094603 3300048907 Bacteria 2858
247 Ga0496105_0012441 3300048908 Bacteria 6737
248 Ga0496105_0039192 3300048908 Bacteria 3904
249 Ga0496105_0052549 3300048908 Bacteria 3365
250 Ga0496105_0070601 3300048908 Bacteria 2887
251 Ga0496105_0122356 3300048908 Bacteria 2145
252 Ga0496105_0148020 3300048908 Bacteria 1931
253 Ga0496106_0011764 3300048909 Bacteria 6459
254 Ga0496106_0130804 3300048909 Bacteria 1968
255 Ga0496106_0173725 3300048909 Bacteria 1709
256 Ga0496106_0211843 3300048909 Bacteria 1544
257 Ga0496107_0060628 3300048910 Bacteria 2738
258 Ga0496108_0016309 3300048911 Bacteria 6059
259 Ga0496108_0025391 3300048911 Bacteria 4882
260 Ga0496108_0029050 3300048911 Bacteria 4576
261 Ga0496109_0024842 3300048912 Bacteria 5332
262 Ga0496109_0038166 3300048912 Bacteria 4341
263 Ga0496109_0117478 3300048912 Bacteria 2476
264 Ga0496109_0146644 3300048912 Bacteria 2208
265 Ga0496110_0076817 3300048913 Bacteria 2970
266 Ga0496111_0076244 3300048914 Bacteria 2444
267 Ga0496111_0154771 3300048914 Bacteria 1701
268 Ga0496112_0028782 3300048915 Bacteria 5366
269 Ga0496112_0071827 3300048915 Bacteria 3421
270 Ga0496112_0161642 3300048915 Bacteria 2206
271 Ga0496112_0164657 3300048915 Bacteria 2183
272 Ga0496112_0571136 3300048915 Bacteria 1064
273 Ga0496113_0017625 3300048916 Bacteria 4962
274 Ga0496113_0051170 3300048916 Bacteria 3082
275 Ga0496114_0032691 3300048917 Bacteria 4284
276 Ga0496114_0326026 3300048917 Bacteria 1357
277 Ga0496115_0005156 3300048918 Bacteria 9509
278 Ga0496115_0032127 3300048918 Bacteria 4140
279 Ga0501067_0120223 3300049583 Bacteria 1461
280 nmdc:mga0n895_45422_c1 3300050512 Bacteria 4287
281 nmdc:mga0rr50_11048_c1 3300050513 Bacteria 5758
282 nmdc:mga0a205_292_c1 3300050515 Bacteria 29895
283 Ga0495601_0006143 3300053077 Bacteria 7006
284 Ga0495601_0033655 3300053077 Bacteria 3193
285 Ga0495601_0062252 3300053077 Bacteria 2369
286 Ga0495601_0126812 3300053077 Bacteria 1660
287 Ga0495601_0165464 3300053077 Bacteria 1445
288 Ga0495601_0286702 3300053077 Bacteria 1073
289 Ga0495612_0002639 3300053078 Bacteria 7394
290 Ga0495612_0005480 3300053078 Bacteria 5245
291 Ga0495612_0059305 3300053078 Bacteria 1582
292 Ga0495595_0008566 3300053084 Bacteria 4204
293 Ga0495595_0012464 3300053084 Bacteria 3575
294 Ga0495595_0021840 3300053084 Bacteria 2801
295 Ga0495595_0073624 3300053084 Bacteria 1618
296 Ga0495619_0003601 3300053085 Bacteria 9980
297 Ga0495619_0006764 3300053085 Bacteria 7253
298 Ga0495619_0013067 3300053085 Bacteria 5232
299 Ga0495619_0036620 3300053085 Bacteria 3195
300 Ga0500566_0021242 3300053094 Bacteria 3818
301 Ga0466962_0005848 3300061719 Bacteria 5910
302 Ga0466962_0017354 3300061719 Bacteria 3465
303 Ga0466962_0103414 3300061719 Bacteria 1368
304 Ga0070714_100062519
305 Ga0070658_10147318
306 Ga0070680_100069093
307 Ga0070660_100016446
308 Ga0070691_10056961
309 Ga0070673_100340496
310 Ga0070659_100095611
311 Ga0070709_10008541
312 Ga0070709_10016593
313 Ga0070714_100033583
314 Ga0070714_100164578
315 Ga0070714_100254187
316 Ga0070714_100471261
317 Ga0070713_100033219
318 Ga0070713_100062388
319 Ga0070710_10017714
320 Ga0070710_10081653
321 Ga0070711_100026451
322 Ga0070711_100033790
323 Ga0070708_100367098
324 Ga0070681_10128615
325 Ga0070707_100003577
326 Ga0070707_100161087
327 Ga0070707_100320770
328 Ga0070698_100195772
329 Ga0070699_100559872
330 Ga0070684_100140026
331 Ga0070684_100393205
332 Ga0070695_100000670
333 Ga0070693_100081909
334 Ga0070693_100101152
335 Ga0068852_100089264
336 Ga0070717_10018633
337 Ga0070717_10031485
338 Ga0070717_10032568
339 Ga0070717_10144548
340 Ga0070717_10179684
341 Ga0070712_100021245
342 Ga0070712_100046883
343 Ga0070712_100253580
344 Ga0097621_100399606
345 Ga0075433_10001302
346 Ga0075434_100000978
347 Ga0075434_100015963
348 Ga0105240_10085718
349 Ga0105248_10035147
350 Ga0105237_10020096
351 Ga0157369_10036209
352 Ga0157374_10023216
353 Ga0157372_10086399
354 Ga0157372_10097837
355 Ga0206356_11907936
356 Ga0207692_10004963
357 Ga0207695_10015652
358 Ga0207671_10018650
359 Ga0207693_10000745
360 Ga0207693_10031085
361 Ga0207693_10044381
362 Ga0207693_10151420
363 Ga0207693_10203701
364 Ga0207663_10071202
365 Ga0207663_10086613
366 Ga0207657_10002003
367 Ga0207646_10000785
368 Ga0207646_10102116
369 Ga0207646_10165616
370 Ga0207700_10002676
371 Ga0207700_10020744
372 Ga0207664_10008805
373 Ga0207664_10020662
374 Ga0207664_10079986
375 Ga0207690_10022591
376 Ga0207665_10001126
377 Ga0207665_10147527
378 Ga0207679_10397810
379 Ga0207702_10482739
380 Ga0207698_10143419
381 Ga0207428_10154522
382 Ga0265334_10002583
383 Ga0265338_10017139
384 Ga0265324_10007617
385 Ga0373926_0034846
386 Ga0373944_0063387
387 Ga0373936_0065338
388 Ga0373954_0119647
389 Ga0373943_0000858
390 Ga0373946_0014987
391 Ga0373931_0046147
392 Ga0373935_0016200
393 Ga0373927_0050237
394 Ga0373947_0000941
395 Ga0373937_0002033
396 Ga0373925_0000874
397 Ga0395898_0278968
398 Ga0466965_0058097
399 Ga0466965_0080594
400 Ga0466965_0087432
401 Ga0466966_0104254
402 Ga0466961_0144671
403 Ga0466963_0000046
404 Ga0466963_0000702
405 Ga0466963_0001313
406 Ga0466963_0013911
407 Ga0466963_0029066
408 Ga0466963_0095265
409 Ga0466963_0148590
410 Ga0466964_0012167
411 Ga0466964_0013857
412 Ga0466964_0081805
413 Ga0466971_0001381
414 Ga0466968_0011953
415 Ga0466968_0012071
416 Ga0466968_0022946
417 Ga0466968_0031486
418 Ga0466957_0001599
419 Ga0466957_0011273
420 Ga0466957_0083854
421 Ga0466960_0015096
422 Ga0466959_0002913
423 Ga0466958_0001038
424 Ga0466958_0003313
425 Ga0466967_0000681
426 Ga0466967_0001292
427 Ga0466967_0004206
428 Ga0466967_0006328
429 Ga0466967_0020551
430 Ga0466967_0064832
431 Ga0466967_0084961
432 Ga0466967_0109601
433 Ga0466967_0182649
434 Ga0466967_0183764
435 Ga0466967_0739845
436 Ga0495592_0000378
437 Ga0495592_0001903
438 Ga0495592_0082508
439 Ga0495592_0136235
440 Ga0495603_0010800
441 Ga0495629_0002124
442 Ga0495641_0000259
443 Ga0495641_0015306
444 Ga0495651_0000004
445 Ga0495651_0081508
446 Ga0495651_0094786
447 Ga0495651_0104091
448 Ga0495653_0001654
449 Ga0495653_0008346
450 Ga0495653_0113944
451 Ga0495653_0134066
452 Ga0495580_0003916
453 Ga0495582_0000869
454 Ga0495582_0045153
455 Ga0495582_0313413
456 Ga0495639_0000656
457 Ga0495662_0003190
458 Ga0495662_0030459
459 Ga0495664_0006093
460 Ga0495664_0025538
461 Ga0495585_0084291
462 Ga0495608_0000706
463 Ga0495608_0034687
464 Ga0495608_0083613
465 Ga0495608_0164206
466 Ga0495608_0266680
467 Ga0495618_0027543
468 Ga0495618_0028183
469 Ga0495618_0222132
470 Ga0495618_0252149
471 Ga0495628_0002866
472 Ga0495628_0005188
473 Ga0495628_0024615
474 Ga0495628_0238951
475 Ga0495630_0000638
476 Ga0495630_0013927
477 Ga0495644_0030815
478 Ga0495666_0000257
479 Ga0495652_0000047
480 Ga0495652_0020215
481 Ga0495652_0020666
482 Ga0495652_0041840
483 Ga0495652_0121921
484 Ga0495665_0000649
485 Ga0495640_0007862
486 Ga0495640_0034645
487 Ga0495640_0168413
488 Ga0495586_0002964
489 Ga0495587_0000103
490 Ga0495587_0012716
491 Ga0495645_0000028
492 Ga0495645_0060188
493 Ga0495645_0070884
494 Ga0495645_0334102
495 Ga0495667_0078847
496 Ga0495667_0085709
497 Ga0495634_0005969
498 Ga0495635_0008004
499 Ga0495635_0041571
500 Ga0495657_0011691
501 Ga0495657_0094176
502 Ga0495599_0000073
503 Ga0495599_0182120
504 Ga0495623_0000105
505 Ga0495623_0024181
506 Ga0495646_0010140
507 Ga0495646_0038383
508 Ga0495647_0000055
509 Ga0495647_0006221
510 Ga0495647_0012495
511 Ga0495658_0001388
512 Ga0495613_0005841
513 Ga0495613_0014705
514 Ga0495624_0002736
515 Ga0495624_0038754
516 Ga0495600_0014931
517 Ga0495581_0003859
518 Ga0495581_0041719
519 Ga0495604_0000027
520 Ga0495604_0168841
521 Ga0495674_0005541
522 Ga0495674_0090938
523 Ga0495674_0141789
524 Ga0495674_0272095
525 Ga0495676_0003155
526 Ga0495676_0111152
527 Ga0495680_0002920
528 Ga0495680_0003487
529 Ga0495680_0272764
530 Ga0495680_0336757
531 Ga0495675_0002963
532 Ga0495684_0015568
533 Ga0495684_0017875
534 Ga0495684_0259127
535 Ga0495593_0000267
536 Ga0495602_0000096
537 Ga0495602_0025708
538 Ga0495614_0000607
539 Ga0496100_0025929
540 Ga0496100_0041612
541 Ga0496101_0028092
542 Ga0496102_0035974
543 Ga0496102_0242604
544 Ga0496103_0023527
545 Ga0496103_0056812
546 Ga0496104_0029794
547 Ga0496104_0037737
548 Ga0496104_0091714
549 Ga0496104_0094603
550 Ga0496105_0012441
551 Ga0496105_0039192
552 Ga0496105_0052549
553 Ga0496105_0070601
554 Ga0496105_0122356
555 Ga0496105_0148020
556 Ga0496106_0011764
557 Ga0496106_0130804
558 Ga0496106_0173725
559 Ga0496106_0211843
560 Ga0496107_0060628
561 Ga0496108_0016309
562 Ga0496108_0025391
563 Ga0496108_0029050
564 Ga0496109_0024842
565 Ga0496109_0038166
566 Ga0496109_0117478
567 Ga0496109_0146644
568 Ga0496110_0076817
569 Ga0496111_0076244
570 Ga0496111_0154771
571 Ga0496112_0028782
572 Ga0496112_0071827
573 Ga0496112_0161642
574 Ga0496112_0164657
575 Ga0496112_0571136
576 Ga0496113_0017625
577 Ga0496113_0051170
578 Ga0496114_0032691
579 Ga0496114_0326026
580 Ga0496115_0005156
581 Ga0496115_0032127
582 Ga0501067_0120223
583 nmdc:mga0n895_45422_c1
584 nmdc:mga0rr50_11048_c1
585 nmdc:mga0a205_292_c1
586 Ga0495601_0006143
587 Ga0495601_0033655
588 Ga0495601_0062252
589 Ga0495601_0126812
590 Ga0495601_0165464
591 Ga0495601_0286702
592 Ga0495612_0002639
593 Ga0495612_0005480
594 Ga0495612_0059305
595 Ga0495595_0008566
596 Ga0495595_0012464
597 Ga0495595_0021840
598 Ga0495595_0073624
599 Ga0495619_0003601
600 Ga0495619_0006764
601 Ga0495619_0013067
602 Ga0495619_0036620
603 Ga0500566_0021242
604 Ga0466962_0005848
605 Ga0466962_0017354
606 Ga0466962_0103414

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

97

294

0.87

Map