F395938

General Info

Members Datasets Scaffolds Average Seq Length
301 187 301 207

Family's Representative Sequence

Representative Sequence 3300025321|Ga0207656_10230956|Ga0207656_102309562
Length 225
Sequence MTLYVPSHFRVEERARLVGFMREHAFATLISSADAGLHVSHVPLLVDLDGETIRLRGHVARGNAHWESLEVARDVTAIFHGPHAYVSPTWYAVHPSVPTWNYAVVHAHGKARLTDEAELHEIVTELSTKYEAGNVPPWKLSEQPAAYVSSMLGMIVGFEIEVAWVEGKFKLSQNRPVEIPRVVDRLEASGEAELASLMRRQASSLWVTTSTMRRAISVASPTGTR

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
138 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.99
Nodule 0
Rhizoplane 3.99
Rhizosphere 93.02
Stem 0
Stem Tuber 0
Unclassified 1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10098422 3300003323 Bacteria 13757
2 Ga0070658_10030313 3300005327 Bacteria 4346
3 Ga0070658_10124045 3300005327 Bacteria 2148
4 Ga0070658_10251636 3300005327 Bacteria 1499
5 Ga0070658_10479910 3300005327 Bacteria 1073
6 Ga0070676_10146674 3300005328 Bacteria 1507
7 Ga0070683_100316920 3300005329 Bacteria 1484
8 Ga0070683_100924408 3300005329 Bacteria 837
9 Ga0070690_100234064 3300005330 Bacteria 1293
10 Ga0070670_100278747 3300005331 Bacteria 1460
11 Ga0070680_100264716 3300005336 Bacteria 1455
12 Ga0070680_100408733 3300005336 Unclassified 1157
13 Ga0068868_100295902 3300005338 Bacteria 1374
14 Ga0070660_100703816 3300005339 Bacteria 847
15 Ga0070689_100001002 3300005340 Bacteria 17702
16 Ga0070689_100026879 3300005340 Bacteria 4336
17 Ga0070687_100053466 3300005343 Bacteria 2100
18 Ga0070661_100769906 3300005344 Bacteria 788
19 Ga0070692_10021950 3300005345 Bacteria 3112
20 Ga0070675_100023054 3300005354 Bacteria 4974
21 Ga0070671_100052685 3300005355 Bacteria 3383
22 Ga0070674_100040026 3300005356 Bacteria 3168
23 Ga0070673_100220310 3300005364 Bacteria 1642
24 Ga0070673_100463429 3300005364 Bacteria 1141
25 Ga0070688_100048014 3300005365 Bacteria 2651
26 Ga0070659_100051220 3300005366 Bacteria 3246
27 Ga0070659_100369742 3300005366 Bacteria 1206
28 Ga0070667_100997956 3300005367 Bacteria 781
29 Ga0070710_10261475 3300005437 Bacteria 1116
30 Ga0070701_10057424 3300005438 Bacteria 2040
31 Ga0070705_100061777 3300005440 Bacteria 2228
32 Ga0070705_100142970 3300005440 Bacteria 1577
33 Ga0070700_100104776 3300005441 Bacteria 1869
34 Ga0070694_100229112 3300005444 Bacteria 1397
35 Ga0070663_100181721 3300005455 Bacteria 1632
36 Ga0070678_100202356 3300005456 Bacteria 1640
37 Ga0070678_100370396 3300005456 Bacteria 1237
38 Ga0070681_10006268 3300005458 Bacteria 11569
39 Ga0070681_10012559 3300005458 Bacteria 8404
40 Ga0068867_100046276 3300005459 Bacteria 3195
41 Ga0068867_100122724 3300005459 Bacteria 2009
42 Ga0068867_100510260 3300005459 Bacteria 1035
43 Ga0068867_100661553 3300005459 Bacteria 917
44 Ga0070685_10119421 3300005466 Bacteria 1635
45 Ga0070707_100431117 3300005468 Bacteria 1279
46 Ga0070699_100231761 3300005518 Bacteria 1647
47 Ga0070684_100082167 3300005535 Bacteria 2852
48 Ga0068853_100005566 3300005539 Bacteria 9888
49 Ga0068853_100012898 3300005539 Bacteria 6811
50 Ga0068853_100248078 3300005539 Bacteria 1633
51 Ga0068853_100570391 3300005539 Bacteria 1073
52 Ga0070686_100017048 3300005544 Bacteria 4238
53 Ga0070686_100534413 3300005544 Bacteria 915
54 Ga0070695_100319800 3300005545 Bacteria 1153
55 Ga0070696_100035786 3300005546 Bacteria 3420
56 Ga0070696_100040502 3300005546 Bacteria 3217
57 Ga0070696_100065036 3300005546 Bacteria 2556
58 Ga0070696_100463108 3300005546 Bacteria 1002
59 Ga0070693_100015741 3300005547 Bacteria 3900
60 Ga0070693_100028240 3300005547 Bacteria 3049
61 Ga0070693_100069789 3300005547 Bacteria 2066
62 Ga0070704_100066179 3300005549 Bacteria 2605
63 Ga0070704_100102155 3300005549 Bacteria 2163
64 Ga0068855_100200930 3300005563 Bacteria 2244
65 Ga0068855_100298044 3300005563 Bacteria 1786
66 Ga0068855_100592127 3300005563 Bacteria 1197
67 Ga0068857_100023233 3300005577 Bacteria 5457
68 Ga0068857_100237822 3300005577 Bacteria 1667
69 Ga0068854_100474754 3300005578 Bacteria 1049
70 Ga0070702_100151119 3300005615 Bacteria 1491
71 Ga0070702_100398463 3300005615 Bacteria 984
72 Ga0068852_100000484 3300005616 Bacteria 26098
73 Ga0068852_100011110 3300005616 Bacteria 6762
74 Ga0068852_100012591 3300005616 Bacteria 6428
75 Ga0068852_100051741 3300005616 Bacteria 3527
76 Ga0068852_100406859 3300005616 Bacteria 1340
77 Ga0068859_100017464 3300005617 Bacteria 7213
78 Ga0068859_100127145 3300005617 Bacteria 2618
79 Ga0068859_100916274 3300005617 Bacteria 961
80 Ga0068864_100069778 3300005618 Bacteria 3056
81 Ga0068851_10001115 3300005834 Bacteria 11633
82 Ga0068870_10050405 3300005840 Bacteria 2200
83 Ga0068863_100070366 3300005841 Bacteria 3309
84 Ga0068863_100142641 3300005841 Bacteria 2290
85 Ga0068863_100282361 3300005841 Bacteria 1609
86 Ga0068858_100014709 3300005842 Bacteria 7366
87 Ga0068858_100061889 3300005842 Bacteria 3460
88 Ga0068858_100501783 3300005842 Bacteria 1172
89 Ga0068860_100760692 3300005843 Bacteria 981
90 Ga0075364_10187945 3300006051 Bacteria 1399
91 Ga0075432_10037973 3300006058 Bacteria 1677
92 Ga0075367_10059849 3300006178 Bacteria 2269
93 Ga0075366_10052981 3300006195 Bacteria 2410
94 Ga0097621_100038035 3300006237 Bacteria 3860
95 Ga0097621_100207572 3300006237 Bacteria 1703
96 Ga0097621_100411806 3300006237 Bacteria 1212
97 Ga0097621_100557775 3300006237 Bacteria 1043
98 Ga0097621_100967489 3300006237 Bacteria 795
99 Ga0068871_100027228 3300006358 Bacteria 4468
100 Ga0068871_100032101 3300006358 Bacteria 4145
101 Ga0068871_100117723 3300006358 Bacteria 2241
102 Ga0075433_10156683 3300006852 Bacteria 2026
103 Ga0068865_100085091 3300006881 Bacteria 2280
104 Ga0068865_100109404 3300006881 Bacteria 2036
105 Ga0097620_100017464 3300006931 Bacteria 7213
106 Ga0097620_100127137 3300006931 Bacteria 2618
107 Ga0097620_100916311 3300006931 Bacteria 961
108 Ga0105240_10019253 3300009093 Bacteria 9123
109 Ga0105240_10065089 3300009093 Bacteria 4526
110 Ga0111539_10577946 3300009094 Bacteria 1309
111 Ga0105245_10938033 3300009098 Bacteria 908
112 Ga0105245_11063902 3300009098 Bacteria 855
113 Ga0105245_11172059 3300009098 Unclassified 816
114 Ga0114129_10632951 3300009147 Bacteria 1382
115 Ga0105243_10203016 3300009148 Bacteria 1740
116 Ga0105243_10933094 3300009148 Bacteria 866
117 Ga0105241_10004571 3300009174 Bacteria 10239
118 Ga0105242_10001658 3300009176 Bacteria 17602
119 Ga0105242_10031399 3300009176 Bacteria 4242
120 Ga0105242_10040427 3300009176 Bacteria 3758
121 Ga0105242_10241229 3300009176 Bacteria 1625
122 Ga0105248_10005187 3300009177 Bacteria 14361
123 Ga0105248_10069333 3300009177 Bacteria 3959
124 Ga0105248_10099766 3300009177 Bacteria 3272
125 Ga0105248_10130703 3300009177 Bacteria 2833
126 Ga0105248_10384790 3300009177 Bacteria 1580
127 Ga0105238_10144017 3300009551 Bacteria 2360
128 Ga0105238_10239886 3300009551 Bacteria 1790
129 Ga0105238_10885436 3300009551 Bacteria 911
130 Ga0105249_10284171 3300009553 Bacteria 1654
131 Ga0105249_10317895 3300009553 Bacteria 1567
132 Ga0105249_10950615 3300009553 Bacteria 927
133 Ga0105239_10050315 3300010375 Bacteria 4571
134 Ga0105239_10997733 3300010375 Bacteria 963
135 Ga0157371_10712950 3300013102 Bacteria 752
136 Ga0157369_10008265 3300013105 Bacteria 11932
137 Ga0157369_10496034 3300013105 Bacteria 1263
138 Ga0157374_10673028 3300013296 Unclassified 1047
139 Ga0157378_10051669 3300013297 Bacteria 3657
140 Ga0157378_10574870 3300013297 Bacteria 1135
141 Ga0163162_10863937 3300013306 Bacteria 1019
142 Ga0157372_10007476 3300013307 Bacteria 11619
143 Ga0157372_10264488 3300013307 Bacteria 1997
144 Ga0157372_11046454 3300013307 Bacteria 945
145 Ga0157375_10186620 3300013308 Bacteria 2227
146 Ga0163163_10388798 3300014325 Bacteria 1453
147 Ga0163163_10685234 3300014325 Bacteria 1088
148 Ga0157380_10649355 3300014326 Bacteria 1052
149 Ga0157380_10820496 3300014326 Bacteria 949
150 Ga0157377_10017058 3300014745 Bacteria 3751
151 Ga0157379_10002873 3300014968 Bacteria 14522
152 Ga0157379_10271267 3300014968 Bacteria 1543
153 Ga0157376_10128920 3300014969 Bacteria 2254
154 Ga0213876_10063155 3300021384 Bacteria 1955
155 Ga0207656_10001284 3300025321 Bacteria 8249
156 Ga0207656_10230956 3300025321 Bacteria 902
157 Ga0207688_10090162 3300025901 Bacteria 1759
158 Ga0207645_10191611 3300025907 Bacteria 1344
159 Ga0207643_10009570 3300025908 Bacteria 5206
160 Ga0207705_10113521 3300025909 Bacteria 2004
161 Ga0207705_10174700 3300025909 Bacteria 1619
162 Ga0207705_10190072 3300025909 Bacteria 1552
163 Ga0207684_10778562 3300025910 Unclassified 810
164 Ga0207707_10027772 3300025912 Bacteria 4947
165 Ga0207707_10048646 3300025912 Bacteria 3693
166 Ga0207695_10037818 3300025913 Bacteria 5204
167 Ga0207695_10086080 3300025913 Bacteria 3170
168 Ga0207695_10551461 3300025913 Bacteria 1034
169 Ga0207660_10073239 3300025917 Bacteria 2497
170 Ga0207662_10068988 3300025918 Bacteria 2136
171 Ga0207662_10258633 3300025918 Bacteria 1145
172 Ga0207662_10434329 3300025918 Bacteria 896
173 Ga0207649_10158856 3300025920 Bacteria 1565
174 Ga0207649_10649449 3300025920 Bacteria 815
175 Ga0207652_10123731 3300025921 Bacteria 2303
176 Ga0207646_10428425 3300025922 Bacteria 1194
177 Ga0207681_10478582 3300025923 Bacteria 1017
178 Ga0207681_10560559 3300025923 Bacteria 941
179 Ga0207694_10070723 3300025924 Bacteria 2727
180 Ga0207694_10162740 3300025924 Bacteria 1803
181 Ga0207694_10180248 3300025924 Bacteria 1713
182 Ga0207694_10611746 3300025924 Bacteria 917
183 Ga0207659_10009172 3300025926 Bacteria 6178
184 Ga0207687_10306994 3300025927 Bacteria 1280
185 Ga0207687_10428967 3300025927 Bacteria 1092
186 Ga0207687_10551307 3300025927 Bacteria 967
187 Ga0207664_10433281 3300025929 Bacteria 1172
188 Ga0207644_10110781 3300025931 Bacteria 2075
189 Ga0207690_10017119 3300025932 Bacteria 4421
190 Ga0207686_10005916 3300025934 Bacteria 6567
191 Ga0207686_10008534 3300025934 Bacteria 5535
192 Ga0207686_10073626 3300025934 Bacteria 2204
193 Ga0207709_10153051 3300025935 Bacteria 1600
194 Ga0207709_10596073 3300025935 Bacteria 874
195 Ga0207670_10023382 3300025936 Bacteria 3847
196 Ga0207670_10034586 3300025936 Bacteria 3267
197 Ga0207670_10434277 3300025936 Bacteria 1056
198 Ga0207704_10012144 3300025938 Bacteria 4267
199 Ga0207704_10041199 3300025938 Bacteria 2706
200 Ga0207691_10008832 3300025940 Bacteria 9669
201 Ga0207711_10013415 3300025941 Bacteria 6807
202 Ga0207711_10166919 3300025941 Bacteria 1995
203 Ga0207689_10046778 3300025942 Bacteria 3575
204 Ga0207689_10446831 3300025942 Unclassified 1080
205 Ga0207667_10019494 3300025949 Bacteria 7569
206 Ga0207667_10617811 3300025949 Bacteria 1092
207 Ga0207651_10442977 3300025960 Bacteria 1113
208 Ga0207651_10485266 3300025960 Bacteria 1066
209 Ga0207677_10191299 3300026023 Bacteria 1619
210 Ga0207703_10014163 3300026035 Bacteria 6219
211 Ga0207703_10316452 3300026035 Bacteria 1428
212 Ga0207703_10615556 3300026035 Bacteria 1028
213 Ga0207639_10005193 3300026041 Bacteria 8785
214 Ga0207639_10014767 3300026041 Bacteria 5502
215 Ga0207639_10520102 3300026041 Bacteria 1090
216 Ga0207678_10519429 3300026067 Bacteria 1039
217 Ga0207708_10111631 3300026075 Bacteria 2122
218 Ga0207708_10143107 3300026075 Bacteria 1877
219 Ga0207708_10204073 3300026075 Bacteria 1578
220 Ga0207641_10025176 3300026088 Bacteria 4907
221 Ga0207641_10598298 3300026088 Bacteria 1079
222 Ga0207648_10014180 3300026089 Bacteria 7370
223 Ga0207648_10086956 3300026089 Bacteria 2728
224 Ga0207648_10418613 3300026089 Bacteria 1216
225 Ga0207676_10056113 3300026095 Bacteria 3095
226 Ga0207674_10032783 3300026116 Bacteria 5445
227 Ga0207674_10160426 3300026116 Bacteria 2203
228 Ga0207675_100317863 3300026118 Bacteria 1520
229 Ga0207675_100520283 3300026118 Bacteria 1186
230 Ga0207683_10053724 3300026121 Bacteria 3532
231 Ga0207683_10189783 3300026121 Bacteria 1865
232 Ga0207683_10478541 3300026121 Bacteria 1149
233 Ga0207698_10008064 3300026142 Bacteria 6641
234 Ga0268265_10503420 3300028380 Bacteria 1142
235 Ga0268264_10669073 3300028381 Bacteria 1029
236 Ga0268264_10925059 3300028381 Bacteria 876
237 Ga0265332_10232193 3300031238 Bacteria 764
238 Ga0307408_100157304 3300031548 Bacteria 1801
239 Ga0265314_10017890 3300031711 Bacteria 5549
240 Ga0307405_10153349 3300031731 Bacteria 1623
241 Ga0307405_10386600 3300031731 Unclassified 1091
242 Ga0307406_10739622 3300031901 Bacteria 825
243 Ga0307409_100397062 3300031995 Bacteria 1316
244 Ga0307416_100052866 3300032002 Bacteria 3255
245 Ga0373956_0074945 3300035119 Bacteria 1547
246 Ga0373931_0474734 3300035691 Bacteria 803
247 Ga0373927_0128006 3300035695 Bacteria 1658
248 Ga0373937_0166695 3300036401 Bacteria 2066
249 Ga0395899_0145709 3300037312 Bacteria 1682
250 Ga0395898_0620122 3300037466 Bacteria 1024
251 Ga0395905_0068916 3300037471 Bacteria 3313
252 Ga0395901_0326571 3300038443 Unclassified 1587
253 Ga0436365_1337187 3300039437 Bacteria 9802
254 Ga0466961_0466001 3300044693 Bacteria 764
255 Ga0466963_0638053 3300044694 Bacteria 752
256 Ga0466957_0003806 3300044842 Bacteria 8339
257 Ga0495618_0329280 3300046514 Unclassified 945
258 Ga0495598_0016772 3300046537 Bacteria 1876
259 Ga0495621_0002227 3300046539 Bacteria 5183
260 Ga0495645_0001930 3300046543 Bacteria 14080
261 Ga0495667_0014114 3300046559 Bacteria 5392
262 Ga0495635_0032421 3300046663 Bacteria 3625
263 Ga0495599_0012523 3300046678 Bacteria 5232
264 Ga0495623_0013457 3300046679 Bacteria 5305
265 Ga0495658_0139486 3300046683 Bacteria 1482
266 Ga0495600_0083218 3300046809 Bacteria 2089
267 Ga0495675_0230451 3300047444 Bacteria 1118
268 Ga0495684_0058067 3300047471 Bacteria 2948
269 Ga0496100_0545310 3300048903 Bacteria 897
270 Ga0496102_1540425 3300048905 Bacteria 583
271 Ga0496104_0015911 3300048907 Bacteria 6827
272 Ga0496104_0644938 3300048907 Bacteria 968
273 Ga0496104_0946294 3300048907 Bacteria 766
274 Ga0496105_0119650 3300048908 Bacteria 2172
275 Ga0496109_0235949 3300048912 Bacteria 1721
276 Ga0496110_0441964 3300048913 Bacteria 1185
277 Ga0496111_0059390 3300048914 Bacteria 2771
278 Ga0496112_0014001 3300048915 Bacteria 7423
279 Ga0496113_0019719 3300048916 Bacteria 4725
280 Ga0496114_0572532 3300048917 Bacteria 997
281 Ga0501032_0058792 3300049569 Bacteria 2581
282 Ga0501037_0117019 3300049573 Bacteria 1918
283 Ga0501043_0226729 3300049579 Bacteria 1444
284 Ga0501068_0001055 3300049584 Bacteria 14604
285 Ga0501070_0003078 3300049586 Bacteria 14519
286 Ga0501073_0003022 3300049589 Bacteria 12609
287 Ga0501074_0019604 3300049590 Bacteria 4909
288 Ga0501079_0512296 3300049741 Bacteria 943
289 Ga0501080_0012613 3300049742 Bacteria 7749
290 Ga0501080_0247426 3300049742 Bacteria 1626
291 Ga0501080_0280341 3300049742 Bacteria 1515
292 Ga0501081_0324446 3300049743 Bacteria 1132
293 Ga0501083_0033393 3300049744 Bacteria 3524
294 Ga0501035_0478225 3300049822 Bacteria 1028
295 nmdc:mga00v17_93030_c1 3300050491 Bacteria 1895
296 nmdc:mga0k408_429668_c1 3300050493 Bacteria 785
297 nmdc:mga07m45_230557_c1 3300050496 Bacteria 1077
298 nmdc:mga05p37_534447_c1 3300050507 Bacteria 1338
299 Ga0495601_0104693 3300053077 Bacteria 1829
300 Ga0495619_0146675 3300053085 Bacteria 1627
301 Ga0501084_0101114 3300054114 Bacteria 2421

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_429668_c1 nmdc:mga0k408_429668_c1_22_537 166
2 3300048905 Ga0496102_1540425 Ga0496102_1540425_22_573 178
3 3300009553 Ga0105249_10950615 Ga0105249_109506152 185
4 3300046539 Ga0495621_0002227 Ga0495621_0002227_580_1173 193
5 3300005355 Ga0070671_100052685 Ga0070671_1000526853 196
6 3300005618 Ga0068864_100069778 Ga0068864_1000697783 196
7 3300009177 Ga0105248_10069333 Ga0105248_100693334 196
8 3300025931 Ga0207644_10110781 Ga0207644_101107811 196
9 3300025941 Ga0207711_10013415 Ga0207711_100134157 196
10 3300026095 Ga0207676_10056113 Ga0207676_100561133 196
11 3300048903 Ga0496100_0545310 Ga0496100_0545310_89_709 196
12 3300048907 Ga0496104_0644938 Ga0496104_0644938_307_927 196
13 3300048915 Ga0496112_0014001 Ga0496112_0014001_198_818 196
14 3300048916 Ga0496113_0019719 Ga0496113_0019719_4018_4638 196
15 3300005327 Ga0070658_10251636 Ga0070658_102516363 197
16 3300005328 Ga0070676_10146674 Ga0070676_101466743 197
17 3300005329 Ga0070683_100924408 Ga0070683_1009244082 197
18 3300005331 Ga0070670_100278747 Ga0070670_1002787472 197
19 3300005340 Ga0070689_100001002 Ga0070689_1000010028 197
20 3300005354 Ga0070675_100023054 Ga0070675_1000230545 197
21 3300005365 Ga0070688_100048014 Ga0070688_1000480142 197
22 3300005456 Ga0070678_100202356 Ga0070678_1002023561 197
23 3300005577 Ga0068857_100237822 Ga0068857_1002378221 197
24 3300005615 Ga0070702_100151119 Ga0070702_1001511192 197
25 3300005840 Ga0068870_10050405 Ga0068870_100504053 197
26 3300013308 Ga0157375_10186620 Ga0157375_101866202 197
27 3300014745 Ga0157377_10017058 Ga0157377_100170584 197
28 3300025907 Ga0207645_10191611 Ga0207645_101916112 197
29 3300025908 Ga0207643_10009570 Ga0207643_100095702 197
30 3300025923 Ga0207681_10560559 Ga0207681_105605592 197
31 3300025926 Ga0207659_10009172 Ga0207659_100091725 197
32 3300025936 Ga0207670_10023382 Ga0207670_100233823 197
33 3300025940 Ga0207691_10008832 Ga0207691_100088325 197
34 3300025942 Ga0207689_10446831 Ga0207689_104468312 197
35 3300026075 Ga0207708_10143107 Ga0207708_101431072 197
36 3300026121 Ga0207683_10189783 Ga0207683_101897833 197
37 3300026121 Ga0207683_10478541 Ga0207683_104785412 197
38 3300005547 Ga0070693_100069789 Ga0070693_1000697892 198
39 3300005616 Ga0068852_100012591 Ga0068852_1000125916 198
40 3300025918 Ga0207662_10258633 Ga0207662_102586332 198
41 3300038443 Ga0395901_0326571 Ga0395901_0326571_154_771 198
42 3300005344 Ga0070661_100769906 Ga0070661_1007699061 199
43 3300005459 Ga0068867_100510260 Ga0068867_1005102601 199
44 3300005547 Ga0070693_100015741 Ga0070693_1000157412 199
45 3300005563 Ga0068855_100592127 Ga0068855_1005921272 199
46 3300009551 Ga0105238_10239886 Ga0105238_102398862 199
47 3300013307 Ga0157372_10264488 Ga0157372_102644882 199
48 3300025913 Ga0207695_10551461 Ga0207695_105514611 199
49 3300025920 Ga0207649_10649449 Ga0207649_106494492 199
50 3300025924 Ga0207694_10162740 Ga0207694_101627403 199
51 3300025949 Ga0207667_10617811 Ga0207667_106178112 199
52 3300026089 Ga0207648_10418613 Ga0207648_104186132 199
53 3300050496 nmdc:mga07m45_230557_c1 nmdc:mga07m45_230557_c1_174_794 199
54 3300005327 Ga0070658_10479910 Ga0070658_104799102 200
55 3300005338 Ga0068868_100295902 Ga0068868_1002959022 200
56 3300005340 Ga0070689_100026879 Ga0070689_1000268792 200
57 3300005343 Ga0070687_100053466 Ga0070687_1000534663 200
58 3300005356 Ga0070674_100040026 Ga0070674_1000400262 200
59 3300005364 Ga0070673_100220310 Ga0070673_1002203102 200
60 3300005364 Ga0070673_100463429 Ga0070673_1004634292 200
61 3300005366 Ga0070659_100369742 Ga0070659_1003697422 200
62 3300005437 Ga0070710_10261475 Ga0070710_102614752 200
63 3300005456 Ga0070678_100370396 Ga0070678_1003703962 200
64 3300005458 Ga0070681_10006268 Ga0070681_100062684 200
65 3300005459 Ga0068867_100122724 Ga0068867_1001227242 200
66 3300005459 Ga0068867_100661553 Ga0068867_1006615532 200
67 3300005539 Ga0068853_100248078 Ga0068853_1002480782 200
68 3300005544 Ga0070686_100534413 Ga0070686_1005344132 200
69 3300005546 Ga0070696_100035786 Ga0070696_1000357862 200
70 3300005547 Ga0070693_100028240 Ga0070693_1000282402 200
71 3300005615 Ga0070702_100398463 Ga0070702_1003984632 200
72 3300005616 Ga0068852_100406859 Ga0068852_1004068592 200
73 3300005617 Ga0068859_100017464 Ga0068859_1000174645 200
74 3300005617 Ga0068859_100916274 Ga0068859_1009162742 200
75 3300005841 Ga0068863_100070366 Ga0068863_1000703663 200
76 3300005841 Ga0068863_100142641 Ga0068863_1001426413 200
77 3300005842 Ga0068858_100014709 Ga0068858_1000147096 200
78 3300006051 Ga0075364_10187945 Ga0075364_101879452 200
79 3300006058 Ga0075432_10037973 Ga0075432_100379733 200
80 3300006178 Ga0075367_10059849 Ga0075367_100598492 200
81 3300006195 Ga0075366_10052981 Ga0075366_100529812 200
82 3300006237 Ga0097621_100038035 Ga0097621_1000380354 200
83 3300006237 Ga0097621_100411806 Ga0097621_1004118061 200
84 3300006358 Ga0068871_100027228 Ga0068871_1000272282 200
85 3300006358 Ga0068871_100117723 Ga0068871_1001177232 200
86 3300006852 Ga0075433_10156683 Ga0075433_101566832 200
87 3300006881 Ga0068865_100085091 Ga0068865_1000850912 200
88 3300006931 Ga0097620_100017464 Ga0097620_1000174645 200
89 3300006931 Ga0097620_100916311 Ga0097620_1009163112 200
90 3300009098 Ga0105245_10938033 Ga0105245_109380332 200
91 3300009098 Ga0105245_11172059 Ga0105245_111720592 200
92 3300009147 Ga0114129_10632951 Ga0114129_106329512 200
93 3300009148 Ga0105243_10933094 Ga0105243_109330941 200
94 3300009176 Ga0105242_10001658 Ga0105242_100016588 200
95 3300009176 Ga0105242_10040427 Ga0105242_100404274 200
96 3300009177 Ga0105248_10005187 Ga0105248_1000518714 200
97 3300009177 Ga0105248_10099766 Ga0105248_100997663 200
98 3300009551 Ga0105238_10885436 Ga0105238_108854362 200
99 3300010375 Ga0105239_10997733 Ga0105239_109977332 200
100 3300013296 Ga0157374_10673028 Ga0157374_106730282 200
101 3300013297 Ga0157378_10051669 Ga0157378_100516693 200
102 3300013306 Ga0163162_10863937 Ga0163162_108639371 200
103 3300014325 Ga0163163_10685234 Ga0163163_106852341 200
104 3300014968 Ga0157379_10002873 Ga0157379_1000287310 200
105 3300014969 Ga0157376_10128920 Ga0157376_101289202 200
106 3300025321 Ga0207656_10230956 Ga0207656_102309562 200
107 3300025901 Ga0207688_10090162 Ga0207688_100901622 200
108 3300025909 Ga0207705_10174700 Ga0207705_101747002 200
109 3300025912 Ga0207707_10048646 Ga0207707_100486463 200
110 3300025917 Ga0207660_10073239 Ga0207660_100732393 200
111 3300025918 Ga0207662_10068988 Ga0207662_100689883 200
112 3300025923 Ga0207681_10478582 Ga0207681_104785822 200
113 3300025924 Ga0207694_10180248 Ga0207694_101802482 200
114 3300025927 Ga0207687_10306994 Ga0207687_103069942 200
115 3300025927 Ga0207687_10551307 Ga0207687_105513072 200
116 3300025929 Ga0207664_10433281 Ga0207664_104332812 200
117 3300025934 Ga0207686_10005916 Ga0207686_100059164 200
118 3300025934 Ga0207686_10008534 Ga0207686_100085345 200
119 3300025935 Ga0207709_10596073 Ga0207709_105960731 200
120 3300025936 Ga0207670_10034586 Ga0207670_100345862 200
121 3300025936 Ga0207670_10434277 Ga0207670_104342771 200
122 3300025938 Ga0207704_10012144 Ga0207704_100121443 200
123 3300025941 Ga0207711_10166919 Ga0207711_101669192 200
124 3300025942 Ga0207689_10046778 Ga0207689_100467783 200
125 3300025960 Ga0207651_10442977 Ga0207651_104429772 200
126 3300025960 Ga0207651_10485266 Ga0207651_104852662 200
127 3300026023 Ga0207677_10191299 Ga0207677_101912992 200
128 3300026035 Ga0207703_10014163 Ga0207703_100141636 200
129 3300026075 Ga0207708_10204073 Ga0207708_102040732 200
130 3300026088 Ga0207641_10025176 Ga0207641_100251761 200
131 3300026089 Ga0207648_10086956 Ga0207648_100869562 200
132 3300026116 Ga0207674_10160426 Ga0207674_101604263 200
133 3300026118 Ga0207675_100317863 Ga0207675_1003178632 200
134 3300026121 Ga0207683_10053724 Ga0207683_100537242 200
135 3300028380 Ga0268265_10503420 Ga0268265_105034202 200
136 3300028381 Ga0268264_10925059 Ga0268264_109250592 200
137 3300031731 Ga0307405_10386600 Ga0307405_103866002 200
138 3300035691 Ga0373931_0474734 Ga0373931_0474734_28_648 200
139 3300046514 Ga0495618_0329280 Ga0495618_0329280_132_767 200
140 3300046537 Ga0495598_0016772 Ga0495598_0016772_1107_1727 200
141 3300046543 Ga0495645_0001930 Ga0495645_0001930_7549_8184 200
142 3300046559 Ga0495667_0014114 Ga0495667_0014114_2048_2683 200
143 3300046663 Ga0495635_0032421 Ga0495635_0032421_1767_2402 200
144 3300046678 Ga0495599_0012523 Ga0495599_0012523_1888_2523 200
145 3300046679 Ga0495623_0013457 Ga0495623_0013457_1998_2633 200
146 3300046809 Ga0495600_0083218 Ga0495600_0083218_229_864 200
147 3300047471 Ga0495684_0058067 Ga0495684_0058067_1355_1990 200
148 3300050491 nmdc:mga00v17_93030_c1 nmdc:mga00v17_93030_c1_719_1342 200
149 3300050507 nmdc:mga05p37_534447_c1 nmdc:mga05p37_534447_c1_684_1319 200
150 3300053077 Ga0495601_0104693 Ga0495601_0104693_58_693 200
151 3300053085 Ga0495619_0146675 Ga0495619_0146675_229_864 200
152 3300005327 Ga0070658_10030313 Ga0070658_100303133 201
153 3300005327 Ga0070658_10124045 Ga0070658_101240452 201
154 3300005329 Ga0070683_100316920 Ga0070683_1003169202 201
155 3300005336 Ga0070680_100264716 Ga0070680_1002647162 201
156 3300005339 Ga0070660_100703816 Ga0070660_1007038162 201
157 3300005366 Ga0070659_100051220 Ga0070659_1000512204 201
158 3300005440 Ga0070705_100061777 Ga0070705_1000617773 201
159 3300005440 Ga0070705_100142970 Ga0070705_1001429702 201
160 3300005468 Ga0070707_100431117 Ga0070707_1004311172 201
161 3300005518 Ga0070699_100231761 Ga0070699_1002317612 201
162 3300005535 Ga0070684_100082167 Ga0070684_1000821672 201
163 3300005539 Ga0068853_100012898 Ga0068853_1000128986 201
164 3300005546 Ga0070696_100040502 Ga0070696_1000405022 201
165 3300005549 Ga0070704_100066179 Ga0070704_1000661793 201
166 3300005563 Ga0068855_100200930 Ga0068855_1002009302 201
167 3300005578 Ga0068854_100474754 Ga0068854_1004747542 201
168 3300005616 Ga0068852_100000484 Ga0068852_10000048420 201
169 3300005616 Ga0068852_100011110 Ga0068852_1000111103 201
170 3300005616 Ga0068852_100051741 Ga0068852_1000517414 201
171 3300005834 Ga0068851_10001115 Ga0068851_100011153 201
172 3300006237 Ga0097621_100207572 Ga0097621_1002075722 201
173 3300006237 Ga0097621_100967489 Ga0097621_1009674892 201
174 3300006358 Ga0068871_100032101 Ga0068871_1000321014 201
175 3300009093 Ga0105240_10019253 Ga0105240_100192532 201
176 3300009093 Ga0105240_10065089 Ga0105240_100650894 201
177 3300009094 Ga0111539_10577946 Ga0111539_105779462 201
178 3300009098 Ga0105245_11063902 Ga0105245_110639021 201
179 3300009176 Ga0105242_10031399 Ga0105242_100313994 201
180 3300009177 Ga0105248_10130703 Ga0105248_101307033 201
181 3300009551 Ga0105238_10144017 Ga0105238_101440172 201
182 3300009553 Ga0105249_10284171 Ga0105249_102841712 201
183 3300013102 Ga0157371_10712950 Ga0157371_107129502 201
184 3300013105 Ga0157369_10008265 Ga0157369_100082654 201
185 3300013105 Ga0157369_10496034 Ga0157369_104960342 201
186 3300013297 Ga0157378_10574870 Ga0157378_105748702 201
187 3300013307 Ga0157372_10007476 Ga0157372_100074769 201
188 3300014326 Ga0157380_10820496 Ga0157380_108204962 201
189 3300021384 Ga0213876_10063155 Ga0213876_100631552 201
190 3300025321 Ga0207656_10001284 Ga0207656_100012844 201
191 3300025909 Ga0207705_10113521 Ga0207705_101135212 201
192 3300025909 Ga0207705_10190072 Ga0207705_101900721 201
193 3300025913 Ga0207695_10037818 Ga0207695_100378184 201
194 3300025913 Ga0207695_10086080 Ga0207695_100860804 201
195 3300025920 Ga0207649_10158856 Ga0207649_101588562 201
196 3300025921 Ga0207652_10123731 Ga0207652_101237313 201
197 3300025924 Ga0207694_10070723 Ga0207694_100707232 201
198 3300025924 Ga0207694_10611746 Ga0207694_106117462 201
199 3300025932 Ga0207690_10017119 Ga0207690_100171193 201
200 3300025949 Ga0207667_10019494 Ga0207667_100194943 201
201 3300026041 Ga0207639_10014767 Ga0207639_100147672 201
202 3300026142 Ga0207698_10008064 Ga0207698_100080645 201
203 3300031238 Ga0265332_10232193 Ga0265332_102321931 201
204 3300031548 Ga0307408_100157304 Ga0307408_1001573042 201
205 3300031711 Ga0265314_10017890 Ga0265314_100178904 201
206 3300031731 Ga0307405_10153349 Ga0307405_101533493 201
207 3300031901 Ga0307406_10739622 Ga0307406_107396221 201
208 3300031995 Ga0307409_100397062 Ga0307409_1003970622 201
209 3300032002 Ga0307416_100052866 Ga0307416_1000528662 201
210 3300037312 Ga0395899_0145709 Ga0395899_0145709_493_1122 201
211 3300037466 Ga0395898_0620122 Ga0395898_0620122_179_808 201
212 3300037471 Ga0395905_0068916 Ga0395905_0068916_253_882 201
213 3300039437 Ga0436365_1337187 Ga0436365_1337187_1636_2262 201
214 3300044693 Ga0466961_0466001 Ga0466961_0466001_67_696 201
215 3300044842 Ga0466957_0003806 Ga0466957_0003806_38_667 201
216 3300046683 Ga0495658_0139486 Ga0495658_0139486_399_1022 201
217 3300047444 Ga0495675_0230451 Ga0495675_0230451_238_867 201
218 3300048907 Ga0496104_0015911 Ga0496104_0015911_926_1564 201
219 3300048908 Ga0496105_0119650 Ga0496105_0119650_840_1478 201
220 3300048912 Ga0496109_0235949 Ga0496109_0235949_293_931 201
221 3300048913 Ga0496110_0441964 Ga0496110_0441964_21_659 201
222 3300048914 Ga0496111_0059390 Ga0496111_0059390_1150_1788 201
223 3300005330 Ga0070690_100234064 Ga0070690_1002340642 202
224 3300005336 Ga0070680_100408733 Ga0070680_1004087331 202
225 3300005345 Ga0070692_10021950 Ga0070692_100219502 202
226 3300005438 Ga0070701_10057424 Ga0070701_100574243 202
227 3300005441 Ga0070700_100104776 Ga0070700_1001047762 202
228 3300005444 Ga0070694_100229112 Ga0070694_1002291122 202
229 3300005459 Ga0068867_100046276 Ga0068867_1000462764 202
230 3300005466 Ga0070685_10119421 Ga0070685_101194213 202
231 3300005539 Ga0068853_100570391 Ga0068853_1005703912 202
232 3300005544 Ga0070686_100017048 Ga0070686_1000170483 202
233 3300005546 Ga0070696_100065036 Ga0070696_1000650362 202
234 3300005546 Ga0070696_100463108 Ga0070696_1004631081 202
235 3300005549 Ga0070704_100102155 Ga0070704_1001021553 202
236 3300005617 Ga0068859_100127145 Ga0068859_1001271452 202
237 3300005841 Ga0068863_100282361 Ga0068863_1002823611 202
238 3300005842 Ga0068858_100061889 Ga0068858_1000618894 202
239 3300005843 Ga0068860_100760692 Ga0068860_1007606922 202
240 3300006881 Ga0068865_100109404 Ga0068865_1001094042 202
241 3300006931 Ga0097620_100127137 Ga0097620_1001271373 202
242 3300009148 Ga0105243_10203016 Ga0105243_102030163 202
243 3300009176 Ga0105242_10241229 Ga0105242_102412292 202
244 3300009553 Ga0105249_10317895 Ga0105249_103178952 202
245 3300014325 Ga0163163_10388798 Ga0163163_103887981 202
246 3300014326 Ga0157380_10649355 Ga0157380_106493551 202
247 3300014968 Ga0157379_10271267 Ga0157379_102712672 202
248 3300025918 Ga0207662_10434329 Ga0207662_104343292 202
249 3300025922 Ga0207646_10428425 Ga0207646_104284252 202
250 3300025927 Ga0207687_10428967 Ga0207687_104289672 202
251 3300025934 Ga0207686_10073626 Ga0207686_100736262 202
252 3300025935 Ga0207709_10153051 Ga0207709_101530512 202
253 3300025938 Ga0207704_10041199 Ga0207704_100411992 202
254 3300026035 Ga0207703_10316452 Ga0207703_103164522 202
255 3300026041 Ga0207639_10520102 Ga0207639_105201022 202
256 3300026075 Ga0207708_10111631 Ga0207708_101116312 202
257 3300026088 Ga0207641_10598298 Ga0207641_105982982 202
258 3300026089 Ga0207648_10014180 Ga0207648_100141806 202
259 3300026118 Ga0207675_100520283 Ga0207675_1005202832 202
260 3300028381 Ga0268264_10669073 Ga0268264_106690732 202
261 3300035695 Ga0373927_0128006 Ga0373927_0128006_883_1509 202
262 3300036401 Ga0373937_0166695 Ga0373937_0166695_1184_1813 202
263 3300044694 Ga0466963_0638053 Ga0466963_0638053_105_725 202
264 3300049569 Ga0501032_0058792 Ga0501032_0058792_1497_2117 202
265 3300049573 Ga0501037_0117019 Ga0501037_0117019_982_1602 202
266 3300049579 Ga0501043_0226729 Ga0501043_0226729_501_1121 202
267 3300049584 Ga0501068_0001055 Ga0501068_0001055_3830_4450 202
268 3300049586 Ga0501070_0003078 Ga0501070_0003078_7703_8323 202
269 3300049589 Ga0501073_0003022 Ga0501073_0003022_5063_5683 202
270 3300049590 Ga0501074_0019604 Ga0501074_0019604_2348_2968 202
271 3300049741 Ga0501079_0512296 Ga0501079_0512296_17_637 202
272 3300049742 Ga0501080_0012613 Ga0501080_0012613_2046_2666 202
273 3300049742 Ga0501080_0247426 Ga0501080_0247426_86_715 202
274 3300049742 Ga0501080_0280341 Ga0501080_0280341_644_1273 202
275 3300049743 Ga0501081_0324446 Ga0501081_0324446_373_993 202
276 3300049744 Ga0501083_0033393 Ga0501083_0033393_1365_1985 202
277 3300049822 Ga0501035_0478225 Ga0501035_0478225_367_996 202
278 3300054114 Ga0501084_0101114 Ga0501084_0101114_563_1183 202
279 3300005367 Ga0070667_100997956 Ga0070667_1009979561 204
280 3300005455 Ga0070663_100181721 Ga0070663_1001817211 204
281 3300005458 Ga0070681_10012559 Ga0070681_100125593 204
282 3300005539 Ga0068853_100005566 Ga0068853_1000055665 204
283 3300005545 Ga0070695_100319800 Ga0070695_1003198001 204
284 3300005563 Ga0068855_100298044 Ga0068855_1002980442 204
285 3300005577 Ga0068857_100023233 Ga0068857_1000232334 204
286 3300005842 Ga0068858_100501783 Ga0068858_1005017831 204
287 3300006237 Ga0097621_100557775 Ga0097621_1005577752 204
288 3300009174 Ga0105241_10004571 Ga0105241_100045712 204
289 3300009177 Ga0105248_10384790 Ga0105248_103847902 204
290 3300010375 Ga0105239_10050315 Ga0105239_100503153 204
291 3300013307 Ga0157372_11046454 Ga0157372_110464542 204
292 3300025912 Ga0207707_10027772 Ga0207707_100277723 204
293 3300026035 Ga0207703_10615556 Ga0207703_106155561 204
294 3300026041 Ga0207639_10005193 Ga0207639_100051935 204
295 3300026067 Ga0207678_10519429 Ga0207678_105194291 204
296 3300026116 Ga0207674_10032783 Ga0207674_100327834 204
297 3300035119 Ga0373956_0074945 Ga0373956_0074945_785_1417 204
298 3300048907 Ga0496104_0946294 Ga0496104_0946294_116_748 204
299 3300048917 Ga0496114_0572532 Ga0496114_0572532_287_919 204
300 3300025910 Ga0207684_10778562 Ga0207684_107785621 205
301 3300003323 rootH1_10098422 rootH1_100984226 206

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04299

FMN_bind_2

Putative FMN-binding domain

3

164

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ol5-assembly1.cif.gz_A crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8993 11 202
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8904 10 201
2ol5-assembly1.cif.gz_A crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8901 11 202
2ol5-assembly1.cif.gz_B crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus 0.8815 10 201
6rk0-assembly1.cif.gz_B structure of the flavocytochrome anf3 from azotobacter vinelandii 0.8523 7 169
ID Description Score Start End Superfamily
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9102 1 203 2.30.110.10
af_A0A1D8PQI8_1_209_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8935 1 203 2.30.110.10
2ol5A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8544 11 200 2.30.110.10
2ol5A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8411 11 200 2.30.110.10
4ybnB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.828 7 169 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A7Y3H251-F1-model_v4 FMN-binding negative transcriptional regulator 0.963 1 203
AF-A0A494YD85-F1-model_v4 FMN-binding negative transcriptional regulator 0.9532 1 203
AF-A0A2U1RTT8-F1-model_v4 deleted 0.9528 1 203
AF-A0A1F7QG36-F1-model_v4 Transcriptional regulator 0.9522 1 204
AF-A0A1Q5VL68-F1-model_v4 deleted 0.9508 1 203

Feature Viewer

pLDDT pTM Quality
91.34 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map