F396308

General Info

Members Datasets Scaffolds Average Seq Length
302 168 604 485

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10080371|Ga0070666_100803712
Length 522
Sequence MFNHKSSNPLTRREALRKVGNGFGMVAFAGMLGNSLARAGAVLDSEGNIGVSKLDHPQRVKRVIFLFMNGGCSSIDSFDPKPALERYDGQPLPGGTIKTERRTGELMKSPFKFKKYGQCGMDVSELWPHLGEVADDICWVRSVYTDIPNHEPSCLMMNTGANQAGRPSMGAWLTYGLGTENQNLPGYVVLCPDVPTTVGPPLWSNGFLPAVNQGTFISNRVQTASDTPGGGADGEMMTEEMPEDRSKETXXXXDGKEKPKKVIVERNFDPKKLVSFVNNPKFSLIEQRRELDLLQKLENMREATTGTDQQVEGVIKSMEVAYRMQTEAPEVFDVRKESQATLDMYGPGPVARGALTAVRLAEKGVRMTQVYYSKGDPWDAHGDIFAHKVNAKNSDQAFAAVIKDLKGRGMWKDTLVVCGSEFGRTPVREVGGASGSVKRGRDHNPFGFTMWLAGGAVKGGTIYGATDDFGFKAIEKPVHVHDIHATILYLFGIEHTKLTYRYSGRDFRLTDVSGEILHDIIA

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
108 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
115 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
116 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
117 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
118 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
121 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
125 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
163 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
167 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 0.66
Rhizosphere 97.68
Stem 0
Stem Tuber 0
Unclassified 4.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10080371 3300005335 Bacteria 2228
2 rootH2_10056229 3300003320 Bacteria 6883
3 Ga0070658_10000120 3300005327 Bacteria 70515
4 Ga0070658_10000813 3300005327 Bacteria 26671
5 Ga0070658_10006513 3300005327 Bacteria 9471
6 Ga0070683_100000001 3300005329 Bacteria 529385
7 Ga0070683_100022782 3300005329 Bacteria 5601
8 Ga0070683_100163425 3300005329 Bacteria 2112
9 Ga0070670_100022609 3300005331 Bacteria 5411
10 Ga0070666_10064169 3300005335 Bacteria 2490
11 Ga0070680_100008702 3300005336 Bacteria 7780
12 Ga0068868_100112661 3300005338 Bacteria 2212
13 Ga0070660_100141987 3300005339 Bacteria 1927
14 Ga0070689_100121363 3300005340 Bacteria 2088
15 Ga0070689_100123779 3300005340 Bacteria 2068
16 Ga0070691_10002485 3300005341 Bacteria 8200
17 Ga0070674_100065360 3300005356 Bacteria 2553
18 Ga0070674_100078445 3300005356 Bacteria 2353
19 Ga0070674_100097896 3300005356 Bacteria 2131
20 Ga0070673_100138200 3300005364 Bacteria 2053
21 Ga0070688_100042203 3300005365 Bacteria 2805
22 Ga0070688_100107234 3300005365 Bacteria 1851
23 Ga0070667_100004355 3300005367 Bacteria 11943
24 Ga0070703_10000611 3300005406 Bacteria 12697
25 Ga0070709_10038004 3300005434 Bacteria 2945
26 Ga0070714_100002192 3300005435 Bacteria 14376
27 Ga0070714_100028669 3300005435 Bacteria 4622
28 Ga0070713_100005554 3300005436 Bacteria 8639
29 Ga0070713_100007517 3300005436 Bacteria 7656
30 Ga0070713_100014048 3300005436 Bacteria 5929
31 Ga0070701_10007686 3300005438 Bacteria 4624
32 Ga0070705_100067192 3300005440 Bacteria 2153
33 Ga0070700_100013470 3300005441 Bacteria 4594
34 Ga0070700_100023222 3300005441 Bacteria 3626
35 Ga0070694_100027620 3300005444 Bacteria 3687
36 Ga0070694_100180972 3300005444 Bacteria 1559
37 Ga0070681_10226537 3300005458 Bacteria 1784
38 Ga0068867_100075182 3300005459 Bacteria 2533
39 Ga0070698_100121329 3300005471 Bacteria 2574
40 Ga0070679_100024096 3300005530 Bacteria 5962
41 Ga0070684_100000006 3300005535 Bacteria 227715
42 Ga0070684_100039244 3300005535 Bacteria 4072
43 Ga0070686_100000142 3300005544 Bacteria 49233
44 Ga0070695_100017483 3300005545 Bacteria 4350
45 Ga0070695_100025781 3300005545 Bacteria 3632
46 Ga0070696_100014351 3300005546 Bacteria 5314
47 Ga0070696_100029557 3300005546 Bacteria 3746
48 Ga0070704_100026192 3300005549 Bacteria 3849
49 Ga0070704_100172202 3300005549 Bacteria 1723
50 Ga0068855_100011924 3300005563 Bacteria 10508
51 Ga0068855_100014926 3300005563 Bacteria 9359
52 Ga0068855_100049801 3300005563 Bacteria 4939
53 Ga0068855_100050872 3300005563 Bacteria 4881
54 Ga0068855_100134261 3300005563 Bacteria 2824
55 Ga0068854_100009758 3300005578 Bacteria 6207
56 Ga0068852_100006138 3300005616 Bacteria 8665
57 Ga0068859_100190354 3300005617 Bacteria 2136
58 Ga0068864_100022136 3300005618 Bacteria 5328
59 Ga0068861_100007508 3300005719 Bacteria 7474
60 Ga0068863_100014414 3300005841 Bacteria 7614
61 Ga0068863_100097646 3300005841 Bacteria 2790
62 Ga0068858_100012325 3300005842 Bacteria 8059
63 Ga0068858_100133996 3300005842 Bacteria 2324
64 Ga0068858_100230085 3300005842 Bacteria 1757
65 Ga0081455_10016653 3300005937 Bacteria 7082
66 Ga0081455_10019012 3300005937 Bacteria 6515
67 Ga0081539_10018532 3300005985 Bacteria 4825
68 Ga0070717_10010159 3300006028 Bacteria 7090
69 Ga0097621_100083572 3300006237 Bacteria 2661
70 Ga0075428_100001429 3300006844 Bacteria 25472
71 Ga0075428_100021654 3300006844 Bacteria 7117
72 Ga0075428_100070599 3300006844 Unclassified 3818
73 Ga0075430_100007076 3300006846 Bacteria 9459
74 Ga0075431_100023895 3300006847 Bacteria 6257
75 Ga0075431_100064321 3300006847 Unclassified 3788
76 Ga0075431_100116988 3300006847 Bacteria 2751
77 Ga0075431_100166434 3300006847 Bacteria 2266
78 Ga0075433_10117160 3300006852 Bacteria 2363
79 Ga0075434_100014182 3300006871 Bacteria 7614
80 Ga0075429_100165487 3300006880 Unclassified 1937
81 Ga0097620_100190351 3300006931 Bacteria 2136
82 Ga0075435_100004208 3300007076 Bacteria 9877
83 Ga0075435_100027890 3300007076 Bacteria 4422
84 Ga0075435_100127639 3300007076 Bacteria 2126
85 Ga0105240_10000689 3300009093 Bacteria 62139
86 Ga0105240_10002638 3300009093 Bacteria 28568
87 Ga0105240_10033574 3300009093 Bacteria 6626
88 Ga0105240_10123888 3300009093 Bacteria 3109
89 Ga0105240_10313341 3300009093 Bacteria 1791
90 Ga0111539_10007822 3300009094 Bacteria 13648
91 Ga0111539_10012090 3300009094 Bacteria 10827
92 Ga0111539_10062373 3300009094 Bacteria 4413
93 Ga0111539_10121392 3300009094 Bacteria 3062
94 Ga0105245_10007861 3300009098 Bacteria 9328
95 Ga0105245_10009490 3300009098 Bacteria 8486
96 Ga0114129_10002144 3300009147 Bacteria 27205
97 Ga0114129_10014933 3300009147 Bacteria 11064
98 Ga0114129_10036921 3300009147 Bacteria 6898
99 Ga0114129_10122303 3300009147 Bacteria 3582
100 Ga0114129_10296825 3300009147 Bacteria 2155
101 Ga0105241_10029433 3300009174 Bacteria 4098
102 Ga0105241_10029480 3300009174 Bacteria 4095
103 Ga0105242_10001331 3300009176 Bacteria 19507
104 Ga0105248_10000024 3300009177 Bacteria 263817
105 Ga0105248_10013707 3300009177 Bacteria 8924
106 Ga0105248_10032064 3300009177 Bacteria 5872
107 Ga0105248_10171369 3300009177 Bacteria 2446
108 Ga0105237_10017778 3300009545 Bacteria 7372
109 Ga0105237_10023401 3300009545 Bacteria 6330
110 Ga0105237_10033230 3300009545 Bacteria 5225
111 Ga0105237_10138787 3300009545 Bacteria 2425
112 Ga0105238_10000180 3300009551 Bacteria 68847
113 Ga0105238_10006812 3300009551 Bacteria 11412
114 Ga0105238_10039494 3300009551 Unclassified 4786
115 Ga0105249_10004732 3300009553 Bacteria 11750
116 Ga0105249_10025970 3300009553 Bacteria 5275
117 Ga0105239_10005550 3300010375 Bacteria 14767
118 Ga0105239_10065130 3300010375 Bacteria 4002
119 Ga0157370_10000386 3300013104 Bacteria 55365
120 Ga0157370_10047988 3300013104 Bacteria 4091
121 Ga0157369_10041647 3300013105 Bacteria 5012
122 Ga0157369_10192240 3300013105 Unclassified 2144
123 Ga0163162_10037742 3300013306 Bacteria 4822
124 Ga0163162_10117882 3300013306 Bacteria 2757
125 Ga0157372_10022664 3300013307 Bacteria 6797
126 Ga0157372_10087934 3300013307 Bacteria 3527
127 Ga0157372_10168525 3300013307 Bacteria 2533
128 Ga0157375_10104268 3300013308 Bacteria 2924
129 Ga0163163_10000077 3300014325 Bacteria 108755
130 Ga0163163_10012098 3300014325 Bacteria 7852
131 Ga0163163_10036912 3300014325 Bacteria 4750
132 Ga0163163_10194442 3300014325 Bacteria 2076
133 Ga0157380_10045586 3300014326 Bacteria 3442
134 Ga0157376_10014390 3300014969 Bacteria 5938
135 Ga0157376_10031783 3300014969 Bacteria 4232
136 Ga0207656_10038093 3300025321 Bacteria 2026
137 Ga0207699_10036519 3300025906 Bacteria 2801
138 Ga0207645_10007008 3300025907 Bacteria 8023
139 Ga0207705_10028821 3300025909 Bacteria 3957
140 Ga0207705_10033559 3300025909 Bacteria 3668
141 Ga0207707_10212075 3300025912 Bacteria 1687
142 Ga0207695_10001792 3300025913 Bacteria 33895
143 Ga0207695_10020343 3300025913 Bacteria 7606
144 Ga0207695_10066189 3300025913 Bacteria 3712
145 Ga0207695_10159589 3300025913 Bacteria 2187
146 Ga0207671_10033259 3300025914 Bacteria 3836
147 Ga0207671_10059140 3300025914 Bacteria 2841
148 Ga0207660_10015402 3300025917 Bacteria 5046
149 Ga0207660_10172501 3300025917 Bacteria 1675
150 Ga0207662_10044607 3300025918 Bacteria 2618
151 Ga0207657_10202835 3300025919 Bacteria 1594
152 Ga0207652_10030367 3300025921 Bacteria 4525
153 Ga0207681_10017093 3300025923 Bacteria 4551
154 Ga0207694_10005350 3300025924 Bacteria 9883
155 Ga0207694_10023925 3300025924 Bacteria 4639
156 Ga0207694_10081688 3300025924 Bacteria 2539
157 Ga0207687_10001985 3300025927 Bacteria 14055
158 Ga0207687_10086898 3300025927 Unclassified 2271
159 Ga0207700_10001115 3300025928 Bacteria 15449
160 Ga0207700_10006351 3300025928 Bacteria 7129
161 Ga0207664_10013881 3300025929 Bacteria 5802
162 Ga0207664_10023874 3300025929 Bacteria 4589
163 Ga0207686_10090142 3300025934 Bacteria 2022
164 Ga0207665_10107854 3300025939 Bacteria 1953
165 Ga0207691_10008524 3300025940 Bacteria 9848
166 Ga0207691_10053443 3300025940 Bacteria 3687
167 Ga0207711_10000007 3300025941 Bacteria 759410
168 Ga0207711_10000018 3300025941 Bacteria 431036
169 Ga0207711_10121117 3300025941 Bacteria 2336
170 Ga0207711_10190049 3300025941 Bacteria 1871
171 Ga0207661_10000005 3300025944 Bacteria 557888
172 Ga0207661_10113197 3300025944 Bacteria 2299
173 Ga0207667_10016371 3300025949 Bacteria 8382
174 Ga0207667_10047272 3300025949 Bacteria 4555
175 Ga0207667_10083151 3300025949 Bacteria 3315
176 Ga0207712_10001550 3300025961 Bacteria 15495
177 Ga0207640_10012177 3300025981 Bacteria 4892
178 Ga0207640_10072202 3300025981 Unclassified 2327
179 Ga0207658_10011843 3300025986 Bacteria 5943
180 Ga0207703_10039771 3300026035 Bacteria 3760
181 Ga0207703_10063581 3300026035 Bacteria 3026
182 Ga0207639_10016985 3300026041 Bacteria 5156
183 Ga0207708_10001236 3300026075 Bacteria 19268
184 Ga0207641_10003195 3300026088 Bacteria 14671
185 Ga0207648_10006305 3300026089 Bacteria 11796
186 Ga0207648_10106029 3300026089 Bacteria 2466
187 Ga0207676_10024822 3300026095 Bacteria 4440
188 Ga0207683_10154609 3300026121 Bacteria 2071
189 Ga0207683_10159445 3300026121 Bacteria 2039
190 Ga0207698_10031029 3300026142 Bacteria 3853
191 Ga0207428_10005563 3300027907 Bacteria 11733
192 Ga0207428_10028480 3300027907 Bacteria 4642
193 Ga0207428_10045928 3300027907 Unclassified 3514
194 Ga0268265_10057885 3300028380 Bacteria 2956
195 Ga0265338_10075595 3300028800 Bacteria 2857
196 Ga0265325_10000214 3300031241 Bacteria 41217
197 Ga0265339_10000717 3300031249 Bacteria 25744
198 Ga0265331_10000417 3300031250 Bacteria 43212
199 Ga0307408_100046105 3300031548 Bacteria 3117
200 Ga0265313_10001149 3300031595 Bacteria 25272
201 Ga0265313_10001248 3300031595 Bacteria 24233
202 Ga0265314_10004569 3300031711 Bacteria 12779
203 Ga0307416_100031001 3300032002 Bacteria 4020
204 Ga0373952_0013359 3300035092 Bacteria 1628
205 Ga0373955_0013180 3300035172 Bacteria 3989
206 Ga0373955_0025686 3300035172 Bacteria 3028
207 Ga0373931_0040898 3300035691 Bacteria 2434
208 Ga0373935_0012346 3300035692 Bacteria 5140
209 Ga0373935_0052767 3300035692 Bacteria 2586
210 Ga0373927_0001281 3300035695 Bacteria 19020
211 Ga0373927_0002611 3300035695 Bacteria 13131
212 Ga0373927_0020473 3300035695 Bacteria 4337
213 Ga0373933_0036184 3300035724 Bacteria 2888
214 Ga0373933_0040115 3300035724 Bacteria 2757
215 Ga0373947_0050640 3300035725 Bacteria 2497
216 Ga0373947_0080630 3300035725 Bacteria 2014
217 Ga0373937_0028129 3300036401 Bacteria 5087
218 Ga0373937_0034255 3300036401 Bacteria 4619
219 Ga0373937_0187831 3300036401 Bacteria 1941
220 Ga0373925_0026977 3300037068 Bacteria 4205
221 Ga0373925_0085291 3300037068 Bacteria 2408
222 Ga0373925_0217566 3300037068 Bacteria 1524
223 Ga0395900_0229218 3300037418 Bacteria 1869
224 Ga0395905_0039394 3300037471 Bacteria 4434
225 Ga0436364_0372048 3300037853 Bacteria 4659
226 Ga0436365_0764362 3300039437 Bacteria 1795
227 Ga0436362_0594531 3300039453 Bacteria 3972
228 Ga0436362_0634879 3300039453 Bacteria 1872
229 Ga0451577_0176177 3300042876 Bacteria 1928
230 Ga0451576_0013290 3300045051 Bacteria 9211
231 Ga0466967_0167132 3300045976 Bacteria 2068
232 Ga0495592_0028159 3300046454 Bacteria 4257
233 Ga0495651_0067721 3300046462 Bacteria 2723
234 Ga0495580_0001112 3300046472 Bacteria 23645
235 Ga0495580_0022346 3300046472 Bacteria 4656
236 Ga0495662_0005916 3300046476 Bacteria 6114
237 Ga0495664_0079191 3300046477 Bacteria 1969
238 Ga0495608_0128470 3300046511 Bacteria 1623
239 Ga0495630_0007771 3300046517 Bacteria 7678
240 Ga0495652_0051129 3300046529 Bacteria 3531
241 Ga0495652_0065243 3300046529 Unclassified 3060
242 Ga0495652_0163530 3300046529 Bacteria 1725
243 Ga0495665_0038217 3300046531 Bacteria 2560
244 Ga0495586_0081244 3300046535 Unclassified 1781
245 Ga0495587_0021989 3300046536 Unclassified 3931
246 Ga0495587_0033099 3300046536 Bacteria 3122
247 Ga0495645_0001096 3300046543 Bacteria 18350
248 Ga0495645_0004348 3300046543 Bacteria 9681
249 Ga0495645_0192003 3300046543 Bacteria 1391
250 Ga0495667_0044094 3300046559 Bacteria 2954
251 Ga0495667_0099343 3300046559 Unclassified 1884
252 Ga0495667_0123129 3300046559 Bacteria 1674
253 Ga0495634_0018246 3300046642 Bacteria 4997
254 Ga0495599_0028487 3300046678 Bacteria 3501
255 Ga0495599_0054450 3300046678 Unclassified 2506
256 Ga0495599_0071167 3300046678 Bacteria 2171
257 Ga0495623_0065550 3300046679 Bacteria 2271
258 Ga0495658_0052222 3300046683 Bacteria 2318
259 Ga0495658_0063355 3300046683 Bacteria 2127
260 Ga0495613_0009779 3300046689 Bacteria 7128
261 Ga0495613_0079204 3300046689 Bacteria 2389
262 Ga0495613_0191573 3300046689 Bacteria 1445
263 Ga0495604_0065497 3300047317 Bacteria 2766
264 Ga0495604_0067926 3300047317 Bacteria 2707
265 Ga0495674_0035470 3300047319 Bacteria 4500
266 Ga0495674_0045190 3300047319 Bacteria 3911
267 Ga0495674_0047915 3300047319 Bacteria 3785
268 Ga0495674_0057229 3300047319 Bacteria 3413
269 Ga0495674_0098526 3300047319 Bacteria 2489
270 Ga0495674_0144811 3300047319 Bacteria 1995
271 Ga0495684_0004785 3300047471 Bacteria 10568
272 Ga0495684_0007276 3300047471 Bacteria 8583
273 Ga0495684_0016570 3300047471 Bacteria 5677
274 Ga0495684_0063012 3300047471 Bacteria 2819
275 Ga0495684_0090350 3300047471 Bacteria 2320
276 Ga0495684_0092824 3300047471 Bacteria 2286
277 Ga0495686_0013945 3300047472 Bacteria 5557
278 Ga0496107_0019827 3300048910 Bacteria 4748
279 Ga0496110_0027285 3300048913 Bacteria 4894
280 Ga0501033_0082883 3300049570 Bacteria 2351
281 Ga0501046_0048820 3300049580 Bacteria 3350
282 Ga0501047_0089185 3300049581 Bacteria 2961
283 nmdc:mga05p37_192352_c1 3300050507 Bacteria 2476
284 nmdc:mga05p37_204743_c1 3300050507 Bacteria 2388
285 nmdc:mga05p37_3587_c1 3300050507 Bacteria 18127
286 nmdc:mga06r32_135144_c1 3300050510 Bacteria 2441
287 nmdc:mga06r32_265313_c1 3300050510 Bacteria 1704
288 nmdc:mga06r32_45682_c1 3300050510 Unclassified 4176
289 nmdc:mga08y16_106876_c1 3300050511 Unclassified 2913
290 nmdc:mga08y16_24506_c1 3300050511 Bacteria 6367
291 nmdc:mga08y16_2575_c1 3300050511 Bacteria 18645
292 nmdc:mga08y16_59336_c1 3300050511 Bacteria 3996
293 nmdc:mga0n895_9889_c1 3300050512 Bacteria 8389
294 nmdc:mga0rr50_45715_c1 3300050513 Bacteria 3220
295 nmdc:mga08x19_86417_c1 3300050514 Bacteria 2065
296 nmdc:mga0a205_146747_c1 3300050515 Bacteria 2259
297 nmdc:mga0a205_149455_c1 3300050515 Bacteria 2236
298 nmdc:mga0a205_62194_c1 3300050515 Bacteria 3607
299 Ga0495601_0105847 3300053077 Bacteria 1819
300 Ga0500595_005277 3300053119 Bacteria 5664
301 Ga0500568_0001506 3300053139 Bacteria 14867
302 Ga0501082_0000111 3300060353 Bacteria 64014
303 Ga0070666_10080371
304 rootH2_10056229
305 Ga0070658_10000120
306 Ga0070658_10000813
307 Ga0070658_10006513
308 Ga0070683_100000001
309 Ga0070683_100022782
310 Ga0070683_100163425
311 Ga0070670_100022609
312 Ga0070666_10064169
313 Ga0070680_100008702
314 Ga0068868_100112661
315 Ga0070660_100141987
316 Ga0070689_100121363
317 Ga0070689_100123779
318 Ga0070691_10002485
319 Ga0070674_100065360
320 Ga0070674_100078445
321 Ga0070674_100097896
322 Ga0070673_100138200
323 Ga0070688_100042203
324 Ga0070688_100107234
325 Ga0070667_100004355
326 Ga0070703_10000611
327 Ga0070709_10038004
328 Ga0070714_100002192
329 Ga0070714_100028669
330 Ga0070713_100005554
331 Ga0070713_100007517
332 Ga0070713_100014048
333 Ga0070701_10007686
334 Ga0070705_100067192
335 Ga0070700_100013470
336 Ga0070700_100023222
337 Ga0070694_100027620
338 Ga0070694_100180972
339 Ga0070681_10226537
340 Ga0068867_100075182
341 Ga0070698_100121329
342 Ga0070679_100024096
343 Ga0070684_100000006
344 Ga0070684_100039244
345 Ga0070686_100000142
346 Ga0070695_100017483
347 Ga0070695_100025781
348 Ga0070696_100014351
349 Ga0070696_100029557
350 Ga0070704_100026192
351 Ga0070704_100172202
352 Ga0068855_100011924
353 Ga0068855_100014926
354 Ga0068855_100049801
355 Ga0068855_100050872
356 Ga0068855_100134261
357 Ga0068854_100009758
358 Ga0068852_100006138
359 Ga0068859_100190354
360 Ga0068864_100022136
361 Ga0068861_100007508
362 Ga0068863_100014414
363 Ga0068863_100097646
364 Ga0068858_100012325
365 Ga0068858_100133996
366 Ga0068858_100230085
367 Ga0081455_10016653
368 Ga0081455_10019012
369 Ga0081539_10018532
370 Ga0070717_10010159
371 Ga0097621_100083572
372 Ga0075428_100001429
373 Ga0075428_100021654
374 Ga0075428_100070599
375 Ga0075430_100007076
376 Ga0075431_100023895
377 Ga0075431_100064321
378 Ga0075431_100116988
379 Ga0075431_100166434
380 Ga0075433_10117160
381 Ga0075434_100014182
382 Ga0075429_100165487
383 Ga0097620_100190351
384 Ga0075435_100004208
385 Ga0075435_100027890
386 Ga0075435_100127639
387 Ga0105240_10000689
388 Ga0105240_10002638
389 Ga0105240_10033574
390 Ga0105240_10123888
391 Ga0105240_10313341
392 Ga0111539_10007822
393 Ga0111539_10012090
394 Ga0111539_10062373
395 Ga0111539_10121392
396 Ga0105245_10007861
397 Ga0105245_10009490
398 Ga0114129_10002144
399 Ga0114129_10014933
400 Ga0114129_10036921
401 Ga0114129_10122303
402 Ga0114129_10296825
403 Ga0105241_10029433
404 Ga0105241_10029480
405 Ga0105242_10001331
406 Ga0105248_10000024
407 Ga0105248_10013707
408 Ga0105248_10032064
409 Ga0105248_10171369
410 Ga0105237_10017778
411 Ga0105237_10023401
412 Ga0105237_10033230
413 Ga0105237_10138787
414 Ga0105238_10000180
415 Ga0105238_10006812
416 Ga0105238_10039494
417 Ga0105249_10004732
418 Ga0105249_10025970
419 Ga0105239_10005550
420 Ga0105239_10065130
421 Ga0157370_10000386
422 Ga0157370_10047988
423 Ga0157369_10041647
424 Ga0157369_10192240
425 Ga0163162_10037742
426 Ga0163162_10117882
427 Ga0157372_10022664
428 Ga0157372_10087934
429 Ga0157372_10168525
430 Ga0157375_10104268
431 Ga0163163_10000077
432 Ga0163163_10012098
433 Ga0163163_10036912
434 Ga0163163_10194442
435 Ga0157380_10045586
436 Ga0157376_10014390
437 Ga0157376_10031783
438 Ga0207656_10038093
439 Ga0207699_10036519
440 Ga0207645_10007008
441 Ga0207705_10028821
442 Ga0207705_10033559
443 Ga0207707_10212075
444 Ga0207695_10001792
445 Ga0207695_10020343
446 Ga0207695_10066189
447 Ga0207695_10159589
448 Ga0207671_10033259
449 Ga0207671_10059140
450 Ga0207660_10015402
451 Ga0207660_10172501
452 Ga0207662_10044607
453 Ga0207657_10202835
454 Ga0207652_10030367
455 Ga0207681_10017093
456 Ga0207694_10005350
457 Ga0207694_10023925
458 Ga0207694_10081688
459 Ga0207687_10001985
460 Ga0207687_10086898
461 Ga0207700_10001115
462 Ga0207700_10006351
463 Ga0207664_10013881
464 Ga0207664_10023874
465 Ga0207686_10090142
466 Ga0207665_10107854
467 Ga0207691_10008524
468 Ga0207691_10053443
469 Ga0207711_10000007
470 Ga0207711_10000018
471 Ga0207711_10121117
472 Ga0207711_10190049
473 Ga0207661_10000005
474 Ga0207661_10113197
475 Ga0207667_10016371
476 Ga0207667_10047272
477 Ga0207667_10083151
478 Ga0207712_10001550
479 Ga0207640_10012177
480 Ga0207640_10072202
481 Ga0207658_10011843
482 Ga0207703_10039771
483 Ga0207703_10063581
484 Ga0207639_10016985
485 Ga0207708_10001236
486 Ga0207641_10003195
487 Ga0207648_10006305
488 Ga0207648_10106029
489 Ga0207676_10024822
490 Ga0207683_10154609
491 Ga0207683_10159445
492 Ga0207698_10031029
493 Ga0207428_10005563
494 Ga0207428_10028480
495 Ga0207428_10045928
496 Ga0268265_10057885
497 Ga0265338_10075595
498 Ga0265325_10000214
499 Ga0265339_10000717
500 Ga0265331_10000417
501 Ga0307408_100046105
502 Ga0265313_10001149
503 Ga0265313_10001248
504 Ga0265314_10004569
505 Ga0307416_100031001
506 Ga0373952_0013359
507 Ga0373955_0013180
508 Ga0373955_0025686
509 Ga0373931_0040898
510 Ga0373935_0012346
511 Ga0373935_0052767
512 Ga0373927_0001281
513 Ga0373927_0002611
514 Ga0373927_0020473
515 Ga0373933_0036184
516 Ga0373933_0040115
517 Ga0373947_0050640
518 Ga0373947_0080630
519 Ga0373937_0028129
520 Ga0373937_0034255
521 Ga0373937_0187831
522 Ga0373925_0026977
523 Ga0373925_0085291
524 Ga0373925_0217566
525 Ga0395900_0229218
526 Ga0395905_0039394
527 Ga0436364_0372048
528 Ga0436365_0764362
529 Ga0436362_0594531
530 Ga0436362_0634879
531 Ga0451577_0176177
532 Ga0451576_0013290
533 Ga0466967_0167132
534 Ga0495592_0028159
535 Ga0495651_0067721
536 Ga0495580_0001112
537 Ga0495580_0022346
538 Ga0495662_0005916
539 Ga0495664_0079191
540 Ga0495608_0128470
541 Ga0495630_0007771
542 Ga0495652_0051129
543 Ga0495652_0065243
544 Ga0495652_0163530
545 Ga0495665_0038217
546 Ga0495586_0081244
547 Ga0495587_0021989
548 Ga0495587_0033099
549 Ga0495645_0001096
550 Ga0495645_0004348
551 Ga0495645_0192003
552 Ga0495667_0044094
553 Ga0495667_0099343
554 Ga0495667_0123129
555 Ga0495634_0018246
556 Ga0495599_0028487
557 Ga0495599_0054450
558 Ga0495599_0071167
559 Ga0495623_0065550
560 Ga0495658_0052222
561 Ga0495658_0063355
562 Ga0495613_0009779
563 Ga0495613_0079204
564 Ga0495613_0191573
565 Ga0495604_0065497
566 Ga0495604_0067926
567 Ga0495674_0035470
568 Ga0495674_0045190
569 Ga0495674_0047915
570 Ga0495674_0057229
571 Ga0495674_0098526
572 Ga0495674_0144811
573 Ga0495684_0004785
574 Ga0495684_0007276
575 Ga0495684_0016570
576 Ga0495684_0063012
577 Ga0495684_0090350
578 Ga0495684_0092824
579 Ga0495686_0013945
580 Ga0496107_0019827
581 Ga0496110_0027285
582 Ga0501033_0082883
583 Ga0501046_0048820
584 Ga0501047_0089185
585 nmdc:mga05p37_192352_c1
586 nmdc:mga05p37_204743_c1
587 nmdc:mga05p37_3587_c1
588 nmdc:mga06r32_135144_c1
589 nmdc:mga06r32_265313_c1
590 nmdc:mga06r32_45682_c1
591 nmdc:mga08y16_106876_c1
592 nmdc:mga08y16_24506_c1
593 nmdc:mga08y16_2575_c1
594 nmdc:mga08y16_59336_c1
595 nmdc:mga0n895_9889_c1
596 nmdc:mga0rr50_45715_c1
597 nmdc:mga08x19_86417_c1
598 nmdc:mga0a205_146747_c1
599 nmdc:mga0a205_149455_c1
600 nmdc:mga0a205_62194_c1
601 Ga0495601_0105847
602 Ga0500595_005277
603 Ga0500568_0001506
604 Ga0501082_0000111

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07394

DUF1501

Protein of unknown function (DUF1501)

60

521

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6wet-assembly1.cif.gz_AaA crystal structures of human e-npp 1: apo 0.7742 306 380
4b56-assembly1.cif.gz_A structure of ectonucleotide pyrophosphatase-phosphodiesterase-1 (npp1) 0.7406 306 381
5lqq-assembly1.cif.gz_A structure of autotaxin (enpp2) with lm350 0.7404 308 381
4zg9-assembly2.cif.gz_B structural basis for inhibition of human autotaxin by four novel compounds 0.7401 308 381
7mfh-assembly1.cif.gz_A crystal structure of bio-32546 bound mouse autotaxin 0.7148 308 381
ID Description Score Start End Superfamily
5eghA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7164 305 451 3.40.720.10
af_P11532_570_675_1.20.58.60 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7125 236 286 1.20.58.60
5udyA01 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.7005 300 451 3.40.720.10
af_I1LEY9_46_222_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6682 307 331 3.40.50.300
af_Q6PGY9_139_533_3.40.720.10 Alpha Beta;3-Layer(aba) Sandwich;Alkaline Phosphatase, subunit A;Alkaline Phosphatase, subunit A 0.5986 306 447 3.40.720.10
ID Description Score Start End GO Terms
AF-A0A4Q3WPU6-F1-model_v4 DUF1501 domain-containing protein 0.9593 280 458
AF-A0A354P4E7-F1-model_v4 DUF1501 domain-containing protein 0.9402 273 480
AF-A0A354P4E7-F1-model_v4 DUF1501 domain-containing protein 0.9273 273 480
AF-A0A4Q3WPU6-F1-model_v4 DUF1501 domain-containing protein 0.9143 280 458
AF-A0A2E4MAY9-F1-model_v4 Sulfatase 0.8937 52 480

Map