F396369

General Info

Members Datasets Scaffolds Average Seq Length
302 189 604 227

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100167709|Ga0070699_1001677093
Length 248
Sequence MTTRSPTKDGRRPRVVGVIMSQTDLDLAIRMRERPDLFELRLDHLVRPPSVAAATGGATDIVDELEEKMSRLRAPLIVTARHPQEGGANKLNLRQRRDLLSRFLPHARYIDIELRSAAALHSLCKLARKKNVRRIISFHDLQATPHLGRLQFKARRAKSLGADIFKVATRTDTPTQLARLLDFITKKDLDLPVSAMGIGKLGAISRVLLAYRGSALVYGSVSATSDIEGQMSLEQLRAFGIGSRTRAF

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
138 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
139 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
182 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
187 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.96
Rhizosphere 94.04
Stem 0
Stem Tuber 0
Unclassified 31.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100167709 3300005518 Bacteria 1945
2 SwRhRL2b_contig_24897 2162886007 Unclassified 941
3 JGI24737J22298_10020136 3300001990 Bacteria 2132
4 JGI24035J26624_1001995 3300002126 Unclassified 1901
5 JGI24035J26624_1004982 3300002126 Bacteria 1265
6 JGI24035J26624_1005007 3300002126 Bacteria 1263
7 JGI25406J46586_10000031 3300003203 Bacteria 68943
8 Ga0065714_10121653 3300005288 Bacteria 1341
9 Ga0065714_10128380 3300005288 Unclassified 1274
10 Ga0065704_10017053 3300005289 Bacteria 1962
11 Ga0065704_10144229 3300005289 Unclassified 1488
12 Ga0065704_10152737 3300005289 Unclassified 1416
13 Ga0065712_10000339 3300005290 Bacteria 13924
14 Ga0065712_10007656 3300005290 Bacteria 4304
15 Ga0065712_10024496 3300005290 Bacteria 1381
16 Ga0065715_10005059 3300005293 Bacteria 3775
17 Ga0065715_10009283 3300005293 Unclassified 3798
18 Ga0065715_10009337 3300005293 Bacteria 5007
19 Ga0065715_10123027 3300005293 Bacteria 2188
20 Ga0065707_10145773 3300005295 Unclassified 1716
21 Ga0065707_10203941 3300005295 Unclassified 1297
22 Ga0070676_10000435 3300005328 Bacteria 19826
23 Ga0070683_100008982 3300005329 Bacteria 8518
24 Ga0070690_100084687 3300005330 Bacteria 2078
25 Ga0068869_100091714 3300005334 Bacteria 2286
26 Ga0068869_100239243 3300005334 Bacteria 1446
27 Ga0070666_10015551 3300005335 Bacteria 4856
28 Ga0070666_10099281 3300005335 Unclassified 2005
29 Ga0070680_100145267 3300005336 Bacteria 1990
30 Ga0070682_100071990 3300005337 Bacteria 2214
31 Ga0070682_100126924 3300005337 Bacteria 1721
32 Ga0068868_100009862 3300005338 Bacteria 6896
33 Ga0068868_100092939 3300005338 Bacteria 2432
34 Ga0070660_100025165 3300005339 Bacteria 4423
35 Ga0070660_100063989 3300005339 Bacteria 2861
36 Ga0070660_100114767 3300005339 Bacteria 2146
37 Ga0070689_100005542 3300005340 Bacteria 8632
38 Ga0070687_100026044 3300005343 Bacteria 2812
39 Ga0070661_100005723 3300005344 Bacteria 8564
40 Ga0070661_100186213 3300005344 Unclassified 1582
41 Ga0070692_10022263 3300005345 Bacteria 3094
42 Ga0070668_100055406 3300005347 Bacteria 3060
43 Ga0070669_100010931 3300005353 Bacteria 6446
44 Ga0070669_100504631 3300005353 Unclassified 1004
45 Ga0070675_100003489 3300005354 Bacteria 11927
46 Ga0070675_100008178 3300005354 Bacteria 8109
47 Ga0070675_100014469 3300005354 Bacteria 6222
48 Ga0070671_100075546 3300005355 Bacteria 2815
49 Ga0070671_100247150 3300005355 Bacteria 1515
50 Ga0070688_100007536 3300005365 Bacteria 5873
51 Ga0070688_100013074 3300005365 Bacteria 4673
52 Ga0070688_100018963 3300005365 Bacteria 3979
53 Ga0070659_100021792 3300005366 Bacteria 4885
54 Ga0070659_100030045 3300005366 Unclassified 4203
55 Ga0070667_100045646 3300005367 Bacteria 3685
56 Ga0070667_100124644 3300005367 Bacteria 2244
57 Ga0070667_100140650 3300005367 Bacteria 2113
58 Ga0070667_100226790 3300005367 Unclassified 1665
59 Ga0070703_10127811 3300005406 Unclassified 930
60 Ga0070709_10070787 3300005434 Bacteria 2249
61 Ga0070714_100366995 3300005435 Unclassified 1355
62 Ga0070713_100118799 3300005436 Unclassified 2315
63 Ga0070713_101062074 3300005436 Bacteria 782
64 Ga0070711_100509121 3300005439 Unclassified 994
65 Ga0070705_100036686 3300005440 Bacteria 2759
66 Ga0070705_100113033 3300005440 Unclassified 1739
67 Ga0070700_100039888 3300005441 Bacteria 2871
68 Ga0070694_100014407 3300005444 Bacteria 4950
69 Ga0070708_100148401 3300005445 Bacteria 2179
70 Ga0070708_100219539 3300005445 Bacteria 1782
71 Ga0070708_100254638 3300005445 Unclassified 1649
72 Ga0070663_100059637 3300005455 Bacteria 2743
73 Ga0070663_100429141 3300005455 Bacteria 1085
74 Ga0070678_100020338 3300005456 Bacteria 4353
75 Ga0070678_100099445 3300005456 Bacteria 2251
76 Ga0070662_100000698 3300005457 Bacteria 20550
77 Ga0070662_100043036 3300005457 Bacteria 3229
78 Ga0070662_100642087 3300005457 Unclassified 895
79 Ga0070681_10022380 3300005458 Bacteria 6347
80 Ga0070685_10252457 3300005466 Bacteria 1169
81 Ga0070706_100035417 3300005467 Bacteria 4610
82 Ga0070706_100053038 3300005467 Unclassified 3742
83 Ga0070706_100125000 3300005467 Unclassified 2398
84 Ga0070707_100038952 3300005468 Bacteria 4541
85 Ga0070707_100054052 3300005468 Unclassified 3850
86 Ga0070707_100280445 3300005468 Bacteria 1619
87 Ga0070679_100123516 3300005530 Bacteria 2572
88 Ga0070684_100000442 3300005535 Bacteria 28430
89 Ga0070684_100011167 3300005535 Bacteria 7150
90 Ga0070697_100041766 3300005536 Bacteria 3712
91 Ga0070672_100286489 3300005543 Bacteria 1394
92 Ga0070686_100054315 3300005544 Bacteria 2562
93 Ga0070686_100275453 3300005544 Unclassified 1239
94 Ga0070695_100432705 3300005545 Unclassified 1004
95 Ga0070665_100012378 3300005548 Bacteria 8598
96 Ga0070665_100031239 3300005548 Bacteria 5360
97 Ga0070704_100000406 3300005549 Bacteria 19907
98 Ga0070664_100031630 3300005564 Bacteria 4423
99 Ga0070664_100033592 3300005564 Bacteria 4298
100 Ga0070664_100218948 3300005564 Unclassified 1703
101 Ga0068856_100023904 3300005614 Bacteria 5944
102 Ga0070702_100030892 3300005615 Unclassified 2925
103 Ga0068859_100336140 3300005617 Unclassified 1605
104 Ga0068861_100238667 3300005719 Bacteria 1545
105 Ga0068863_100042235 3300005841 Bacteria 4333
106 Ga0068858_100007713 3300005842 Bacteria 10389
107 Ga0068860_100206100 3300005843 Bacteria 1907
108 Ga0068862_100054578 3300005844 Unclassified 3421
109 Ga0081455_10037194 3300005937 Unclassified 4326
110 Ga0081455_10085939 3300005937 Bacteria 2563
111 Ga0081538_10079175 3300005981 Bacteria 1759
112 Ga0081540_1067597 3300005983 Bacteria 1669
113 Ga0081539_10000564 3300005985 Bacteria 76514
114 Ga0081539_10007635 3300005985 Bacteria 9748
115 Ga0081539_10027334 3300005985 Bacteria 3616
116 Ga0070717_10106854 3300006028 Bacteria 2383
117 Ga0070716_100112988 3300006173 Bacteria 1687
118 Ga0070712_100044241 3300006175 Unclassified 3069
119 Ga0070712_100140295 3300006175 Bacteria 1843
120 Ga0070712_100548791 3300006175 Unclassified 973
121 Ga0068871_100088914 3300006358 Bacteria 2571
122 Ga0075428_100117604 3300006844 Bacteria 2896
123 Ga0075434_100368692 3300006871 Bacteria 1457
124 Ga0068865_100435188 3300006881 Unclassified 1081
125 Ga0097620_100336142 3300006931 Unclassified 1605
126 Ga0105245_10064387 3300009098 Bacteria 3313
127 Ga0105245_10197957 3300009098 Unclassified 1928
128 Ga0105247_10011762 3300009101 Bacteria 5264
129 Ga0114129_10020828 3300009147 Bacteria 9314
130 Ga0114129_10359701 3300009147 Bacteria 1926
131 Ga0105241_10026262 3300009174 Bacteria 4332
132 Ga0105248_10595649 3300009177 Bacteria 1247
133 Ga0105248_10678162 3300009177 Bacteria 1163
134 Ga0105249_10006693 3300009553 Bacteria 10039
135 Ga0105249_10051923 3300009553 Unclassified 3742
136 Ga0099796_10037445 3300010159 Bacteria 1622
137 Ga0099796_10084540 3300010159 Unclassified 1169
138 Ga0105239_10032566 3300010375 Bacteria 5728
139 Ga0105239_10197680 3300010375 Bacteria 2252
140 Ga0105239_10753470 3300010375 Unclassified 1115
141 Ga0157374_10006533 3300013296 Bacteria 9903
142 Ga0157374_10012054 3300013296 Bacteria 7506
143 Ga0157374_10202701 3300013296 Bacteria 1943
144 Ga0157374_10424226 3300013296 Unclassified 1329
145 Ga0157378_10063278 3300013297 Bacteria 3305
146 Ga0157378_10130975 3300013297 Bacteria 2321
147 Ga0163162_10466495 3300013306 Unclassified 1394
148 Ga0163162_10766494 3300013306 Unclassified 1084
149 Ga0157372_10244555 3300013307 Bacteria 2082
150 Ga0157375_10001242 3300013308 Bacteria 22030
151 Ga0163163_10039785 3300014325 Bacteria 4590
152 Ga0163163_10109763 3300014325 Unclassified 2786
153 Ga0163163_10518844 3300014325 Unclassified 1254
154 Ga0163163_11050202 3300014325 Unclassified 878
155 Ga0157377_10062640 3300014745 Unclassified 2128
156 Ga0157377_10694234 3300014745 Unclassified 738
157 Ga0157379_10049392 3300014968 Unclassified 3757
158 Ga0157379_10345028 3300014968 Unclassified 1362
159 Ga0157376_10032104 3300014969 Bacteria 4212
160 Ga0157376_10191919 3300014969 Bacteria 1874
161 Ga0182007_10068264 3300015262 Unclassified 1165
162 Ga0207666_1000563 3300025271 Bacteria 4505
163 Ga0207666_1008829 3300025271 Bacteria 1352
164 Ga0207697_10000531 3300025315 Bacteria 21534
165 Ga0207697_10001878 3300025315 Bacteria 11216
166 Ga0207697_10002672 3300025315 Bacteria 9123
167 Ga0207697_10004542 3300025315 Bacteria 6609
168 Ga0207692_10136336 3300025898 Unclassified 1391
169 Ga0207680_10079841 3300025903 Unclassified 2053
170 Ga0207647_10029384 3300025904 Bacteria 3559
171 Ga0207645_10005299 3300025907 Bacteria 9386
172 Ga0207684_10006557 3300025910 Bacteria 10595
173 Ga0207684_10121279 3300025910 Unclassified 2242
174 Ga0207654_10052820 3300025911 Bacteria 2343
175 Ga0207693_10034000 3300025915 Bacteria 4022
176 Ga0207693_10052809 3300025915 Bacteria 3188
177 Ga0207693_10172311 3300025915 Unclassified 1704
178 Ga0207663_10632731 3300025916 Unclassified 843
179 Ga0207660_10048374 3300025917 Bacteria 3009
180 Ga0207662_10005894 3300025918 Bacteria 6574
181 Ga0207657_10062613 3300025919 Bacteria 3184
182 Ga0207649_10015291 3300025920 Bacteria 4312
183 Ga0207652_10076371 3300025921 Bacteria 2921
184 Ga0207646_10036437 3300025922 Bacteria 4441
185 Ga0207646_10042322 3300025922 Unclassified 4091
186 Ga0207646_10190867 3300025922 Bacteria 1850
187 Ga0207646_10269037 3300025922 Bacteria 1540
188 Ga0207681_10012608 3300025923 Bacteria 5218
189 Ga0207659_10199139 3300025926 Bacteria 1598
190 Ga0207659_10304858 3300025926 Bacteria 1309
191 Ga0207687_10401960 3300025927 Bacteria 1127
192 Ga0207644_10366266 3300025931 Bacteria 1173
193 Ga0207690_10030777 3300025932 Bacteria 3427
194 Ga0207690_10438756 3300025932 Bacteria 1047
195 Ga0207706_10000509 3300025933 Bacteria 41327
196 Ga0207706_10063446 3300025933 Bacteria 3253
197 Ga0207670_10005940 3300025936 Bacteria 6739
198 Ga0207670_10029738 3300025936 Bacteria 3483
199 Ga0207670_10104131 3300025936 Bacteria 2032
200 Ga0207669_10076356 3300025937 Bacteria 2127
201 Ga0207704_10649065 3300025938 Unclassified 869
202 Ga0207665_10020246 3300025939 Bacteria 4370
203 Ga0207665_10031709 3300025939 Bacteria 3498
204 Ga0207691_10332603 3300025940 Bacteria 1301
205 Ga0207689_10042684 3300025942 Bacteria 3750
206 Ga0207689_10091877 3300025942 Bacteria 2493
207 Ga0207661_10567631 3300025944 Unclassified 1040
208 Ga0207679_10038651 3300025945 Bacteria 3402
209 Ga0207712_10030492 3300025961 Unclassified 3626
210 Ga0207712_10108767 3300025961 Bacteria 2075
211 Ga0207668_10016586 3300025972 Bacteria 4599
212 Ga0207668_10088923 3300025972 Bacteria 2263
213 Ga0207668_10141502 3300025972 Bacteria 1851
214 Ga0207658_10025005 3300025986 Unclassified 4179
215 Ga0207677_10161845 3300026023 Bacteria 1740
216 Ga0207703_10088265 3300026035 Bacteria 2602
217 Ga0207678_10000783 3300026067 Bacteria 29037
218 Ga0207678_10651709 3300026067 Bacteria 925
219 Ga0207708_10019467 3300026075 Bacteria 5117
220 Ga0207675_100258677 3300026118 Bacteria 1686
221 Ga0207683_10043337 3300026121 Bacteria 3933
222 Ga0268266_10005252 3300028379 Bacteria 12162
223 Ga0268266_10510285 3300028379 Unclassified 1149
224 Ga0268266_11048089 3300028379 Unclassified 789
225 Ga0268265_10323205 3300028380 Bacteria 1398
226 Ga0268264_10270433 3300028381 Bacteria 1587
227 Ga0373944_0075221 3300035089 Bacteria 1107
228 Ga0373944_0206309 3300035089 Unclassified 713
229 Ga0373943_0024623 3300035170 Bacteria 2808
230 Ga0373935_0193052 3300035692 Unclassified 1404
231 Ga0373935_0468947 3300035692 Unclassified 911
232 Ga0373927_0588234 3300035695 Unclassified 736
233 Ga0373933_0214165 3300035724 Bacteria 1235
234 Ga0373947_0119249 3300035725 Bacteria 1675
235 Ga0373947_0126758 3300035725 Bacteria 1626
236 Ga0373937_0085012 3300036401 Bacteria 2928
237 Ga0373937_0101339 3300036401 Unclassified 2672
238 Ga0373937_1148388 3300036401 Unclassified 725
239 Ga0373925_0056169 3300037068 Bacteria 2949
240 Ga0373925_0139892 3300037068 Bacteria 1894
241 Ga0373925_0417008 3300037068 Unclassified 1096
242 Ga0439455_0007845 3300042012 Bacteria 2272
243 Ga0439464_0018368 3300042439 Unclassified 1902
244 Ga0439464_0053381 3300042439 Unclassified 1173
245 Ga0466964_0026167 3300044706 Bacteria 2283
246 Ga0451576_0857245 3300045051 Unclassified 953
247 Ga0466967_0118560 3300045976 Bacteria 2441
248 Ga0495592_0002125 3300046454 Bacteria 13971
249 Ga0495653_0112045 3300046463 Bacteria 1959
250 Ga0495653_0305717 3300046463 Bacteria 1036
251 Ga0495664_0049520 3300046477 Unclassified 2494
252 Ga0495608_0086745 3300046511 Unclassified 2028
253 Ga0495608_0350085 3300046511 Unclassified 909
254 Ga0495628_0011475 3300046516 Bacteria 7490
255 Ga0495630_0016720 3300046517 Bacteria 5366
256 Ga0495630_0645768 3300046517 Unclassified 810
257 Ga0495652_0050270 3300046529 Bacteria 3564
258 Ga0495586_0028907 3300046535 Bacteria 2967
259 Ga0495586_0131677 3300046535 Unclassified 1400
260 Ga0495587_0067896 3300046536 Unclassified 2077
261 Ga0495645_0023076 3300046543 Bacteria 4504
262 Ga0495645_0358877 3300046543 Unclassified 937
263 Ga0495667_0096130 3300046559 Unclassified 1918
264 Ga0495634_0032475 3300046642 Bacteria 3591
265 Ga0495635_0192660 3300046663 Unclassified 1384
266 Ga0495635_0360708 3300046663 Unclassified 969
267 Ga0495657_0304610 3300046675 Unclassified 950
268 Ga0495623_0007036 3300046679 Bacteria 7309
269 Ga0495604_0058303 3300047317 Unclassified 2965
270 Ga0495674_0141338 3300047319 Bacteria 2023
271 Ga0495674_0312448 3300047319 Unclassified 1282
272 Ga0495675_0031350 3300047444 Unclassified 3393
273 Ga0495684_0021900 3300047471 Bacteria 4921
274 Ga0495684_0272301 3300047471 Bacteria 1225
275 Ga0495602_0029189 3300048088 Bacteria 5261
276 Ga0496101_0117844 3300048904 Bacteria 2005
277 Ga0496102_0029608 3300048905 Bacteria 4900
278 Ga0496103_0037929 3300048906 Unclassified 2955
279 Ga0496104_0153963 3300048907 Unclassified 2207
280 Ga0496104_0419628 3300048907 Bacteria 1250
281 Ga0496105_0082415 3300048908 Bacteria 2657
282 Ga0496105_0158452 3300048908 Unclassified 1859
283 Ga0496106_0146512 3300048909 Unclassified 1860
284 Ga0496108_0233378 3300048911 Unclassified 1600
285 Ga0496109_0067419 3300048912 Unclassified 3278
286 Ga0496109_0074667 3300048912 Bacteria 3117
287 Ga0496110_0832589 3300048913 Bacteria 828
288 Ga0496111_0136916 3300048914 Bacteria 1814
289 Ga0496112_0011728 3300048915 Bacteria 8022
290 Ga0496113_0012171 3300048916 Bacteria 5775
291 Ga0496114_0006852 3300048917 Bacteria 8977
292 Ga0496115_0051031 3300048918 Bacteria 3316
293 Ga0496115_0681957 3300048918 Bacteria 809
294 nmdc:mga05p37_193930_c1 3300050507 Bacteria 2464
295 nmdc:mga0n895_374962_c1 3300050512 Unclassified 1440
296 nmdc:mga0rr50_374812_c1 3300050513 Bacteria 1199
297 Ga0495601_0018989 3300053077 Unclassified 4188
298 Ga0495612_0015727 3300053078 Bacteria 3033
299 Ga0495595_0192745 3300053084 Unclassified 1013
300 Ga0495619_0088301 3300053085 Unclassified 2097
301 Ga0495619_0109506 3300053085 Bacteria 1886
302 Ga0495619_0732408 3300053085 Unclassified 671
303 Ga0070699_100167709
304 SwRhRL2b_contig_24897
305 JGI24737J22298_10020136
306 JGI24035J26624_1001995
307 JGI24035J26624_1004982
308 JGI24035J26624_1005007
309 JGI25406J46586_10000031
310 Ga0065714_10121653
311 Ga0065714_10128380
312 Ga0065704_10017053
313 Ga0065704_10144229
314 Ga0065704_10152737
315 Ga0065712_10000339
316 Ga0065712_10007656
317 Ga0065712_10024496
318 Ga0065715_10005059
319 Ga0065715_10009283
320 Ga0065715_10009337
321 Ga0065715_10123027
322 Ga0065707_10145773
323 Ga0065707_10203941
324 Ga0070676_10000435
325 Ga0070683_100008982
326 Ga0070690_100084687
327 Ga0068869_100091714
328 Ga0068869_100239243
329 Ga0070666_10015551
330 Ga0070666_10099281
331 Ga0070680_100145267
332 Ga0070682_100071990
333 Ga0070682_100126924
334 Ga0068868_100009862
335 Ga0068868_100092939
336 Ga0070660_100025165
337 Ga0070660_100063989
338 Ga0070660_100114767
339 Ga0070689_100005542
340 Ga0070687_100026044
341 Ga0070661_100005723
342 Ga0070661_100186213
343 Ga0070692_10022263
344 Ga0070668_100055406
345 Ga0070669_100010931
346 Ga0070669_100504631
347 Ga0070675_100003489
348 Ga0070675_100008178
349 Ga0070675_100014469
350 Ga0070671_100075546
351 Ga0070671_100247150
352 Ga0070688_100007536
353 Ga0070688_100013074
354 Ga0070688_100018963
355 Ga0070659_100021792
356 Ga0070659_100030045
357 Ga0070667_100045646
358 Ga0070667_100124644
359 Ga0070667_100140650
360 Ga0070667_100226790
361 Ga0070703_10127811
362 Ga0070709_10070787
363 Ga0070714_100366995
364 Ga0070713_100118799
365 Ga0070713_101062074
366 Ga0070711_100509121
367 Ga0070705_100036686
368 Ga0070705_100113033
369 Ga0070700_100039888
370 Ga0070694_100014407
371 Ga0070708_100148401
372 Ga0070708_100219539
373 Ga0070708_100254638
374 Ga0070663_100059637
375 Ga0070663_100429141
376 Ga0070678_100020338
377 Ga0070678_100099445
378 Ga0070662_100000698
379 Ga0070662_100043036
380 Ga0070662_100642087
381 Ga0070681_10022380
382 Ga0070685_10252457
383 Ga0070706_100035417
384 Ga0070706_100053038
385 Ga0070706_100125000
386 Ga0070707_100038952
387 Ga0070707_100054052
388 Ga0070707_100280445
389 Ga0070679_100123516
390 Ga0070684_100000442
391 Ga0070684_100011167
392 Ga0070697_100041766
393 Ga0070672_100286489
394 Ga0070686_100054315
395 Ga0070686_100275453
396 Ga0070695_100432705
397 Ga0070665_100012378
398 Ga0070665_100031239
399 Ga0070704_100000406
400 Ga0070664_100031630
401 Ga0070664_100033592
402 Ga0070664_100218948
403 Ga0068856_100023904
404 Ga0070702_100030892
405 Ga0068859_100336140
406 Ga0068861_100238667
407 Ga0068863_100042235
408 Ga0068858_100007713
409 Ga0068860_100206100
410 Ga0068862_100054578
411 Ga0081455_10037194
412 Ga0081455_10085939
413 Ga0081538_10079175
414 Ga0081540_1067597
415 Ga0081539_10000564
416 Ga0081539_10007635
417 Ga0081539_10027334
418 Ga0070717_10106854
419 Ga0070716_100112988
420 Ga0070712_100044241
421 Ga0070712_100140295
422 Ga0070712_100548791
423 Ga0068871_100088914
424 Ga0075428_100117604
425 Ga0075434_100368692
426 Ga0068865_100435188
427 Ga0097620_100336142
428 Ga0105245_10064387
429 Ga0105245_10197957
430 Ga0105247_10011762
431 Ga0114129_10020828
432 Ga0114129_10359701
433 Ga0105241_10026262
434 Ga0105248_10595649
435 Ga0105248_10678162
436 Ga0105249_10006693
437 Ga0105249_10051923
438 Ga0099796_10037445
439 Ga0099796_10084540
440 Ga0105239_10032566
441 Ga0105239_10197680
442 Ga0105239_10753470
443 Ga0157374_10006533
444 Ga0157374_10012054
445 Ga0157374_10202701
446 Ga0157374_10424226
447 Ga0157378_10063278
448 Ga0157378_10130975
449 Ga0163162_10466495
450 Ga0163162_10766494
451 Ga0157372_10244555
452 Ga0157375_10001242
453 Ga0163163_10039785
454 Ga0163163_10109763
455 Ga0163163_10518844
456 Ga0163163_11050202
457 Ga0157377_10062640
458 Ga0157377_10694234
459 Ga0157379_10049392
460 Ga0157379_10345028
461 Ga0157376_10032104
462 Ga0157376_10191919
463 Ga0182007_10068264
464 Ga0207666_1000563
465 Ga0207666_1008829
466 Ga0207697_10000531
467 Ga0207697_10001878
468 Ga0207697_10002672
469 Ga0207697_10004542
470 Ga0207692_10136336
471 Ga0207680_10079841
472 Ga0207647_10029384
473 Ga0207645_10005299
474 Ga0207684_10006557
475 Ga0207684_10121279
476 Ga0207654_10052820
477 Ga0207693_10034000
478 Ga0207693_10052809
479 Ga0207693_10172311
480 Ga0207663_10632731
481 Ga0207660_10048374
482 Ga0207662_10005894
483 Ga0207657_10062613
484 Ga0207649_10015291
485 Ga0207652_10076371
486 Ga0207646_10036437
487 Ga0207646_10042322
488 Ga0207646_10190867
489 Ga0207646_10269037
490 Ga0207681_10012608
491 Ga0207659_10199139
492 Ga0207659_10304858
493 Ga0207687_10401960
494 Ga0207644_10366266
495 Ga0207690_10030777
496 Ga0207690_10438756
497 Ga0207706_10000509
498 Ga0207706_10063446
499 Ga0207670_10005940
500 Ga0207670_10029738
501 Ga0207670_10104131
502 Ga0207669_10076356
503 Ga0207704_10649065
504 Ga0207665_10020246
505 Ga0207665_10031709
506 Ga0207691_10332603
507 Ga0207689_10042684
508 Ga0207689_10091877
509 Ga0207661_10567631
510 Ga0207679_10038651
511 Ga0207712_10030492
512 Ga0207712_10108767
513 Ga0207668_10016586
514 Ga0207668_10088923
515 Ga0207668_10141502
516 Ga0207658_10025005
517 Ga0207677_10161845
518 Ga0207703_10088265
519 Ga0207678_10000783
520 Ga0207678_10651709
521 Ga0207708_10019467
522 Ga0207675_100258677
523 Ga0207683_10043337
524 Ga0268266_10005252
525 Ga0268266_10510285
526 Ga0268266_11048089
527 Ga0268265_10323205
528 Ga0268264_10270433
529 Ga0373944_0075221
530 Ga0373944_0206309
531 Ga0373943_0024623
532 Ga0373935_0193052
533 Ga0373935_0468947
534 Ga0373927_0588234
535 Ga0373933_0214165
536 Ga0373947_0119249
537 Ga0373947_0126758
538 Ga0373937_0085012
539 Ga0373937_0101339
540 Ga0373937_1148388
541 Ga0373925_0056169
542 Ga0373925_0139892
543 Ga0373925_0417008
544 Ga0439455_0007845
545 Ga0439464_0018368
546 Ga0439464_0053381
547 Ga0466964_0026167
548 Ga0451576_0857245
549 Ga0466967_0118560
550 Ga0495592_0002125
551 Ga0495653_0112045
552 Ga0495653_0305717
553 Ga0495664_0049520
554 Ga0495608_0086745
555 Ga0495608_0350085
556 Ga0495628_0011475
557 Ga0495630_0016720
558 Ga0495630_0645768
559 Ga0495652_0050270
560 Ga0495586_0028907
561 Ga0495586_0131677
562 Ga0495587_0067896
563 Ga0495645_0023076
564 Ga0495645_0358877
565 Ga0495667_0096130
566 Ga0495634_0032475
567 Ga0495635_0192660
568 Ga0495635_0360708
569 Ga0495657_0304610
570 Ga0495623_0007036
571 Ga0495604_0058303
572 Ga0495674_0141338
573 Ga0495674_0312448
574 Ga0495675_0031350
575 Ga0495684_0021900
576 Ga0495684_0272301
577 Ga0495602_0029189
578 Ga0496101_0117844
579 Ga0496102_0029608
580 Ga0496103_0037929
581 Ga0496104_0153963
582 Ga0496104_0419628
583 Ga0496105_0082415
584 Ga0496105_0158452
585 Ga0496106_0146512
586 Ga0496108_0233378
587 Ga0496109_0067419
588 Ga0496109_0074667
589 Ga0496110_0832589
590 Ga0496111_0136916
591 Ga0496112_0011728
592 Ga0496113_0012171
593 Ga0496114_0006852
594 Ga0496115_0051031
595 Ga0496115_0681957
596 nmdc:mga05p37_193930_c1
597 nmdc:mga0n895_374962_c1
598 nmdc:mga0rr50_374812_c1
599 Ga0495601_0018989
600 Ga0495612_0015727
601 Ga0495595_0192745
602 Ga0495619_0088301
603 Ga0495619_0109506
604 Ga0495619_0732408

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01487

DHquinase_I

Type I 3-dehydroquinase

16

239

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
3js3-assembly1.cif.gz_A crystal structure of type i 3-dehydroquinate dehydratase (arod) from clostridium difficile with covalent reaction intermediate 0.8991 10 223
3oex-assembly1.cif.gz_B crystal structure of type i 3-dehydroquinate dehydratase (arod) from salmonella typhimurium with close loop conformation. 0.8855 11 223
6bmb-assembly1.cif.gz_A crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase (t381g mutant) in complex with tartrate and shikimate 0.8853 11 221
8b2b-assembly1.cif.gz_AAA crystal structure of type i dehydroquinase from salmonella typhi inhibited by a hydroxylamine derivative 0.8852 11 223
2yr1-assembly1.cif.gz_B crystal structure of 3-dehydroquinate dehydratase from geobacillus kaustophilus hta426 0.885 11 223
ID Description Score Start End Superfamily
2yr1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8861 11 223 3.20.20.70
af_A0A1D6MXQ7_44_252_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.885 52 221 3.20.20.70
1l9wC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8847 11 223 3.20.20.70
2egzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8689 12 223 3.20.20.70
4ph6A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.861 10 223 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A2V6CU95-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9926 6 223 GO:0003855
GO:0046279
AF-A0A2V5RDY9-F1-model_v4 3-dehydroquinate dehydratase 0.9906 10 108 GO:0003855
AF-A0A2V6GPH7-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9901 2 223 GO:0003855
GO:0046279
AF-A0A2V6JZN4-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9862 17 202 GO:0003855
GO:0046279
AF-A0A7V8VLD6-F1-model_v4 3-dehydroquinate dehydratase (EC 4.2.1.10) 0.9839 11 222 GO:0003855
GO:0046279

Map