F395938
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 301 | 187 | 301 | 207 |
Family's Representative Sequence
| Representative Sequence | 3300025321|Ga0207656_10230956|Ga0207656_102309562 |
| Length | 225 |
| Sequence | MTLYVPSHFRVEERARLVGFMREHAFATLISSADAGLHVSHVPLLVDLDGETIRLRGHVARGNAHWESLEVARDVTAIFHGPHAYVSPTWYAVHPSVPTWNYAVVHAHGKARLTDEAELHEIVTELSTKYEAGNVPPWKLSEQPAAYVSSMLGMIVGFEIEVAWVEGKFKLSQNRPVEIPRVVDRLEASGEAELASLMRRQASSLWVTTSTMRRAISVASPTGTR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 136 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 138 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 139 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 140 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 141 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 142 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 143 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 146 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 147 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 160 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 161 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 162 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 163 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 165 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 168 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 169 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 182 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 183 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 184 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 185 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.99 |
| Nodule | 0 |
| Rhizoplane | 3.99 |
| Rhizosphere | 93.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10098422 | 3300003323 | Bacteria | 13757 |
| 2 | Ga0070658_10030313 | 3300005327 | Bacteria | 4346 |
| 3 | Ga0070658_10124045 | 3300005327 | Bacteria | 2148 |
| 4 | Ga0070658_10251636 | 3300005327 | Bacteria | 1499 |
| 5 | Ga0070658_10479910 | 3300005327 | Bacteria | 1073 |
| 6 | Ga0070676_10146674 | 3300005328 | Bacteria | 1507 |
| 7 | Ga0070683_100316920 | 3300005329 | Bacteria | 1484 |
| 8 | Ga0070683_100924408 | 3300005329 | Bacteria | 837 |
| 9 | Ga0070690_100234064 | 3300005330 | Bacteria | 1293 |
| 10 | Ga0070670_100278747 | 3300005331 | Bacteria | 1460 |
| 11 | Ga0070680_100264716 | 3300005336 | Bacteria | 1455 |
| 12 | Ga0070680_100408733 | 3300005336 | Unclassified | 1157 |
| 13 | Ga0068868_100295902 | 3300005338 | Bacteria | 1374 |
| 14 | Ga0070660_100703816 | 3300005339 | Bacteria | 847 |
| 15 | Ga0070689_100001002 | 3300005340 | Bacteria | 17702 |
| 16 | Ga0070689_100026879 | 3300005340 | Bacteria | 4336 |
| 17 | Ga0070687_100053466 | 3300005343 | Bacteria | 2100 |
| 18 | Ga0070661_100769906 | 3300005344 | Bacteria | 788 |
| 19 | Ga0070692_10021950 | 3300005345 | Bacteria | 3112 |
| 20 | Ga0070675_100023054 | 3300005354 | Bacteria | 4974 |
| 21 | Ga0070671_100052685 | 3300005355 | Bacteria | 3383 |
| 22 | Ga0070674_100040026 | 3300005356 | Bacteria | 3168 |
| 23 | Ga0070673_100220310 | 3300005364 | Bacteria | 1642 |
| 24 | Ga0070673_100463429 | 3300005364 | Bacteria | 1141 |
| 25 | Ga0070688_100048014 | 3300005365 | Bacteria | 2651 |
| 26 | Ga0070659_100051220 | 3300005366 | Bacteria | 3246 |
| 27 | Ga0070659_100369742 | 3300005366 | Bacteria | 1206 |
| 28 | Ga0070667_100997956 | 3300005367 | Bacteria | 781 |
| 29 | Ga0070710_10261475 | 3300005437 | Bacteria | 1116 |
| 30 | Ga0070701_10057424 | 3300005438 | Bacteria | 2040 |
| 31 | Ga0070705_100061777 | 3300005440 | Bacteria | 2228 |
| 32 | Ga0070705_100142970 | 3300005440 | Bacteria | 1577 |
| 33 | Ga0070700_100104776 | 3300005441 | Bacteria | 1869 |
| 34 | Ga0070694_100229112 | 3300005444 | Bacteria | 1397 |
| 35 | Ga0070663_100181721 | 3300005455 | Bacteria | 1632 |
| 36 | Ga0070678_100202356 | 3300005456 | Bacteria | 1640 |
| 37 | Ga0070678_100370396 | 3300005456 | Bacteria | 1237 |
| 38 | Ga0070681_10006268 | 3300005458 | Bacteria | 11569 |
| 39 | Ga0070681_10012559 | 3300005458 | Bacteria | 8404 |
| 40 | Ga0068867_100046276 | 3300005459 | Bacteria | 3195 |
| 41 | Ga0068867_100122724 | 3300005459 | Bacteria | 2009 |
| 42 | Ga0068867_100510260 | 3300005459 | Bacteria | 1035 |
| 43 | Ga0068867_100661553 | 3300005459 | Bacteria | 917 |
| 44 | Ga0070685_10119421 | 3300005466 | Bacteria | 1635 |
| 45 | Ga0070707_100431117 | 3300005468 | Bacteria | 1279 |
| 46 | Ga0070699_100231761 | 3300005518 | Bacteria | 1647 |
| 47 | Ga0070684_100082167 | 3300005535 | Bacteria | 2852 |
| 48 | Ga0068853_100005566 | 3300005539 | Bacteria | 9888 |
| 49 | Ga0068853_100012898 | 3300005539 | Bacteria | 6811 |
| 50 | Ga0068853_100248078 | 3300005539 | Bacteria | 1633 |
| 51 | Ga0068853_100570391 | 3300005539 | Bacteria | 1073 |
| 52 | Ga0070686_100017048 | 3300005544 | Bacteria | 4238 |
| 53 | Ga0070686_100534413 | 3300005544 | Bacteria | 915 |
| 54 | Ga0070695_100319800 | 3300005545 | Bacteria | 1153 |
| 55 | Ga0070696_100035786 | 3300005546 | Bacteria | 3420 |
| 56 | Ga0070696_100040502 | 3300005546 | Bacteria | 3217 |
| 57 | Ga0070696_100065036 | 3300005546 | Bacteria | 2556 |
| 58 | Ga0070696_100463108 | 3300005546 | Bacteria | 1002 |
| 59 | Ga0070693_100015741 | 3300005547 | Bacteria | 3900 |
| 60 | Ga0070693_100028240 | 3300005547 | Bacteria | 3049 |
| 61 | Ga0070693_100069789 | 3300005547 | Bacteria | 2066 |
| 62 | Ga0070704_100066179 | 3300005549 | Bacteria | 2605 |
| 63 | Ga0070704_100102155 | 3300005549 | Bacteria | 2163 |
| 64 | Ga0068855_100200930 | 3300005563 | Bacteria | 2244 |
| 65 | Ga0068855_100298044 | 3300005563 | Bacteria | 1786 |
| 66 | Ga0068855_100592127 | 3300005563 | Bacteria | 1197 |
| 67 | Ga0068857_100023233 | 3300005577 | Bacteria | 5457 |
| 68 | Ga0068857_100237822 | 3300005577 | Bacteria | 1667 |
| 69 | Ga0068854_100474754 | 3300005578 | Bacteria | 1049 |
| 70 | Ga0070702_100151119 | 3300005615 | Bacteria | 1491 |
| 71 | Ga0070702_100398463 | 3300005615 | Bacteria | 984 |
| 72 | Ga0068852_100000484 | 3300005616 | Bacteria | 26098 |
| 73 | Ga0068852_100011110 | 3300005616 | Bacteria | 6762 |
| 74 | Ga0068852_100012591 | 3300005616 | Bacteria | 6428 |
| 75 | Ga0068852_100051741 | 3300005616 | Bacteria | 3527 |
| 76 | Ga0068852_100406859 | 3300005616 | Bacteria | 1340 |
| 77 | Ga0068859_100017464 | 3300005617 | Bacteria | 7213 |
| 78 | Ga0068859_100127145 | 3300005617 | Bacteria | 2618 |
| 79 | Ga0068859_100916274 | 3300005617 | Bacteria | 961 |
| 80 | Ga0068864_100069778 | 3300005618 | Bacteria | 3056 |
| 81 | Ga0068851_10001115 | 3300005834 | Bacteria | 11633 |
| 82 | Ga0068870_10050405 | 3300005840 | Bacteria | 2200 |
| 83 | Ga0068863_100070366 | 3300005841 | Bacteria | 3309 |
| 84 | Ga0068863_100142641 | 3300005841 | Bacteria | 2290 |
| 85 | Ga0068863_100282361 | 3300005841 | Bacteria | 1609 |
| 86 | Ga0068858_100014709 | 3300005842 | Bacteria | 7366 |
| 87 | Ga0068858_100061889 | 3300005842 | Bacteria | 3460 |
| 88 | Ga0068858_100501783 | 3300005842 | Bacteria | 1172 |
| 89 | Ga0068860_100760692 | 3300005843 | Bacteria | 981 |
| 90 | Ga0075364_10187945 | 3300006051 | Bacteria | 1399 |
| 91 | Ga0075432_10037973 | 3300006058 | Bacteria | 1677 |
| 92 | Ga0075367_10059849 | 3300006178 | Bacteria | 2269 |
| 93 | Ga0075366_10052981 | 3300006195 | Bacteria | 2410 |
| 94 | Ga0097621_100038035 | 3300006237 | Bacteria | 3860 |
| 95 | Ga0097621_100207572 | 3300006237 | Bacteria | 1703 |
| 96 | Ga0097621_100411806 | 3300006237 | Bacteria | 1212 |
| 97 | Ga0097621_100557775 | 3300006237 | Bacteria | 1043 |
| 98 | Ga0097621_100967489 | 3300006237 | Bacteria | 795 |
| 99 | Ga0068871_100027228 | 3300006358 | Bacteria | 4468 |
| 100 | Ga0068871_100032101 | 3300006358 | Bacteria | 4145 |
| 101 | Ga0068871_100117723 | 3300006358 | Bacteria | 2241 |
| 102 | Ga0075433_10156683 | 3300006852 | Bacteria | 2026 |
| 103 | Ga0068865_100085091 | 3300006881 | Bacteria | 2280 |
| 104 | Ga0068865_100109404 | 3300006881 | Bacteria | 2036 |
| 105 | Ga0097620_100017464 | 3300006931 | Bacteria | 7213 |
| 106 | Ga0097620_100127137 | 3300006931 | Bacteria | 2618 |
| 107 | Ga0097620_100916311 | 3300006931 | Bacteria | 961 |
| 108 | Ga0105240_10019253 | 3300009093 | Bacteria | 9123 |
| 109 | Ga0105240_10065089 | 3300009093 | Bacteria | 4526 |
| 110 | Ga0111539_10577946 | 3300009094 | Bacteria | 1309 |
| 111 | Ga0105245_10938033 | 3300009098 | Bacteria | 908 |
| 112 | Ga0105245_11063902 | 3300009098 | Bacteria | 855 |
| 113 | Ga0105245_11172059 | 3300009098 | Unclassified | 816 |
| 114 | Ga0114129_10632951 | 3300009147 | Bacteria | 1382 |
| 115 | Ga0105243_10203016 | 3300009148 | Bacteria | 1740 |
| 116 | Ga0105243_10933094 | 3300009148 | Bacteria | 866 |
| 117 | Ga0105241_10004571 | 3300009174 | Bacteria | 10239 |
| 118 | Ga0105242_10001658 | 3300009176 | Bacteria | 17602 |
| 119 | Ga0105242_10031399 | 3300009176 | Bacteria | 4242 |
| 120 | Ga0105242_10040427 | 3300009176 | Bacteria | 3758 |
| 121 | Ga0105242_10241229 | 3300009176 | Bacteria | 1625 |
| 122 | Ga0105248_10005187 | 3300009177 | Bacteria | 14361 |
| 123 | Ga0105248_10069333 | 3300009177 | Bacteria | 3959 |
| 124 | Ga0105248_10099766 | 3300009177 | Bacteria | 3272 |
| 125 | Ga0105248_10130703 | 3300009177 | Bacteria | 2833 |
| 126 | Ga0105248_10384790 | 3300009177 | Bacteria | 1580 |
| 127 | Ga0105238_10144017 | 3300009551 | Bacteria | 2360 |
| 128 | Ga0105238_10239886 | 3300009551 | Bacteria | 1790 |
| 129 | Ga0105238_10885436 | 3300009551 | Bacteria | 911 |
| 130 | Ga0105249_10284171 | 3300009553 | Bacteria | 1654 |
| 131 | Ga0105249_10317895 | 3300009553 | Bacteria | 1567 |
| 132 | Ga0105249_10950615 | 3300009553 | Bacteria | 927 |
| 133 | Ga0105239_10050315 | 3300010375 | Bacteria | 4571 |
| 134 | Ga0105239_10997733 | 3300010375 | Bacteria | 963 |
| 135 | Ga0157371_10712950 | 3300013102 | Bacteria | 752 |
| 136 | Ga0157369_10008265 | 3300013105 | Bacteria | 11932 |
| 137 | Ga0157369_10496034 | 3300013105 | Bacteria | 1263 |
| 138 | Ga0157374_10673028 | 3300013296 | Unclassified | 1047 |
| 139 | Ga0157378_10051669 | 3300013297 | Bacteria | 3657 |
| 140 | Ga0157378_10574870 | 3300013297 | Bacteria | 1135 |
| 141 | Ga0163162_10863937 | 3300013306 | Bacteria | 1019 |
| 142 | Ga0157372_10007476 | 3300013307 | Bacteria | 11619 |
| 143 | Ga0157372_10264488 | 3300013307 | Bacteria | 1997 |
| 144 | Ga0157372_11046454 | 3300013307 | Bacteria | 945 |
| 145 | Ga0157375_10186620 | 3300013308 | Bacteria | 2227 |
| 146 | Ga0163163_10388798 | 3300014325 | Bacteria | 1453 |
| 147 | Ga0163163_10685234 | 3300014325 | Bacteria | 1088 |
| 148 | Ga0157380_10649355 | 3300014326 | Bacteria | 1052 |
| 149 | Ga0157380_10820496 | 3300014326 | Bacteria | 949 |
| 150 | Ga0157377_10017058 | 3300014745 | Bacteria | 3751 |
| 151 | Ga0157379_10002873 | 3300014968 | Bacteria | 14522 |
| 152 | Ga0157379_10271267 | 3300014968 | Bacteria | 1543 |
| 153 | Ga0157376_10128920 | 3300014969 | Bacteria | 2254 |
| 154 | Ga0213876_10063155 | 3300021384 | Bacteria | 1955 |
| 155 | Ga0207656_10001284 | 3300025321 | Bacteria | 8249 |
| 156 | Ga0207656_10230956 | 3300025321 | Bacteria | 902 |
| 157 | Ga0207688_10090162 | 3300025901 | Bacteria | 1759 |
| 158 | Ga0207645_10191611 | 3300025907 | Bacteria | 1344 |
| 159 | Ga0207643_10009570 | 3300025908 | Bacteria | 5206 |
| 160 | Ga0207705_10113521 | 3300025909 | Bacteria | 2004 |
| 161 | Ga0207705_10174700 | 3300025909 | Bacteria | 1619 |
| 162 | Ga0207705_10190072 | 3300025909 | Bacteria | 1552 |
| 163 | Ga0207684_10778562 | 3300025910 | Unclassified | 810 |
| 164 | Ga0207707_10027772 | 3300025912 | Bacteria | 4947 |
| 165 | Ga0207707_10048646 | 3300025912 | Bacteria | 3693 |
| 166 | Ga0207695_10037818 | 3300025913 | Bacteria | 5204 |
| 167 | Ga0207695_10086080 | 3300025913 | Bacteria | 3170 |
| 168 | Ga0207695_10551461 | 3300025913 | Bacteria | 1034 |
| 169 | Ga0207660_10073239 | 3300025917 | Bacteria | 2497 |
| 170 | Ga0207662_10068988 | 3300025918 | Bacteria | 2136 |
| 171 | Ga0207662_10258633 | 3300025918 | Bacteria | 1145 |
| 172 | Ga0207662_10434329 | 3300025918 | Bacteria | 896 |
| 173 | Ga0207649_10158856 | 3300025920 | Bacteria | 1565 |
| 174 | Ga0207649_10649449 | 3300025920 | Bacteria | 815 |
| 175 | Ga0207652_10123731 | 3300025921 | Bacteria | 2303 |
| 176 | Ga0207646_10428425 | 3300025922 | Bacteria | 1194 |
| 177 | Ga0207681_10478582 | 3300025923 | Bacteria | 1017 |
| 178 | Ga0207681_10560559 | 3300025923 | Bacteria | 941 |
| 179 | Ga0207694_10070723 | 3300025924 | Bacteria | 2727 |
| 180 | Ga0207694_10162740 | 3300025924 | Bacteria | 1803 |
| 181 | Ga0207694_10180248 | 3300025924 | Bacteria | 1713 |
| 182 | Ga0207694_10611746 | 3300025924 | Bacteria | 917 |
| 183 | Ga0207659_10009172 | 3300025926 | Bacteria | 6178 |
| 184 | Ga0207687_10306994 | 3300025927 | Bacteria | 1280 |
| 185 | Ga0207687_10428967 | 3300025927 | Bacteria | 1092 |
| 186 | Ga0207687_10551307 | 3300025927 | Bacteria | 967 |
| 187 | Ga0207664_10433281 | 3300025929 | Bacteria | 1172 |
| 188 | Ga0207644_10110781 | 3300025931 | Bacteria | 2075 |
| 189 | Ga0207690_10017119 | 3300025932 | Bacteria | 4421 |
| 190 | Ga0207686_10005916 | 3300025934 | Bacteria | 6567 |
| 191 | Ga0207686_10008534 | 3300025934 | Bacteria | 5535 |
| 192 | Ga0207686_10073626 | 3300025934 | Bacteria | 2204 |
| 193 | Ga0207709_10153051 | 3300025935 | Bacteria | 1600 |
| 194 | Ga0207709_10596073 | 3300025935 | Bacteria | 874 |
| 195 | Ga0207670_10023382 | 3300025936 | Bacteria | 3847 |
| 196 | Ga0207670_10034586 | 3300025936 | Bacteria | 3267 |
| 197 | Ga0207670_10434277 | 3300025936 | Bacteria | 1056 |
| 198 | Ga0207704_10012144 | 3300025938 | Bacteria | 4267 |
| 199 | Ga0207704_10041199 | 3300025938 | Bacteria | 2706 |
| 200 | Ga0207691_10008832 | 3300025940 | Bacteria | 9669 |
| 201 | Ga0207711_10013415 | 3300025941 | Bacteria | 6807 |
| 202 | Ga0207711_10166919 | 3300025941 | Bacteria | 1995 |
| 203 | Ga0207689_10046778 | 3300025942 | Bacteria | 3575 |
| 204 | Ga0207689_10446831 | 3300025942 | Unclassified | 1080 |
| 205 | Ga0207667_10019494 | 3300025949 | Bacteria | 7569 |
| 206 | Ga0207667_10617811 | 3300025949 | Bacteria | 1092 |
| 207 | Ga0207651_10442977 | 3300025960 | Bacteria | 1113 |
| 208 | Ga0207651_10485266 | 3300025960 | Bacteria | 1066 |
| 209 | Ga0207677_10191299 | 3300026023 | Bacteria | 1619 |
| 210 | Ga0207703_10014163 | 3300026035 | Bacteria | 6219 |
| 211 | Ga0207703_10316452 | 3300026035 | Bacteria | 1428 |
| 212 | Ga0207703_10615556 | 3300026035 | Bacteria | 1028 |
| 213 | Ga0207639_10005193 | 3300026041 | Bacteria | 8785 |
| 214 | Ga0207639_10014767 | 3300026041 | Bacteria | 5502 |
| 215 | Ga0207639_10520102 | 3300026041 | Bacteria | 1090 |
| 216 | Ga0207678_10519429 | 3300026067 | Bacteria | 1039 |
| 217 | Ga0207708_10111631 | 3300026075 | Bacteria | 2122 |
| 218 | Ga0207708_10143107 | 3300026075 | Bacteria | 1877 |
| 219 | Ga0207708_10204073 | 3300026075 | Bacteria | 1578 |
| 220 | Ga0207641_10025176 | 3300026088 | Bacteria | 4907 |
| 221 | Ga0207641_10598298 | 3300026088 | Bacteria | 1079 |
| 222 | Ga0207648_10014180 | 3300026089 | Bacteria | 7370 |
| 223 | Ga0207648_10086956 | 3300026089 | Bacteria | 2728 |
| 224 | Ga0207648_10418613 | 3300026089 | Bacteria | 1216 |
| 225 | Ga0207676_10056113 | 3300026095 | Bacteria | 3095 |
| 226 | Ga0207674_10032783 | 3300026116 | Bacteria | 5445 |
| 227 | Ga0207674_10160426 | 3300026116 | Bacteria | 2203 |
| 228 | Ga0207675_100317863 | 3300026118 | Bacteria | 1520 |
| 229 | Ga0207675_100520283 | 3300026118 | Bacteria | 1186 |
| 230 | Ga0207683_10053724 | 3300026121 | Bacteria | 3532 |
| 231 | Ga0207683_10189783 | 3300026121 | Bacteria | 1865 |
| 232 | Ga0207683_10478541 | 3300026121 | Bacteria | 1149 |
| 233 | Ga0207698_10008064 | 3300026142 | Bacteria | 6641 |
| 234 | Ga0268265_10503420 | 3300028380 | Bacteria | 1142 |
| 235 | Ga0268264_10669073 | 3300028381 | Bacteria | 1029 |
| 236 | Ga0268264_10925059 | 3300028381 | Bacteria | 876 |
| 237 | Ga0265332_10232193 | 3300031238 | Bacteria | 764 |
| 238 | Ga0307408_100157304 | 3300031548 | Bacteria | 1801 |
| 239 | Ga0265314_10017890 | 3300031711 | Bacteria | 5549 |
| 240 | Ga0307405_10153349 | 3300031731 | Bacteria | 1623 |
| 241 | Ga0307405_10386600 | 3300031731 | Unclassified | 1091 |
| 242 | Ga0307406_10739622 | 3300031901 | Bacteria | 825 |
| 243 | Ga0307409_100397062 | 3300031995 | Bacteria | 1316 |
| 244 | Ga0307416_100052866 | 3300032002 | Bacteria | 3255 |
| 245 | Ga0373956_0074945 | 3300035119 | Bacteria | 1547 |
| 246 | Ga0373931_0474734 | 3300035691 | Bacteria | 803 |
| 247 | Ga0373927_0128006 | 3300035695 | Bacteria | 1658 |
| 248 | Ga0373937_0166695 | 3300036401 | Bacteria | 2066 |
| 249 | Ga0395899_0145709 | 3300037312 | Bacteria | 1682 |
| 250 | Ga0395898_0620122 | 3300037466 | Bacteria | 1024 |
| 251 | Ga0395905_0068916 | 3300037471 | Bacteria | 3313 |
| 252 | Ga0395901_0326571 | 3300038443 | Unclassified | 1587 |
| 253 | Ga0436365_1337187 | 3300039437 | Bacteria | 9802 |
| 254 | Ga0466961_0466001 | 3300044693 | Bacteria | 764 |
| 255 | Ga0466963_0638053 | 3300044694 | Bacteria | 752 |
| 256 | Ga0466957_0003806 | 3300044842 | Bacteria | 8339 |
| 257 | Ga0495618_0329280 | 3300046514 | Unclassified | 945 |
| 258 | Ga0495598_0016772 | 3300046537 | Bacteria | 1876 |
| 259 | Ga0495621_0002227 | 3300046539 | Bacteria | 5183 |
| 260 | Ga0495645_0001930 | 3300046543 | Bacteria | 14080 |
| 261 | Ga0495667_0014114 | 3300046559 | Bacteria | 5392 |
| 262 | Ga0495635_0032421 | 3300046663 | Bacteria | 3625 |
| 263 | Ga0495599_0012523 | 3300046678 | Bacteria | 5232 |
| 264 | Ga0495623_0013457 | 3300046679 | Bacteria | 5305 |
| 265 | Ga0495658_0139486 | 3300046683 | Bacteria | 1482 |
| 266 | Ga0495600_0083218 | 3300046809 | Bacteria | 2089 |
| 267 | Ga0495675_0230451 | 3300047444 | Bacteria | 1118 |
| 268 | Ga0495684_0058067 | 3300047471 | Bacteria | 2948 |
| 269 | Ga0496100_0545310 | 3300048903 | Bacteria | 897 |
| 270 | Ga0496102_1540425 | 3300048905 | Bacteria | 583 |
| 271 | Ga0496104_0015911 | 3300048907 | Bacteria | 6827 |
| 272 | Ga0496104_0644938 | 3300048907 | Bacteria | 968 |
| 273 | Ga0496104_0946294 | 3300048907 | Bacteria | 766 |
| 274 | Ga0496105_0119650 | 3300048908 | Bacteria | 2172 |
| 275 | Ga0496109_0235949 | 3300048912 | Bacteria | 1721 |
| 276 | Ga0496110_0441964 | 3300048913 | Bacteria | 1185 |
| 277 | Ga0496111_0059390 | 3300048914 | Bacteria | 2771 |
| 278 | Ga0496112_0014001 | 3300048915 | Bacteria | 7423 |
| 279 | Ga0496113_0019719 | 3300048916 | Bacteria | 4725 |
| 280 | Ga0496114_0572532 | 3300048917 | Bacteria | 997 |
| 281 | Ga0501032_0058792 | 3300049569 | Bacteria | 2581 |
| 282 | Ga0501037_0117019 | 3300049573 | Bacteria | 1918 |
| 283 | Ga0501043_0226729 | 3300049579 | Bacteria | 1444 |
| 284 | Ga0501068_0001055 | 3300049584 | Bacteria | 14604 |
| 285 | Ga0501070_0003078 | 3300049586 | Bacteria | 14519 |
| 286 | Ga0501073_0003022 | 3300049589 | Bacteria | 12609 |
| 287 | Ga0501074_0019604 | 3300049590 | Bacteria | 4909 |
| 288 | Ga0501079_0512296 | 3300049741 | Bacteria | 943 |
| 289 | Ga0501080_0012613 | 3300049742 | Bacteria | 7749 |
| 290 | Ga0501080_0247426 | 3300049742 | Bacteria | 1626 |
| 291 | Ga0501080_0280341 | 3300049742 | Bacteria | 1515 |
| 292 | Ga0501081_0324446 | 3300049743 | Bacteria | 1132 |
| 293 | Ga0501083_0033393 | 3300049744 | Bacteria | 3524 |
| 294 | Ga0501035_0478225 | 3300049822 | Bacteria | 1028 |
| 295 | nmdc:mga00v17_93030_c1 | 3300050491 | Bacteria | 1895 |
| 296 | nmdc:mga0k408_429668_c1 | 3300050493 | Bacteria | 785 |
| 297 | nmdc:mga07m45_230557_c1 | 3300050496 | Bacteria | 1077 |
| 298 | nmdc:mga05p37_534447_c1 | 3300050507 | Bacteria | 1338 |
| 299 | Ga0495601_0104693 | 3300053077 | Bacteria | 1829 |
| 300 | Ga0495619_0146675 | 3300053085 | Bacteria | 1627 |
| 301 | Ga0501084_0101114 | 3300054114 | Bacteria | 2421 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050493 | nmdc:mga0k408_429668_c1 | nmdc:mga0k408_429668_c1_22_537 | 166 |
| 2 | 3300048905 | Ga0496102_1540425 | Ga0496102_1540425_22_573 | 178 |
| 3 | 3300009553 | Ga0105249_10950615 | Ga0105249_109506152 | 185 |
| 4 | 3300046539 | Ga0495621_0002227 | Ga0495621_0002227_580_1173 | 193 |
| 5 | 3300005355 | Ga0070671_100052685 | Ga0070671_1000526853 | 196 |
| 6 | 3300005618 | Ga0068864_100069778 | Ga0068864_1000697783 | 196 |
| 7 | 3300009177 | Ga0105248_10069333 | Ga0105248_100693334 | 196 |
| 8 | 3300025931 | Ga0207644_10110781 | Ga0207644_101107811 | 196 |
| 9 | 3300025941 | Ga0207711_10013415 | Ga0207711_100134157 | 196 |
| 10 | 3300026095 | Ga0207676_10056113 | Ga0207676_100561133 | 196 |
| 11 | 3300048903 | Ga0496100_0545310 | Ga0496100_0545310_89_709 | 196 |
| 12 | 3300048907 | Ga0496104_0644938 | Ga0496104_0644938_307_927 | 196 |
| 13 | 3300048915 | Ga0496112_0014001 | Ga0496112_0014001_198_818 | 196 |
| 14 | 3300048916 | Ga0496113_0019719 | Ga0496113_0019719_4018_4638 | 196 |
| 15 | 3300005327 | Ga0070658_10251636 | Ga0070658_102516363 | 197 |
| 16 | 3300005328 | Ga0070676_10146674 | Ga0070676_101466743 | 197 |
| 17 | 3300005329 | Ga0070683_100924408 | Ga0070683_1009244082 | 197 |
| 18 | 3300005331 | Ga0070670_100278747 | Ga0070670_1002787472 | 197 |
| 19 | 3300005340 | Ga0070689_100001002 | Ga0070689_1000010028 | 197 |
| 20 | 3300005354 | Ga0070675_100023054 | Ga0070675_1000230545 | 197 |
| 21 | 3300005365 | Ga0070688_100048014 | Ga0070688_1000480142 | 197 |
| 22 | 3300005456 | Ga0070678_100202356 | Ga0070678_1002023561 | 197 |
| 23 | 3300005577 | Ga0068857_100237822 | Ga0068857_1002378221 | 197 |
| 24 | 3300005615 | Ga0070702_100151119 | Ga0070702_1001511192 | 197 |
| 25 | 3300005840 | Ga0068870_10050405 | Ga0068870_100504053 | 197 |
| 26 | 3300013308 | Ga0157375_10186620 | Ga0157375_101866202 | 197 |
| 27 | 3300014745 | Ga0157377_10017058 | Ga0157377_100170584 | 197 |
| 28 | 3300025907 | Ga0207645_10191611 | Ga0207645_101916112 | 197 |
| 29 | 3300025908 | Ga0207643_10009570 | Ga0207643_100095702 | 197 |
| 30 | 3300025923 | Ga0207681_10560559 | Ga0207681_105605592 | 197 |
| 31 | 3300025926 | Ga0207659_10009172 | Ga0207659_100091725 | 197 |
| 32 | 3300025936 | Ga0207670_10023382 | Ga0207670_100233823 | 197 |
| 33 | 3300025940 | Ga0207691_10008832 | Ga0207691_100088325 | 197 |
| 34 | 3300025942 | Ga0207689_10446831 | Ga0207689_104468312 | 197 |
| 35 | 3300026075 | Ga0207708_10143107 | Ga0207708_101431072 | 197 |
| 36 | 3300026121 | Ga0207683_10189783 | Ga0207683_101897833 | 197 |
| 37 | 3300026121 | Ga0207683_10478541 | Ga0207683_104785412 | 197 |
| 38 | 3300005547 | Ga0070693_100069789 | Ga0070693_1000697892 | 198 |
| 39 | 3300005616 | Ga0068852_100012591 | Ga0068852_1000125916 | 198 |
| 40 | 3300025918 | Ga0207662_10258633 | Ga0207662_102586332 | 198 |
| 41 | 3300038443 | Ga0395901_0326571 | Ga0395901_0326571_154_771 | 198 |
| 42 | 3300005344 | Ga0070661_100769906 | Ga0070661_1007699061 | 199 |
| 43 | 3300005459 | Ga0068867_100510260 | Ga0068867_1005102601 | 199 |
| 44 | 3300005547 | Ga0070693_100015741 | Ga0070693_1000157412 | 199 |
| 45 | 3300005563 | Ga0068855_100592127 | Ga0068855_1005921272 | 199 |
| 46 | 3300009551 | Ga0105238_10239886 | Ga0105238_102398862 | 199 |
| 47 | 3300013307 | Ga0157372_10264488 | Ga0157372_102644882 | 199 |
| 48 | 3300025913 | Ga0207695_10551461 | Ga0207695_105514611 | 199 |
| 49 | 3300025920 | Ga0207649_10649449 | Ga0207649_106494492 | 199 |
| 50 | 3300025924 | Ga0207694_10162740 | Ga0207694_101627403 | 199 |
| 51 | 3300025949 | Ga0207667_10617811 | Ga0207667_106178112 | 199 |
| 52 | 3300026089 | Ga0207648_10418613 | Ga0207648_104186132 | 199 |
| 53 | 3300050496 | nmdc:mga07m45_230557_c1 | nmdc:mga07m45_230557_c1_174_794 | 199 |
| 54 | 3300005327 | Ga0070658_10479910 | Ga0070658_104799102 | 200 |
| 55 | 3300005338 | Ga0068868_100295902 | Ga0068868_1002959022 | 200 |
| 56 | 3300005340 | Ga0070689_100026879 | Ga0070689_1000268792 | 200 |
| 57 | 3300005343 | Ga0070687_100053466 | Ga0070687_1000534663 | 200 |
| 58 | 3300005356 | Ga0070674_100040026 | Ga0070674_1000400262 | 200 |
| 59 | 3300005364 | Ga0070673_100220310 | Ga0070673_1002203102 | 200 |
| 60 | 3300005364 | Ga0070673_100463429 | Ga0070673_1004634292 | 200 |
| 61 | 3300005366 | Ga0070659_100369742 | Ga0070659_1003697422 | 200 |
| 62 | 3300005437 | Ga0070710_10261475 | Ga0070710_102614752 | 200 |
| 63 | 3300005456 | Ga0070678_100370396 | Ga0070678_1003703962 | 200 |
| 64 | 3300005458 | Ga0070681_10006268 | Ga0070681_100062684 | 200 |
| 65 | 3300005459 | Ga0068867_100122724 | Ga0068867_1001227242 | 200 |
| 66 | 3300005459 | Ga0068867_100661553 | Ga0068867_1006615532 | 200 |
| 67 | 3300005539 | Ga0068853_100248078 | Ga0068853_1002480782 | 200 |
| 68 | 3300005544 | Ga0070686_100534413 | Ga0070686_1005344132 | 200 |
| 69 | 3300005546 | Ga0070696_100035786 | Ga0070696_1000357862 | 200 |
| 70 | 3300005547 | Ga0070693_100028240 | Ga0070693_1000282402 | 200 |
| 71 | 3300005615 | Ga0070702_100398463 | Ga0070702_1003984632 | 200 |
| 72 | 3300005616 | Ga0068852_100406859 | Ga0068852_1004068592 | 200 |
| 73 | 3300005617 | Ga0068859_100017464 | Ga0068859_1000174645 | 200 |
| 74 | 3300005617 | Ga0068859_100916274 | Ga0068859_1009162742 | 200 |
| 75 | 3300005841 | Ga0068863_100070366 | Ga0068863_1000703663 | 200 |
| 76 | 3300005841 | Ga0068863_100142641 | Ga0068863_1001426413 | 200 |
| 77 | 3300005842 | Ga0068858_100014709 | Ga0068858_1000147096 | 200 |
| 78 | 3300006051 | Ga0075364_10187945 | Ga0075364_101879452 | 200 |
| 79 | 3300006058 | Ga0075432_10037973 | Ga0075432_100379733 | 200 |
| 80 | 3300006178 | Ga0075367_10059849 | Ga0075367_100598492 | 200 |
| 81 | 3300006195 | Ga0075366_10052981 | Ga0075366_100529812 | 200 |
| 82 | 3300006237 | Ga0097621_100038035 | Ga0097621_1000380354 | 200 |
| 83 | 3300006237 | Ga0097621_100411806 | Ga0097621_1004118061 | 200 |
| 84 | 3300006358 | Ga0068871_100027228 | Ga0068871_1000272282 | 200 |
| 85 | 3300006358 | Ga0068871_100117723 | Ga0068871_1001177232 | 200 |
| 86 | 3300006852 | Ga0075433_10156683 | Ga0075433_101566832 | 200 |
| 87 | 3300006881 | Ga0068865_100085091 | Ga0068865_1000850912 | 200 |
| 88 | 3300006931 | Ga0097620_100017464 | Ga0097620_1000174645 | 200 |
| 89 | 3300006931 | Ga0097620_100916311 | Ga0097620_1009163112 | 200 |
| 90 | 3300009098 | Ga0105245_10938033 | Ga0105245_109380332 | 200 |
| 91 | 3300009098 | Ga0105245_11172059 | Ga0105245_111720592 | 200 |
| 92 | 3300009147 | Ga0114129_10632951 | Ga0114129_106329512 | 200 |
| 93 | 3300009148 | Ga0105243_10933094 | Ga0105243_109330941 | 200 |
| 94 | 3300009176 | Ga0105242_10001658 | Ga0105242_100016588 | 200 |
| 95 | 3300009176 | Ga0105242_10040427 | Ga0105242_100404274 | 200 |
| 96 | 3300009177 | Ga0105248_10005187 | Ga0105248_1000518714 | 200 |
| 97 | 3300009177 | Ga0105248_10099766 | Ga0105248_100997663 | 200 |
| 98 | 3300009551 | Ga0105238_10885436 | Ga0105238_108854362 | 200 |
| 99 | 3300010375 | Ga0105239_10997733 | Ga0105239_109977332 | 200 |
| 100 | 3300013296 | Ga0157374_10673028 | Ga0157374_106730282 | 200 |
| 101 | 3300013297 | Ga0157378_10051669 | Ga0157378_100516693 | 200 |
| 102 | 3300013306 | Ga0163162_10863937 | Ga0163162_108639371 | 200 |
| 103 | 3300014325 | Ga0163163_10685234 | Ga0163163_106852341 | 200 |
| 104 | 3300014968 | Ga0157379_10002873 | Ga0157379_1000287310 | 200 |
| 105 | 3300014969 | Ga0157376_10128920 | Ga0157376_101289202 | 200 |
| 106 | 3300025321 | Ga0207656_10230956 | Ga0207656_102309562 | 200 |
| 107 | 3300025901 | Ga0207688_10090162 | Ga0207688_100901622 | 200 |
| 108 | 3300025909 | Ga0207705_10174700 | Ga0207705_101747002 | 200 |
| 109 | 3300025912 | Ga0207707_10048646 | Ga0207707_100486463 | 200 |
| 110 | 3300025917 | Ga0207660_10073239 | Ga0207660_100732393 | 200 |
| 111 | 3300025918 | Ga0207662_10068988 | Ga0207662_100689883 | 200 |
| 112 | 3300025923 | Ga0207681_10478582 | Ga0207681_104785822 | 200 |
| 113 | 3300025924 | Ga0207694_10180248 | Ga0207694_101802482 | 200 |
| 114 | 3300025927 | Ga0207687_10306994 | Ga0207687_103069942 | 200 |
| 115 | 3300025927 | Ga0207687_10551307 | Ga0207687_105513072 | 200 |
| 116 | 3300025929 | Ga0207664_10433281 | Ga0207664_104332812 | 200 |
| 117 | 3300025934 | Ga0207686_10005916 | Ga0207686_100059164 | 200 |
| 118 | 3300025934 | Ga0207686_10008534 | Ga0207686_100085345 | 200 |
| 119 | 3300025935 | Ga0207709_10596073 | Ga0207709_105960731 | 200 |
| 120 | 3300025936 | Ga0207670_10034586 | Ga0207670_100345862 | 200 |
| 121 | 3300025936 | Ga0207670_10434277 | Ga0207670_104342771 | 200 |
| 122 | 3300025938 | Ga0207704_10012144 | Ga0207704_100121443 | 200 |
| 123 | 3300025941 | Ga0207711_10166919 | Ga0207711_101669192 | 200 |
| 124 | 3300025942 | Ga0207689_10046778 | Ga0207689_100467783 | 200 |
| 125 | 3300025960 | Ga0207651_10442977 | Ga0207651_104429772 | 200 |
| 126 | 3300025960 | Ga0207651_10485266 | Ga0207651_104852662 | 200 |
| 127 | 3300026023 | Ga0207677_10191299 | Ga0207677_101912992 | 200 |
| 128 | 3300026035 | Ga0207703_10014163 | Ga0207703_100141636 | 200 |
| 129 | 3300026075 | Ga0207708_10204073 | Ga0207708_102040732 | 200 |
| 130 | 3300026088 | Ga0207641_10025176 | Ga0207641_100251761 | 200 |
| 131 | 3300026089 | Ga0207648_10086956 | Ga0207648_100869562 | 200 |
| 132 | 3300026116 | Ga0207674_10160426 | Ga0207674_101604263 | 200 |
| 133 | 3300026118 | Ga0207675_100317863 | Ga0207675_1003178632 | 200 |
| 134 | 3300026121 | Ga0207683_10053724 | Ga0207683_100537242 | 200 |
| 135 | 3300028380 | Ga0268265_10503420 | Ga0268265_105034202 | 200 |
| 136 | 3300028381 | Ga0268264_10925059 | Ga0268264_109250592 | 200 |
| 137 | 3300031731 | Ga0307405_10386600 | Ga0307405_103866002 | 200 |
| 138 | 3300035691 | Ga0373931_0474734 | Ga0373931_0474734_28_648 | 200 |
| 139 | 3300046514 | Ga0495618_0329280 | Ga0495618_0329280_132_767 | 200 |
| 140 | 3300046537 | Ga0495598_0016772 | Ga0495598_0016772_1107_1727 | 200 |
| 141 | 3300046543 | Ga0495645_0001930 | Ga0495645_0001930_7549_8184 | 200 |
| 142 | 3300046559 | Ga0495667_0014114 | Ga0495667_0014114_2048_2683 | 200 |
| 143 | 3300046663 | Ga0495635_0032421 | Ga0495635_0032421_1767_2402 | 200 |
| 144 | 3300046678 | Ga0495599_0012523 | Ga0495599_0012523_1888_2523 | 200 |
| 145 | 3300046679 | Ga0495623_0013457 | Ga0495623_0013457_1998_2633 | 200 |
| 146 | 3300046809 | Ga0495600_0083218 | Ga0495600_0083218_229_864 | 200 |
| 147 | 3300047471 | Ga0495684_0058067 | Ga0495684_0058067_1355_1990 | 200 |
| 148 | 3300050491 | nmdc:mga00v17_93030_c1 | nmdc:mga00v17_93030_c1_719_1342 | 200 |
| 149 | 3300050507 | nmdc:mga05p37_534447_c1 | nmdc:mga05p37_534447_c1_684_1319 | 200 |
| 150 | 3300053077 | Ga0495601_0104693 | Ga0495601_0104693_58_693 | 200 |
| 151 | 3300053085 | Ga0495619_0146675 | Ga0495619_0146675_229_864 | 200 |
| 152 | 3300005327 | Ga0070658_10030313 | Ga0070658_100303133 | 201 |
| 153 | 3300005327 | Ga0070658_10124045 | Ga0070658_101240452 | 201 |
| 154 | 3300005329 | Ga0070683_100316920 | Ga0070683_1003169202 | 201 |
| 155 | 3300005336 | Ga0070680_100264716 | Ga0070680_1002647162 | 201 |
| 156 | 3300005339 | Ga0070660_100703816 | Ga0070660_1007038162 | 201 |
| 157 | 3300005366 | Ga0070659_100051220 | Ga0070659_1000512204 | 201 |
| 158 | 3300005440 | Ga0070705_100061777 | Ga0070705_1000617773 | 201 |
| 159 | 3300005440 | Ga0070705_100142970 | Ga0070705_1001429702 | 201 |
| 160 | 3300005468 | Ga0070707_100431117 | Ga0070707_1004311172 | 201 |
| 161 | 3300005518 | Ga0070699_100231761 | Ga0070699_1002317612 | 201 |
| 162 | 3300005535 | Ga0070684_100082167 | Ga0070684_1000821672 | 201 |
| 163 | 3300005539 | Ga0068853_100012898 | Ga0068853_1000128986 | 201 |
| 164 | 3300005546 | Ga0070696_100040502 | Ga0070696_1000405022 | 201 |
| 165 | 3300005549 | Ga0070704_100066179 | Ga0070704_1000661793 | 201 |
| 166 | 3300005563 | Ga0068855_100200930 | Ga0068855_1002009302 | 201 |
| 167 | 3300005578 | Ga0068854_100474754 | Ga0068854_1004747542 | 201 |
| 168 | 3300005616 | Ga0068852_100000484 | Ga0068852_10000048420 | 201 |
| 169 | 3300005616 | Ga0068852_100011110 | Ga0068852_1000111103 | 201 |
| 170 | 3300005616 | Ga0068852_100051741 | Ga0068852_1000517414 | 201 |
| 171 | 3300005834 | Ga0068851_10001115 | Ga0068851_100011153 | 201 |
| 172 | 3300006237 | Ga0097621_100207572 | Ga0097621_1002075722 | 201 |
| 173 | 3300006237 | Ga0097621_100967489 | Ga0097621_1009674892 | 201 |
| 174 | 3300006358 | Ga0068871_100032101 | Ga0068871_1000321014 | 201 |
| 175 | 3300009093 | Ga0105240_10019253 | Ga0105240_100192532 | 201 |
| 176 | 3300009093 | Ga0105240_10065089 | Ga0105240_100650894 | 201 |
| 177 | 3300009094 | Ga0111539_10577946 | Ga0111539_105779462 | 201 |
| 178 | 3300009098 | Ga0105245_11063902 | Ga0105245_110639021 | 201 |
| 179 | 3300009176 | Ga0105242_10031399 | Ga0105242_100313994 | 201 |
| 180 | 3300009177 | Ga0105248_10130703 | Ga0105248_101307033 | 201 |
| 181 | 3300009551 | Ga0105238_10144017 | Ga0105238_101440172 | 201 |
| 182 | 3300009553 | Ga0105249_10284171 | Ga0105249_102841712 | 201 |
| 183 | 3300013102 | Ga0157371_10712950 | Ga0157371_107129502 | 201 |
| 184 | 3300013105 | Ga0157369_10008265 | Ga0157369_100082654 | 201 |
| 185 | 3300013105 | Ga0157369_10496034 | Ga0157369_104960342 | 201 |
| 186 | 3300013297 | Ga0157378_10574870 | Ga0157378_105748702 | 201 |
| 187 | 3300013307 | Ga0157372_10007476 | Ga0157372_100074769 | 201 |
| 188 | 3300014326 | Ga0157380_10820496 | Ga0157380_108204962 | 201 |
| 189 | 3300021384 | Ga0213876_10063155 | Ga0213876_100631552 | 201 |
| 190 | 3300025321 | Ga0207656_10001284 | Ga0207656_100012844 | 201 |
| 191 | 3300025909 | Ga0207705_10113521 | Ga0207705_101135212 | 201 |
| 192 | 3300025909 | Ga0207705_10190072 | Ga0207705_101900721 | 201 |
| 193 | 3300025913 | Ga0207695_10037818 | Ga0207695_100378184 | 201 |
| 194 | 3300025913 | Ga0207695_10086080 | Ga0207695_100860804 | 201 |
| 195 | 3300025920 | Ga0207649_10158856 | Ga0207649_101588562 | 201 |
| 196 | 3300025921 | Ga0207652_10123731 | Ga0207652_101237313 | 201 |
| 197 | 3300025924 | Ga0207694_10070723 | Ga0207694_100707232 | 201 |
| 198 | 3300025924 | Ga0207694_10611746 | Ga0207694_106117462 | 201 |
| 199 | 3300025932 | Ga0207690_10017119 | Ga0207690_100171193 | 201 |
| 200 | 3300025949 | Ga0207667_10019494 | Ga0207667_100194943 | 201 |
| 201 | 3300026041 | Ga0207639_10014767 | Ga0207639_100147672 | 201 |
| 202 | 3300026142 | Ga0207698_10008064 | Ga0207698_100080645 | 201 |
| 203 | 3300031238 | Ga0265332_10232193 | Ga0265332_102321931 | 201 |
| 204 | 3300031548 | Ga0307408_100157304 | Ga0307408_1001573042 | 201 |
| 205 | 3300031711 | Ga0265314_10017890 | Ga0265314_100178904 | 201 |
| 206 | 3300031731 | Ga0307405_10153349 | Ga0307405_101533493 | 201 |
| 207 | 3300031901 | Ga0307406_10739622 | Ga0307406_107396221 | 201 |
| 208 | 3300031995 | Ga0307409_100397062 | Ga0307409_1003970622 | 201 |
| 209 | 3300032002 | Ga0307416_100052866 | Ga0307416_1000528662 | 201 |
| 210 | 3300037312 | Ga0395899_0145709 | Ga0395899_0145709_493_1122 | 201 |
| 211 | 3300037466 | Ga0395898_0620122 | Ga0395898_0620122_179_808 | 201 |
| 212 | 3300037471 | Ga0395905_0068916 | Ga0395905_0068916_253_882 | 201 |
| 213 | 3300039437 | Ga0436365_1337187 | Ga0436365_1337187_1636_2262 | 201 |
| 214 | 3300044693 | Ga0466961_0466001 | Ga0466961_0466001_67_696 | 201 |
| 215 | 3300044842 | Ga0466957_0003806 | Ga0466957_0003806_38_667 | 201 |
| 216 | 3300046683 | Ga0495658_0139486 | Ga0495658_0139486_399_1022 | 201 |
| 217 | 3300047444 | Ga0495675_0230451 | Ga0495675_0230451_238_867 | 201 |
| 218 | 3300048907 | Ga0496104_0015911 | Ga0496104_0015911_926_1564 | 201 |
| 219 | 3300048908 | Ga0496105_0119650 | Ga0496105_0119650_840_1478 | 201 |
| 220 | 3300048912 | Ga0496109_0235949 | Ga0496109_0235949_293_931 | 201 |
| 221 | 3300048913 | Ga0496110_0441964 | Ga0496110_0441964_21_659 | 201 |
| 222 | 3300048914 | Ga0496111_0059390 | Ga0496111_0059390_1150_1788 | 201 |
| 223 | 3300005330 | Ga0070690_100234064 | Ga0070690_1002340642 | 202 |
| 224 | 3300005336 | Ga0070680_100408733 | Ga0070680_1004087331 | 202 |
| 225 | 3300005345 | Ga0070692_10021950 | Ga0070692_100219502 | 202 |
| 226 | 3300005438 | Ga0070701_10057424 | Ga0070701_100574243 | 202 |
| 227 | 3300005441 | Ga0070700_100104776 | Ga0070700_1001047762 | 202 |
| 228 | 3300005444 | Ga0070694_100229112 | Ga0070694_1002291122 | 202 |
| 229 | 3300005459 | Ga0068867_100046276 | Ga0068867_1000462764 | 202 |
| 230 | 3300005466 | Ga0070685_10119421 | Ga0070685_101194213 | 202 |
| 231 | 3300005539 | Ga0068853_100570391 | Ga0068853_1005703912 | 202 |
| 232 | 3300005544 | Ga0070686_100017048 | Ga0070686_1000170483 | 202 |
| 233 | 3300005546 | Ga0070696_100065036 | Ga0070696_1000650362 | 202 |
| 234 | 3300005546 | Ga0070696_100463108 | Ga0070696_1004631081 | 202 |
| 235 | 3300005549 | Ga0070704_100102155 | Ga0070704_1001021553 | 202 |
| 236 | 3300005617 | Ga0068859_100127145 | Ga0068859_1001271452 | 202 |
| 237 | 3300005841 | Ga0068863_100282361 | Ga0068863_1002823611 | 202 |
| 238 | 3300005842 | Ga0068858_100061889 | Ga0068858_1000618894 | 202 |
| 239 | 3300005843 | Ga0068860_100760692 | Ga0068860_1007606922 | 202 |
| 240 | 3300006881 | Ga0068865_100109404 | Ga0068865_1001094042 | 202 |
| 241 | 3300006931 | Ga0097620_100127137 | Ga0097620_1001271373 | 202 |
| 242 | 3300009148 | Ga0105243_10203016 | Ga0105243_102030163 | 202 |
| 243 | 3300009176 | Ga0105242_10241229 | Ga0105242_102412292 | 202 |
| 244 | 3300009553 | Ga0105249_10317895 | Ga0105249_103178952 | 202 |
| 245 | 3300014325 | Ga0163163_10388798 | Ga0163163_103887981 | 202 |
| 246 | 3300014326 | Ga0157380_10649355 | Ga0157380_106493551 | 202 |
| 247 | 3300014968 | Ga0157379_10271267 | Ga0157379_102712672 | 202 |
| 248 | 3300025918 | Ga0207662_10434329 | Ga0207662_104343292 | 202 |
| 249 | 3300025922 | Ga0207646_10428425 | Ga0207646_104284252 | 202 |
| 250 | 3300025927 | Ga0207687_10428967 | Ga0207687_104289672 | 202 |
| 251 | 3300025934 | Ga0207686_10073626 | Ga0207686_100736262 | 202 |
| 252 | 3300025935 | Ga0207709_10153051 | Ga0207709_101530512 | 202 |
| 253 | 3300025938 | Ga0207704_10041199 | Ga0207704_100411992 | 202 |
| 254 | 3300026035 | Ga0207703_10316452 | Ga0207703_103164522 | 202 |
| 255 | 3300026041 | Ga0207639_10520102 | Ga0207639_105201022 | 202 |
| 256 | 3300026075 | Ga0207708_10111631 | Ga0207708_101116312 | 202 |
| 257 | 3300026088 | Ga0207641_10598298 | Ga0207641_105982982 | 202 |
| 258 | 3300026089 | Ga0207648_10014180 | Ga0207648_100141806 | 202 |
| 259 | 3300026118 | Ga0207675_100520283 | Ga0207675_1005202832 | 202 |
| 260 | 3300028381 | Ga0268264_10669073 | Ga0268264_106690732 | 202 |
| 261 | 3300035695 | Ga0373927_0128006 | Ga0373927_0128006_883_1509 | 202 |
| 262 | 3300036401 | Ga0373937_0166695 | Ga0373937_0166695_1184_1813 | 202 |
| 263 | 3300044694 | Ga0466963_0638053 | Ga0466963_0638053_105_725 | 202 |
| 264 | 3300049569 | Ga0501032_0058792 | Ga0501032_0058792_1497_2117 | 202 |
| 265 | 3300049573 | Ga0501037_0117019 | Ga0501037_0117019_982_1602 | 202 |
| 266 | 3300049579 | Ga0501043_0226729 | Ga0501043_0226729_501_1121 | 202 |
| 267 | 3300049584 | Ga0501068_0001055 | Ga0501068_0001055_3830_4450 | 202 |
| 268 | 3300049586 | Ga0501070_0003078 | Ga0501070_0003078_7703_8323 | 202 |
| 269 | 3300049589 | Ga0501073_0003022 | Ga0501073_0003022_5063_5683 | 202 |
| 270 | 3300049590 | Ga0501074_0019604 | Ga0501074_0019604_2348_2968 | 202 |
| 271 | 3300049741 | Ga0501079_0512296 | Ga0501079_0512296_17_637 | 202 |
| 272 | 3300049742 | Ga0501080_0012613 | Ga0501080_0012613_2046_2666 | 202 |
| 273 | 3300049742 | Ga0501080_0247426 | Ga0501080_0247426_86_715 | 202 |
| 274 | 3300049742 | Ga0501080_0280341 | Ga0501080_0280341_644_1273 | 202 |
| 275 | 3300049743 | Ga0501081_0324446 | Ga0501081_0324446_373_993 | 202 |
| 276 | 3300049744 | Ga0501083_0033393 | Ga0501083_0033393_1365_1985 | 202 |
| 277 | 3300049822 | Ga0501035_0478225 | Ga0501035_0478225_367_996 | 202 |
| 278 | 3300054114 | Ga0501084_0101114 | Ga0501084_0101114_563_1183 | 202 |
| 279 | 3300005367 | Ga0070667_100997956 | Ga0070667_1009979561 | 204 |
| 280 | 3300005455 | Ga0070663_100181721 | Ga0070663_1001817211 | 204 |
| 281 | 3300005458 | Ga0070681_10012559 | Ga0070681_100125593 | 204 |
| 282 | 3300005539 | Ga0068853_100005566 | Ga0068853_1000055665 | 204 |
| 283 | 3300005545 | Ga0070695_100319800 | Ga0070695_1003198001 | 204 |
| 284 | 3300005563 | Ga0068855_100298044 | Ga0068855_1002980442 | 204 |
| 285 | 3300005577 | Ga0068857_100023233 | Ga0068857_1000232334 | 204 |
| 286 | 3300005842 | Ga0068858_100501783 | Ga0068858_1005017831 | 204 |
| 287 | 3300006237 | Ga0097621_100557775 | Ga0097621_1005577752 | 204 |
| 288 | 3300009174 | Ga0105241_10004571 | Ga0105241_100045712 | 204 |
| 289 | 3300009177 | Ga0105248_10384790 | Ga0105248_103847902 | 204 |
| 290 | 3300010375 | Ga0105239_10050315 | Ga0105239_100503153 | 204 |
| 291 | 3300013307 | Ga0157372_11046454 | Ga0157372_110464542 | 204 |
| 292 | 3300025912 | Ga0207707_10027772 | Ga0207707_100277723 | 204 |
| 293 | 3300026035 | Ga0207703_10615556 | Ga0207703_106155561 | 204 |
| 294 | 3300026041 | Ga0207639_10005193 | Ga0207639_100051935 | 204 |
| 295 | 3300026067 | Ga0207678_10519429 | Ga0207678_105194291 | 204 |
| 296 | 3300026116 | Ga0207674_10032783 | Ga0207674_100327834 | 204 |
| 297 | 3300035119 | Ga0373956_0074945 | Ga0373956_0074945_785_1417 | 204 |
| 298 | 3300048907 | Ga0496104_0946294 | Ga0496104_0946294_116_748 | 204 |
| 299 | 3300048917 | Ga0496114_0572532 | Ga0496114_0572532_287_919 | 204 |
| 300 | 3300025910 | Ga0207684_10778562 | Ga0207684_107785621 | 205 |
| 301 | 3300003323 | rootH1_10098422 | rootH1_100984226 | 206 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ol5-assembly1.cif.gz_A | crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus | 0.8993 | 11 | 202 |
| 2ol5-assembly1.cif.gz_B | crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus | 0.8904 | 10 | 201 |
| 2ol5-assembly1.cif.gz_A | crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus | 0.8901 | 11 | 202 |
| 2ol5-assembly1.cif.gz_B | crystal structure of a protease synthase and sporulation negative regulatory protein pai 2 from bacillus stearothermophilus | 0.8815 | 10 | 201 |
| 6rk0-assembly1.cif.gz_B | structure of the flavocytochrome anf3 from azotobacter vinelandii | 0.8523 | 7 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PQI8_1_209_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.9102 | 1 | 203 | 2.30.110.10 |
| af_A0A1D8PQI8_1_209_2.30.110.10 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8935 | 1 | 203 | 2.30.110.10 |
| 2ol5A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8544 | 11 | 200 | 2.30.110.10 |
| 2ol5A00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.8411 | 11 | 200 | 2.30.110.10 |
| 4ybnB00 | Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A | 0.828 | 7 | 169 | 2.30.110.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y3H251-F1-model_v4 | FMN-binding negative transcriptional regulator | 0.963 | 1 | 203 |
|
| AF-A0A494YD85-F1-model_v4 | FMN-binding negative transcriptional regulator | 0.9532 | 1 | 203 |
|
| AF-A0A2U1RTT8-F1-model_v4 | deleted | 0.9528 | 1 | 203 |
|
| AF-A0A1F7QG36-F1-model_v4 | Transcriptional regulator | 0.9522 | 1 | 204 |
|
| AF-A0A1Q5VL68-F1-model_v4 | deleted | 0.9508 | 1 | 203 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar