F396637

General Info

Members Datasets Scaffolds Average Seq Length
302 209 604 179

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0043751|Ga0466961_0043751_397_966
Length 189
Sequence MADVSVRPARPEDAAEIGRIQVDTWRTAYAEILPAAVLDALSADEAAAVWADAIAAPPSSRHHVLVAQEQQWRVGFVALGPAEDLEDDDPDRETTVALAPLLVEPRWGRRGHGSRLLAAAVDHARADGMTRAVIWIPEGDTPSREFLLSAGWAPDGLARALDTGAGELREIRLHTLLADDPESPQSASS

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
152 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
153 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
156 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
160 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
161 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
162 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
163 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
181 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
182 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 1.99
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.28
Rhizosphere 91.06
Stem 0
Stem Tuber 0
Unclassified 3.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0043751 3300044693 Bacteria 2867
2 JGI24743J22301_10050066 3300001991 Bacteria 850
3 JGI24749J21850_1018577 3300002076 Bacteria 981
4 rootH1_10145998 3300003323 Unclassified 3043
5 Ga0070683_100019015 3300005329 Bacteria 6095
6 Ga0070690_100551425 3300005330 Bacteria 869
7 Ga0068869_100027759 3300005334 Bacteria 3949
8 Ga0070666_10013589 3300005335 Bacteria 5169
9 Ga0070682_100305901 3300005337 Bacteria 1168
10 Ga0068868_100015586 3300005338 Bacteria 5626
11 Ga0070660_100016439 3300005339 Bacteria 5370
12 Ga0070689_100222010 3300005340 Bacteria 1550
13 Ga0070691_10109640 3300005341 Bacteria 1379
14 Ga0070687_100080680 3300005343 Bacteria 1774
15 Ga0070692_10011002 3300005345 Bacteria 4142
16 Ga0070668_100062814 3300005347 Bacteria 2878
17 Ga0070669_100021821 3300005353 Bacteria 4579
18 Ga0070671_100015920 3300005355 Bacteria 6077
19 Ga0070674_100039982 3300005356 Bacteria 3170
20 Ga0070673_100090269 3300005364 Bacteria 2503
21 Ga0070688_100076367 3300005365 Bacteria 2156
22 Ga0070659_100016788 3300005366 Bacteria 5500
23 Ga0070667_100161621 3300005367 Bacteria 1973
24 Ga0070703_10006287 3300005406 Bacteria 3327
25 Ga0070709_10139433 3300005434 Bacteria 1664
26 Ga0070714_100015899 3300005435 Bacteria 6065
27 Ga0070714_100254076 3300005435 Unclassified 1626
28 Ga0070714_101036024 3300005435 Bacteria 799
29 Ga0070713_100017841 3300005436 Bacteria 5382
30 Ga0070710_10064707 3300005437 Bacteria 2092
31 Ga0070701_10022455 3300005438 Bacteria 3026
32 Ga0070711_100007698 3300005439 Bacteria 6559
33 Ga0070705_100005120 3300005440 Bacteria 6368
34 Ga0070694_100007111 3300005444 Bacteria 6814
35 Ga0070663_100175284 3300005455 Bacteria 1660
36 Ga0070678_100014824 3300005456 Bacteria 4931
37 Ga0070662_100640158 3300005457 Bacteria 896
38 Ga0068867_100089433 3300005459 Bacteria 2335
39 Ga0070685_10053596 3300005466 Bacteria 2337
40 Ga0070697_100170438 3300005536 Bacteria 1842
41 Ga0068853_100146656 3300005539 Bacteria 2121
42 Ga0070672_100189787 3300005543 Bacteria 1715
43 Ga0070686_100164686 3300005544 Bacteria 1564
44 Ga0070695_100075176 3300005545 Bacteria 2221
45 Ga0070693_100006072 3300005547 Bacteria 5849
46 Ga0070665_100042045 3300005548 Bacteria 4593
47 Ga0070704_100025350 3300005549 Bacteria 3903
48 Ga0068855_100081144 3300005563 Bacteria 3760
49 Ga0068855_100102736 3300005563 Bacteria 3289
50 Ga0068855_101557040 3300005563 Unclassified 677
51 Ga0070664_100015889 3300005564 Bacteria 6163
52 Ga0068857_100370046 3300005577 Bacteria 1329
53 Ga0068854_100021853 3300005578 Bacteria 4349
54 Ga0068856_100009085 3300005614 Bacteria 9667
55 Ga0068856_100031251 3300005614 Bacteria 5209
56 Ga0068856_101729729 3300005614 Bacteria 637
57 Ga0070702_100006774 3300005615 Bacteria 5446
58 Ga0068852_100052836 3300005616 Bacteria 3495
59 Ga0068859_100003150 3300005617 Bacteria 16776
60 Ga0068859_100991890 3300005617 Bacteria 922
61 Ga0068864_100083738 3300005618 Bacteria 2801
62 Ga0068866_10036661 3300005718 Bacteria 2403
63 Ga0068861_100025815 3300005719 Bacteria 4266
64 Ga0068863_100012221 3300005841 Bacteria 8291
65 Ga0068858_100021153 3300005842 Bacteria 6076
66 Ga0068860_100041900 3300005843 Bacteria 4374
67 Ga0068862_100096242 3300005844 Bacteria 2584
68 Ga0070717_10015596 3300006028 Bacteria 5872
69 Ga0070717_10417799 3300006028 Bacteria 1206
70 Ga0070715_10322660 3300006163 Bacteria 834
71 Ga0070716_100003542 3300006173 Bacteria 7366
72 Ga0070712_100009308 3300006175 Bacteria 6189
73 Ga0097621_100063988 3300006237 Bacteria 3024
74 Ga0068871_100033370 3300006358 Bacteria 4076
75 Ga0075434_100143135 3300006871 Bacteria 2411
76 Ga0068865_100119396 3300006881 Bacteria 1958
77 Ga0097620_100003150 3300006931 Bacteria 16776
78 Ga0097620_100991747 3300006931 Bacteria 922
79 Ga0075435_100088284 3300007076 Bacteria 2555
80 Ga0105240_10136093 3300009093 Bacteria 2942
81 Ga0105240_10247252 3300009093 Bacteria 2064
82 Ga0105240_10384047 3300009093 Bacteria 1585
83 Ga0111539_10731668 3300009094 Bacteria 1152
84 Ga0105245_10064432 3300009098 Bacteria 3312
85 Ga0105245_10696972 3300009098 Bacteria 1048
86 Ga0105247_10009583 3300009101 Bacteria 5877
87 Ga0105247_10010459 3300009101 Bacteria 5610
88 Ga0105243_10006810 3300009148 Bacteria 8810
89 Ga0105241_10012774 3300009174 Bacteria 6162
90 Ga0105248_10037286 3300009177 Bacteria 5439
91 Ga0105237_10028876 3300009545 Bacteria 5644
92 Ga0105238_10018237 3300009551 Bacteria 7139
93 Ga0105249_10032705 3300009553 Bacteria 4706
94 Ga0105239_10078508 3300010375 Bacteria 3633
95 Ga0105239_10167644 3300010375 Bacteria 2456
96 Ga0105239_10896309 3300010375 Bacteria 1018
97 Ga0105246_10009262 3300011119 Bacteria 6065
98 Ga0157373_10268859 3300013100 Bacteria 1207
99 Ga0157371_10155728 3300013102 Bacteria 1630
100 Ga0157370_10023585 3300013104 Bacteria 6106
101 Ga0157369_10052653 3300013105 Bacteria 4403
102 Ga0157369_10416752 3300013105 Bacteria 1392
103 Ga0157369_10965090 3300013105 Bacteria 873
104 Ga0157374_10009104 3300013296 Bacteria 8509
105 Ga0157378_10009197 3300013297 Bacteria 8605
106 Ga0163162_10013930 3300013306 Bacteria 7855
107 Ga0157372_10036231 3300013307 Bacteria 5437
108 Ga0157372_10496555 3300013307 Bacteria 1423
109 Ga0157375_10026177 3300013308 Bacteria 5432
110 Ga0163163_10141448 3300014325 Bacteria 2449
111 Ga0157380_10009830 3300014326 Bacteria 6866
112 Ga0157379_10003350 3300014968 Bacteria 13580
113 Ga0157376_10357263 3300014969 Bacteria 1400
114 Ga0163161_10211667 3300017792 Bacteria 1498
115 Ga0197907_10471728 3300020069 Bacteria 899
116 Ga0206354_10022383 3300020081 Bacteria 1051
117 Ga0206354_11451236 3300020081 Bacteria 1932
118 Ga0206353_11061338 3300020082 Bacteria 6422
119 Ga0206353_11628104 3300020082 Bacteria 2131
120 Ga0206353_11634863 3300020082 Bacteria 910
121 Ga0207653_10040051 3300025885 Bacteria 1536
122 Ga0207692_10014117 3300025898 Bacteria 3483
123 Ga0207688_10003409 3300025901 Bacteria 8668
124 Ga0207699_10136029 3300025906 Bacteria 1609
125 Ga0207654_10020307 3300025911 Bacteria 3520
126 Ga0207654_10669877 3300025911 Bacteria 744
127 Ga0207707_10141058 3300025912 Bacteria 2107
128 Ga0207671_10230565 3300025914 Bacteria 1453
129 Ga0207693_10017006 3300025915 Bacteria 5807
130 Ga0207663_10021117 3300025916 Bacteria 3701
131 Ga0207662_10087819 3300025918 Bacteria 1908
132 Ga0207657_10045429 3300025919 Bacteria 3855
133 Ga0207649_10420950 3300025920 Bacteria 1003
134 Ga0207681_10042057 3300025923 Bacteria 3050
135 Ga0207694_10078484 3300025924 Bacteria 2588
136 Ga0207687_10075165 3300025927 Bacteria 2424
137 Ga0207687_10419473 3300025927 Bacteria 1104
138 Ga0207700_10109691 3300025928 Bacteria 2218
139 Ga0207664_10172025 3300025929 Bacteria 1854
140 Ga0207664_11311417 3300025929 Bacteria 644
141 Ga0207644_10040090 3300025931 Bacteria 3309
142 Ga0207690_10233150 3300025932 Bacteria 1414
143 Ga0207706_10019013 3300025933 Bacteria 6179
144 Ga0207709_10017399 3300025935 Bacteria 4013
145 Ga0207669_10107775 3300025937 Bacteria 1859
146 Ga0207665_10000659 3300025939 Bacteria 23268
147 Ga0207691_10534471 3300025940 Bacteria 995
148 Ga0207711_10249481 3300025941 Bacteria 1629
149 Ga0207689_10007845 3300025942 Bacteria 9331
150 Ga0207667_10006887 3300025949 Bacteria 13734
151 Ga0207667_10020227 3300025949 Bacteria 7407
152 Ga0207667_10067842 3300025949 Bacteria 3715
153 Ga0207667_10410877 3300025949 Bacteria 1378
154 Ga0207712_10241237 3300025961 Bacteria 1456
155 Ga0207668_10305473 3300025972 Bacteria 1314
156 Ga0207640_10022714 3300025981 Bacteria 3760
157 Ga0207658_10061636 3300025986 Bacteria 2804
158 Ga0207677_10010607 3300026023 Bacteria 5219
159 Ga0207703_10279533 3300026035 Bacteria 1515
160 Ga0207639_10019954 3300026041 Bacteria 4790
161 Ga0207678_10019986 3300026067 Bacteria 5886
162 Ga0207702_10109758 3300026078 Bacteria 2450
163 Ga0207702_10195505 3300026078 Bacteria 1872
164 Ga0207641_10041029 3300026088 Bacteria 3878
165 Ga0207648_10765532 3300026089 Bacteria 897
166 Ga0207676_10050109 3300026095 Bacteria 3253
167 Ga0207674_10805987 3300026116 Bacteria 906
168 Ga0207675_100012650 3300026118 Bacteria 7885
169 Ga0207683_10013958 3300026121 Bacteria 6850
170 Ga0207698_10026570 3300026142 Bacteria 4096
171 Ga0268265_10086531 3300028380 Bacteria 2491
172 Ga0268264_10091850 3300028381 Bacteria 2619
173 Ga0373948_0081497 3300034817 Bacteria 739
174 Ga0373928_0006873 3300035084 Bacteria 2192
175 Ga0373940_0025676 3300035088 Bacteria 1536
176 Ga0373932_0015809 3300035112 Bacteria 1918
177 Ga0373939_0013086 3300035114 Bacteria 2127
178 Ga0373941_0003818 3300035115 Bacteria 3449
179 Ga0373960_0127096 3300035121 Bacteria 851
180 Ga0373942_0052501 3300035207 Bacteria 1147
181 Ga0373931_0009873 3300035691 Bacteria 4573
182 Ga0466969_0030154 3300044656 Bacteria 2765
183 Ga0466972_0077079 3300044658 Bacteria 1588
184 Ga0466972_0144161 3300044658 Unclassified 1121
185 Ga0466972_0229222 3300044658 Bacteria 869
186 Ga0466966_0004614 3300044684 Bacteria 9076
187 Ga0466966_0019366 3300044684 Bacteria 4478
188 Ga0466966_0255379 3300044684 Bacteria 1056
189 Ga0466966_0475142 3300044684 Unclassified 752
190 Ga0466961_0011034 3300044693 Bacteria 5775
191 Ga0466961_0014817 3300044693 Bacteria 5009
192 Ga0466961_0022713 3300044693 Bacteria 4035
193 Ga0466961_0032856 3300044693 Bacteria 3334
194 Ga0466961_0139566 3300044693 Bacteria 1518
195 Ga0466961_0152097 3300044693 Bacteria 1445
196 Ga0466961_0358532 3300044693 Bacteria 887
197 Ga0466963_0002553 3300044694 Bacteria 10203
198 Ga0466963_0044438 3300044694 Bacteria 2924
199 Ga0466963_0075782 3300044694 Bacteria 2271
200 Ga0466963_0102962 3300044694 Unclassified 1956
201 Ga0466963_0182548 3300044694 Bacteria 1465
202 Ga0466963_0227931 3300044694 Bacteria 1305
203 Ga0466963_0238778 3300044694 Unclassified 1274
204 Ga0466963_0261343 3300044694 Bacteria 1215
205 Ga0466963_0437712 3300044694 Bacteria 922
206 Ga0466964_0009677 3300044706 Bacteria 3632
207 Ga0466964_0188114 3300044706 Bacteria 983
208 Ga0466971_0073348 3300044719 Bacteria 1555
209 Ga0466968_0129296 3300044735 Bacteria 1148
210 Ga0466970_0007018 3300044765 Bacteria 5638
211 Ga0466970_0026975 3300044765 Bacteria 3012
212 Ga0466970_0167526 3300044765 Bacteria 1217
213 Ga0466957_0037229 3300044842 Bacteria 2929
214 Ga0466957_0056377 3300044842 Bacteria 2403
215 Ga0466957_0079829 3300044842 Bacteria 2036
216 Ga0466957_0234184 3300044842 Bacteria 1217
217 Ga0466957_0465410 3300044842 Unclassified 873
218 Ga0466960_0014228 3300044901 Bacteria 3400
219 Ga0466960_0092348 3300044901 Bacteria 1545
220 Ga0466960_0794727 3300044901 Unclassified 572
221 Ga0466959_0010017 3300045049 Bacteria 6754
222 Ga0466959_0018760 3300045049 Bacteria 5081
223 Ga0466959_0049994 3300045049 Bacteria 3071
224 Ga0466959_0095923 3300045049 Bacteria 2127
225 Ga0466959_0164903 3300045049 Bacteria 1556
226 Ga0466959_0329247 3300045049 Bacteria 1043
227 Ga0466958_0003280 3300045836 Bacteria 8373
228 Ga0466958_0013834 3300045836 Bacteria 4601
229 Ga0466958_0017704 3300045836 Bacteria 4125
230 Ga0466958_0064597 3300045836 Bacteria 2233
231 Ga0466958_0086569 3300045836 Unclassified 1934
232 Ga0466967_0003489 3300045976 Bacteria 10273
233 Ga0466967_0004654 3300045976 Bacteria 9309
234 Ga0466967_0006470 3300045976 Bacteria 8295
235 Ga0466967_0073503 3300045976 Bacteria 3068
236 Ga0466967_0087353 3300045976 Bacteria 2827
237 Ga0466967_0092654 3300045976 Bacteria 2748
238 Ga0466967_0117033 3300045976 Bacteria 2456
239 Ga0466967_0133512 3300045976 Bacteria 2306
240 Ga0466967_0133735 3300045976 Bacteria 2305
241 Ga0466967_0334973 3300045976 Bacteria 1462
242 Ga0466967_0403636 3300045976 Bacteria 1330
243 Ga0466967_0487439 3300045976 Bacteria 1208
244 Ga0495653_0597064 3300046463 Bacteria 679
245 Ga0495623_0363980 3300046679 Unclassified 785
246 Ga0496100_0275521 3300048903 Bacteria 1252
247 Ga0496101_0042537 3300048904 Bacteria 3243
248 Ga0496101_0234697 3300048904 Bacteria 1426
249 Ga0496102_0000094 3300048905 Bacteria 125159
250 Ga0496102_0001365 3300048905 Bacteria 21868
251 Ga0496102_0037164 3300048905 Bacteria 4391
252 Ga0496103_0000042 3300048906 Bacteria 168701
253 Ga0496103_0071624 3300048906 Bacteria 2170
254 Ga0496104_0362137 3300048907 Bacteria 1362
255 Ga0496105_0013042 3300048908 Bacteria 6587
256 Ga0496105_0190924 3300048908 Bacteria 1675
257 Ga0496106_0026819 3300048909 Bacteria 4291
258 Ga0496107_0993018 3300048910 Unclassified 609
259 Ga0496108_0014186 3300048911 Bacteria 6500
260 Ga0496109_0011776 3300048912 Bacteria 7527
261 Ga0496109_0044824 3300048912 Bacteria 4013
262 Ga0496110_0009041 3300048913 Bacteria 8040
263 Ga0496110_0187523 3300048913 Bacteria 1878
264 Ga0496111_0138749 3300048914 Bacteria 1801
265 Ga0496111_0237305 3300048914 Bacteria 1354
266 Ga0496112_0013492 3300048915 Bacteria 7546
267 Ga0496113_0020052 3300048916 Bacteria 4692
268 Ga0496114_0020181 3300048917 Bacteria 5407
269 Ga0496115_0006941 3300048918 Bacteria 8323
270 Ga0496115_0370889 3300048918 Bacteria 1165
271 Ga0496118_0020918 3300048921 Bacteria 5783
272 Ga0501031_0050294 3300049568 Bacteria 2715
273 Ga0501032_0196431 3300049569 Bacteria 1317
274 Ga0501033_0064937 3300049570 Bacteria 2685
275 Ga0501034_0126737 3300049571 Bacteria 2538
276 Ga0501036_0082871 3300049572 Bacteria 2711
277 Ga0501037_0216037 3300049573 Bacteria 1350
278 Ga0501038_0029966 3300049574 Bacteria 4817
279 Ga0501039_0073188 3300049575 Bacteria 2663
280 Ga0501043_0018812 3300049579 Bacteria 5422
281 Ga0501046_0360765 3300049580 Bacteria 1054
282 Ga0501047_0003729 3300049581 Bacteria 14348
283 Ga0501047_0349582 3300049581 Bacteria 1315
284 Ga0501047_0475659 3300049581 Bacteria 1077
285 Ga0501048_0000571 3300049582 Bacteria 26167
286 Ga0501067_0072289 3300049583 Bacteria 1911
287 Ga0501070_0004427 3300049586 Bacteria 12065
288 Ga0501070_0210815 3300049586 Bacteria 1595
289 Ga0501070_0381548 3300049586 Bacteria 1142
290 Ga0501074_0670990 3300049590 Bacteria 732
291 Ga0501080_0801568 3300049742 Bacteria 826
292 Ga0501081_0164852 3300049743 Bacteria 1598
293 Ga0501035_0139070 3300049822 Bacteria 2112
294 Ga0501035_0579671 3300049822 Bacteria 916
295 Ga0501044_0073081 3300049823 Bacteria 3486
296 Ga0501044_0590602 3300049823 Bacteria 1004
297 nmdc:mga0n895_145082_c1 3300050512 Bacteria 2403
298 nmdc:mga0rr50_291893_c1 3300050513 Bacteria 1363
299 nmdc:mga08x19_136159_c1 3300050514 Bacteria 1656
300 Ga0501082_0587791 3300060353 Bacteria 974
301 Ga0466962_0218272 3300061719 Bacteria 934
302 Ga0466962_0339377 3300061719 Bacteria 747
303 Ga0466961_0043751
304 JGI24743J22301_10050066
305 JGI24749J21850_1018577
306 rootH1_10145998
307 Ga0070683_100019015
308 Ga0070690_100551425
309 Ga0068869_100027759
310 Ga0070666_10013589
311 Ga0070682_100305901
312 Ga0068868_100015586
313 Ga0070660_100016439
314 Ga0070689_100222010
315 Ga0070691_10109640
316 Ga0070687_100080680
317 Ga0070692_10011002
318 Ga0070668_100062814
319 Ga0070669_100021821
320 Ga0070671_100015920
321 Ga0070674_100039982
322 Ga0070673_100090269
323 Ga0070688_100076367
324 Ga0070659_100016788
325 Ga0070667_100161621
326 Ga0070703_10006287
327 Ga0070709_10139433
328 Ga0070714_100015899
329 Ga0070714_100254076
330 Ga0070714_101036024
331 Ga0070713_100017841
332 Ga0070710_10064707
333 Ga0070701_10022455
334 Ga0070711_100007698
335 Ga0070705_100005120
336 Ga0070694_100007111
337 Ga0070663_100175284
338 Ga0070678_100014824
339 Ga0070662_100640158
340 Ga0068867_100089433
341 Ga0070685_10053596
342 Ga0070697_100170438
343 Ga0068853_100146656
344 Ga0070672_100189787
345 Ga0070686_100164686
346 Ga0070695_100075176
347 Ga0070693_100006072
348 Ga0070665_100042045
349 Ga0070704_100025350
350 Ga0068855_100081144
351 Ga0068855_100102736
352 Ga0068855_101557040
353 Ga0070664_100015889
354 Ga0068857_100370046
355 Ga0068854_100021853
356 Ga0068856_100009085
357 Ga0068856_100031251
358 Ga0068856_101729729
359 Ga0070702_100006774
360 Ga0068852_100052836
361 Ga0068859_100003150
362 Ga0068859_100991890
363 Ga0068864_100083738
364 Ga0068866_10036661
365 Ga0068861_100025815
366 Ga0068863_100012221
367 Ga0068858_100021153
368 Ga0068860_100041900
369 Ga0068862_100096242
370 Ga0070717_10015596
371 Ga0070717_10417799
372 Ga0070715_10322660
373 Ga0070716_100003542
374 Ga0070712_100009308
375 Ga0097621_100063988
376 Ga0068871_100033370
377 Ga0075434_100143135
378 Ga0068865_100119396
379 Ga0097620_100003150
380 Ga0097620_100991747
381 Ga0075435_100088284
382 Ga0105240_10136093
383 Ga0105240_10247252
384 Ga0105240_10384047
385 Ga0111539_10731668
386 Ga0105245_10064432
387 Ga0105245_10696972
388 Ga0105247_10009583
389 Ga0105247_10010459
390 Ga0105243_10006810
391 Ga0105241_10012774
392 Ga0105248_10037286
393 Ga0105237_10028876
394 Ga0105238_10018237
395 Ga0105249_10032705
396 Ga0105239_10078508
397 Ga0105239_10167644
398 Ga0105239_10896309
399 Ga0105246_10009262
400 Ga0157373_10268859
401 Ga0157371_10155728
402 Ga0157370_10023585
403 Ga0157369_10052653
404 Ga0157369_10416752
405 Ga0157369_10965090
406 Ga0157374_10009104
407 Ga0157378_10009197
408 Ga0163162_10013930
409 Ga0157372_10036231
410 Ga0157372_10496555
411 Ga0157375_10026177
412 Ga0163163_10141448
413 Ga0157380_10009830
414 Ga0157379_10003350
415 Ga0157376_10357263
416 Ga0163161_10211667
417 Ga0197907_10471728
418 Ga0206354_10022383
419 Ga0206354_11451236
420 Ga0206353_11061338
421 Ga0206353_11628104
422 Ga0206353_11634863
423 Ga0207653_10040051
424 Ga0207692_10014117
425 Ga0207688_10003409
426 Ga0207699_10136029
427 Ga0207654_10020307
428 Ga0207654_10669877
429 Ga0207707_10141058
430 Ga0207671_10230565
431 Ga0207693_10017006
432 Ga0207663_10021117
433 Ga0207662_10087819
434 Ga0207657_10045429
435 Ga0207649_10420950
436 Ga0207681_10042057
437 Ga0207694_10078484
438 Ga0207687_10075165
439 Ga0207687_10419473
440 Ga0207700_10109691
441 Ga0207664_10172025
442 Ga0207664_11311417
443 Ga0207644_10040090
444 Ga0207690_10233150
445 Ga0207706_10019013
446 Ga0207709_10017399
447 Ga0207669_10107775
448 Ga0207665_10000659
449 Ga0207691_10534471
450 Ga0207711_10249481
451 Ga0207689_10007845
452 Ga0207667_10006887
453 Ga0207667_10020227
454 Ga0207667_10067842
455 Ga0207667_10410877
456 Ga0207712_10241237
457 Ga0207668_10305473
458 Ga0207640_10022714
459 Ga0207658_10061636
460 Ga0207677_10010607
461 Ga0207703_10279533
462 Ga0207639_10019954
463 Ga0207678_10019986
464 Ga0207702_10109758
465 Ga0207702_10195505
466 Ga0207641_10041029
467 Ga0207648_10765532
468 Ga0207676_10050109
469 Ga0207674_10805987
470 Ga0207675_100012650
471 Ga0207683_10013958
472 Ga0207698_10026570
473 Ga0268265_10086531
474 Ga0268264_10091850
475 Ga0373948_0081497
476 Ga0373928_0006873
477 Ga0373940_0025676
478 Ga0373932_0015809
479 Ga0373939_0013086
480 Ga0373941_0003818
481 Ga0373960_0127096
482 Ga0373942_0052501
483 Ga0373931_0009873
484 Ga0466969_0030154
485 Ga0466972_0077079
486 Ga0466972_0144161
487 Ga0466972_0229222
488 Ga0466966_0004614
489 Ga0466966_0019366
490 Ga0466966_0255379
491 Ga0466966_0475142
492 Ga0466961_0011034
493 Ga0466961_0014817
494 Ga0466961_0022713
495 Ga0466961_0032856
496 Ga0466961_0139566
497 Ga0466961_0152097
498 Ga0466961_0358532
499 Ga0466963_0002553
500 Ga0466963_0044438
501 Ga0466963_0075782
502 Ga0466963_0102962
503 Ga0466963_0182548
504 Ga0466963_0227931
505 Ga0466963_0238778
506 Ga0466963_0261343
507 Ga0466963_0437712
508 Ga0466964_0009677
509 Ga0466964_0188114
510 Ga0466971_0073348
511 Ga0466968_0129296
512 Ga0466970_0007018
513 Ga0466970_0026975
514 Ga0466970_0167526
515 Ga0466957_0037229
516 Ga0466957_0056377
517 Ga0466957_0079829
518 Ga0466957_0234184
519 Ga0466957_0465410
520 Ga0466960_0014228
521 Ga0466960_0092348
522 Ga0466960_0794727
523 Ga0466959_0010017
524 Ga0466959_0018760
525 Ga0466959_0049994
526 Ga0466959_0095923
527 Ga0466959_0164903
528 Ga0466959_0329247
529 Ga0466958_0003280
530 Ga0466958_0013834
531 Ga0466958_0017704
532 Ga0466958_0064597
533 Ga0466958_0086569
534 Ga0466967_0003489
535 Ga0466967_0004654
536 Ga0466967_0006470
537 Ga0466967_0073503
538 Ga0466967_0087353
539 Ga0466967_0092654
540 Ga0466967_0117033
541 Ga0466967_0133512
542 Ga0466967_0133735
543 Ga0466967_0334973
544 Ga0466967_0403636
545 Ga0466967_0487439
546 Ga0495653_0597064
547 Ga0495623_0363980
548 Ga0496100_0275521
549 Ga0496101_0042537
550 Ga0496101_0234697
551 Ga0496102_0000094
552 Ga0496102_0001365
553 Ga0496102_0037164
554 Ga0496103_0000042
555 Ga0496103_0071624
556 Ga0496104_0362137
557 Ga0496105_0013042
558 Ga0496105_0190924
559 Ga0496106_0026819
560 Ga0496107_0993018
561 Ga0496108_0014186
562 Ga0496109_0011776
563 Ga0496109_0044824
564 Ga0496110_0009041
565 Ga0496110_0187523
566 Ga0496111_0138749
567 Ga0496111_0237305
568 Ga0496112_0013492
569 Ga0496113_0020052
570 Ga0496114_0020181
571 Ga0496115_0006941
572 Ga0496115_0370889
573 Ga0496118_0020918
574 Ga0501031_0050294
575 Ga0501032_0196431
576 Ga0501033_0064937
577 Ga0501034_0126737
578 Ga0501036_0082871
579 Ga0501037_0216037
580 Ga0501038_0029966
581 Ga0501039_0073188
582 Ga0501043_0018812
583 Ga0501046_0360765
584 Ga0501047_0003729
585 Ga0501047_0349582
586 Ga0501047_0475659
587 Ga0501048_0000571
588 Ga0501067_0072289
589 Ga0501070_0004427
590 Ga0501070_0210815
591 Ga0501070_0381548
592 Ga0501074_0670990
593 Ga0501080_0801568
594 Ga0501081_0164852
595 Ga0501035_0139070
596 Ga0501035_0579671
597 Ga0501044_0073081
598 Ga0501044_0590602
599 nmdc:mga0n895_145082_c1
600 nmdc:mga0rr50_291893_c1
601 nmdc:mga08x19_136159_c1
602 Ga0501082_0587791
603 Ga0466962_0218272
604 Ga0466962_0339377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

20

152

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wk4-assembly1.cif.gz_A crystal structure of ttk003001606 0.939 5 177
1wk4-assembly1.cif.gz_A crystal structure of ttk003001606 0.9028 5 177
3pp9-assembly2.cif.gz_C 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.874 58 176
1tiq-assembly1.cif.gz_A crystal structure of an acetyltransferase (paia) in complex with coa and dtt from bacillus subtilis, northeast structural genomics target sr64. 0.8686 3 179
3pp9-assembly1.cif.gz_A-2 1.6 angstrom resolution crystal structure of putative streptothricin acetyltransferase from bacillus anthracis str. ames in complex with acetyl coenzyme a 0.8662 58 176
ID Description Score Start End Superfamily
2cy2A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9455 5 177 3.40.630.30
2cy2A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9086 5 177 3.40.630.30
3fncA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8967 3 176 3.40.630.30
af_P9WQG5_1_155_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8883 13 176 3.40.630.30
3fncA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.886 3 176 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A2V7KQW7-F1-model_v4 N-acetyltransferase domain-containing protein 0.9545 3 178 GO:0016747
AF-K9AV92-F1-model_v4 Acetyltransferase 0.9468 5 177 GO:0016747
AF-A0A6L7NC67-F1-model_v4 GNAT family N-acetyltransferase 0.9458 5 175 GO:0016747
AF-A0A209CJA1-F1-model_v4 GNAT family N-acetyltransferase 0.9436 6 176 GO:0016747
AF-A0A4R7SQG7-F1-model_v4 Ribosomal protein S18 acetylase RimI-like enzyme 0.9423 5 181 GO:0005840
GO:0016747

Map