F395578

General Info

Members Datasets Scaffolds Average Seq Length
300 169 600 169

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0630378|Ga0501033_0630378_216_719
Length 167
Sequence VLDWGAGARRCAIGRGGIAVKGGEGDGITPRGRWPVREIFYRPDRIARPQVMLPLRAIRPQDGWCDAPHDANYNRLVTLPYRASAERMWRDDHLYDLVAVLGYNDDPVVPGKGSAIFLHLTRSGGESRSDALKEPDYSVTQGCVALAFADALAALEQLQPGDAVTIE

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
72 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
121 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
139 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
158 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
159 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
160 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
161 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
162 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
163 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
168 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
169 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.33
Nodule 0
Rhizoplane 0.33
Rhizosphere 92.67
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0630378 3300049570 Bacteria 733
2 JGI25165J46597_1000035 3300003214 Bacteria 290723
3 Ga0070658_10005258 3300005327 Bacteria 10513
4 Ga0070658_10047043 3300005327 Bacteria 3491
5 Ga0070658_10063946 3300005327 Bacteria 3001
6 Ga0070676_10001376 3300005328 Bacteria 12257
7 Ga0070683_100025508 3300005329 Bacteria 5310
8 Ga0070683_100032417 3300005329 Bacteria 4758
9 Ga0070690_100018184 3300005330 Bacteria 4241
10 Ga0070670_101084089 3300005331 Bacteria 730
11 Ga0068869_100116264 3300005334 Bacteria 2040
12 Ga0070666_10010153 3300005335 Bacteria 5882
13 Ga0070680_100375949 3300005336 Bacteria 1209
14 Ga0068868_100023583 3300005338 Bacteria 4658
15 Ga0068868_100050623 3300005338 Bacteria 3263
16 Ga0068868_101103748 3300005338 Bacteria 730
17 Ga0070660_100053981 3300005339 Bacteria 3101
18 Ga0070660_100167826 3300005339 Bacteria 1771
19 Ga0070661_100071985 3300005344 Bacteria 2544
20 Ga0070661_100282164 3300005344 Bacteria 1289
21 Ga0070675_100083418 3300005354 Bacteria 2668
22 Ga0070674_100288658 3300005356 Bacteria 1303
23 Ga0070688_100335512 3300005365 Bacteria 1102
24 Ga0070659_100133774 3300005366 Bacteria 2016
25 Ga0070667_100011320 3300005367 Bacteria 7377
26 Ga0070667_100176844 3300005367 Bacteria 1886
27 Ga0070678_100230461 3300005456 Bacteria 1544
28 Ga0070662_101406199 3300005457 Bacteria 601
29 Ga0070681_10107480 3300005458 Bacteria 2731
30 Ga0068867_100009845 3300005459 Bacteria 6736
31 Ga0070685_10241289 3300005466 Bacteria 1193
32 Ga0070679_100013853 3300005530 Bacteria 7726
33 Ga0070679_100934837 3300005530 Bacteria 811
34 Ga0070684_100068978 3300005535 Bacteria 3108
35 Ga0068853_100337515 3300005539 Bacteria 1400
36 Ga0068853_100758035 3300005539 Bacteria 928
37 Ga0070672_100787477 3300005543 Unclassified 836
38 Ga0070693_100308723 3300005547 Bacteria 1069
39 Ga0070665_100000943 3300005548 Bacteria 37102
40 Ga0070665_100291323 3300005548 Bacteria 1635
41 Ga0070665_100317286 3300005548 Bacteria 1563
42 Ga0068855_100090716 3300005563 Bacteria 3526
43 Ga0068855_100841967 3300005563 Bacteria 972
44 Ga0070664_100592209 3300005564 Bacteria 1028
45 Ga0068857_101116092 3300005577 Bacteria 762
46 Ga0068854_100155158 3300005578 Bacteria 1769
47 Ga0068856_100035238 3300005614 Bacteria 4904
48 Ga0068856_100062911 3300005614 Bacteria 3665
49 Ga0068856_100098490 3300005614 Bacteria 2914
50 Ga0068856_100398099 3300005614 Bacteria 1397
51 Ga0070702_100079117 3300005615 Bacteria 1964
52 Ga0070702_100387017 3300005615 Bacteria 996
53 Ga0068852_100641846 3300005616 Bacteria 1069
54 Ga0068864_100130554 3300005618 Bacteria 2256
55 Ga0068866_11019384 3300005718 Bacteria 589
56 Ga0068861_100384938 3300005719 Bacteria 1240
57 Ga0068851_10058067 3300005834 Bacteria 1977
58 Ga0068863_100596833 3300005841 Bacteria 1093
59 Ga0068858_100044564 3300005842 Bacteria 4111
60 Ga0068860_100089223 3300005843 Bacteria 2935
61 Ga0068860_100113478 3300005843 Bacteria 2591
62 Ga0068860_100301701 3300005843 Bacteria 1569
63 Ga0068862_100261093 3300005844 Bacteria 1581
64 Ga0097621_100002964 3300006237 Bacteria 11650
65 Ga0097621_100022475 3300006237 Bacteria 4896
66 Ga0097621_100142797 3300006237 Bacteria 2047
67 Ga0097621_100159929 3300006237 Bacteria 1936
68 Ga0097621_100247257 3300006237 Bacteria 1561
69 Ga0068871_100001250 3300006358 Bacteria 16986
70 Ga0068871_100014477 3300006358 Bacteria 5885
71 Ga0068871_100075994 3300006358 Bacteria 2773
72 Ga0068871_100398004 3300006358 Bacteria 1226
73 Ga0068865_100657620 3300006881 Bacteria 891
74 Ga0105250_10082330 3300009092 Bacteria 1305
75 Ga0105240_10038579 3300009093 Bacteria 6125
76 Ga0105240_10072282 3300009093 Bacteria 4263
77 Ga0105240_10074440 3300009093 Bacteria 4192
78 Ga0105240_10076332 3300009093 Bacteria 4131
79 Ga0105240_10253678 3300009093 Bacteria 2033
80 Ga0105240_10294065 3300009093 Bacteria 1860
81 Ga0105240_11707538 3300009093 Unclassified 657
82 Ga0105245_10876810 3300009098 Bacteria 938
83 Ga0105243_10036052 3300009148 Bacteria 3836
84 Ga0105243_10468159 3300009148 Bacteria 1186
85 Ga0105243_11407477 3300009148 Bacteria 718
86 Ga0105241_10009812 3300009174 Bacteria 7036
87 Ga0105241_10113035 3300009174 Bacteria 2176
88 Ga0105241_10143348 3300009174 Bacteria 1948
89 Ga0105241_10386184 3300009174 Bacteria 1225
90 Ga0105241_10408755 3300009174 Bacteria 1192
91 Ga0105242_10026481 3300009176 Bacteria 4597
92 Ga0105242_10036803 3300009176 Bacteria 3928
93 Ga0105242_10798226 3300009176 Bacteria 934
94 Ga0105248_10323947 3300009177 Bacteria 1736
95 Ga0105237_10038414 3300009545 Bacteria 4834
96 Ga0105237_10493231 3300009545 Bacteria 1231
97 Ga0105237_10752741 3300009545 Bacteria 981
98 Ga0105237_11662229 3300009545 Unclassified 646
99 Ga0105238_10030554 3300009551 Bacteria 5484
100 Ga0105238_10074658 3300009551 Bacteria 3383
101 Ga0105238_10228092 3300009551 Unclassified 1839
102 Ga0105238_10373226 3300009551 Bacteria 1417
103 Ga0105249_10016114 3300009553 Bacteria 6626
104 Ga0105249_12368430 3300009553 Unclassified 604
105 Ga0105239_10054643 3300010375 Bacteria 4381
106 Ga0105239_10139770 3300010375 Bacteria 2698
107 Ga0105239_10252692 3300010375 Bacteria 1980
108 Ga0105239_10521337 3300010375 Bacteria 1352
109 Ga0105239_10746303 3300010375 Bacteria 1120
110 Ga0105239_12160285 3300010375 Bacteria 647
111 Ga0105246_10009740 3300011119 Bacteria 5923
112 Ga0105246_10017403 3300011119 Bacteria 4567
113 Ga0157370_10065059 3300013104 Bacteria 3451
114 Ga0157370_10623994 3300013104 Bacteria 986
115 Ga0157369_10216696 3300013105 Bacteria 2005
116 Ga0157369_10377322 3300013105 Bacteria 1472
117 Ga0157374_10100273 3300013296 Bacteria 2776
118 Ga0157374_10444701 3300013296 Bacteria 1297
119 Ga0157378_10029713 3300013297 Bacteria 4826
120 Ga0157378_10167200 3300013297 Bacteria 2061
121 Ga0157378_10411493 3300013297 Bacteria 1335
122 Ga0163162_10026910 3300013306 Bacteria 5687
123 Ga0163162_10051586 3300013306 Bacteria 4128
124 Ga0163162_10195162 3300013306 Bacteria 2153
125 Ga0157372_10023327 3300013307 Bacteria 6706
126 Ga0157375_10757201 3300013308 Bacteria 1122
127 Ga0163163_10044744 3300014325 Bacteria 4343
128 Ga0163163_10137903 3300014325 Bacteria 2481
129 Ga0163163_10623955 3300014325 Bacteria 1141
130 Ga0157380_10111173 3300014326 Bacteria 2303
131 Ga0157379_10250516 3300014968 Bacteria 1608
132 Ga0157379_10320061 3300014968 Bacteria 1416
133 Ga0157376_10341510 3300014969 Bacteria 1430
134 Ga0157376_11684153 3300014969 Unclassified 669
135 Ga0157376_12046992 3300014969 Bacteria 610
136 Ga0213871_10035658 3300021441 Bacteria 1317
137 Ga0209233_1000006 3300025261 Bacteria 1473685
138 Ga0209233_1005387 3300025261 Bacteria 4246
139 Ga0207680_10040875 3300025903 Bacteria 2702
140 Ga0207680_10041662 3300025903 Bacteria 2681
141 Ga0207680_10722121 3300025903 Bacteria 714
142 Ga0207645_10005584 3300025907 Bacteria 9097
143 Ga0207705_10025387 3300025909 Bacteria 4230
144 Ga0207705_10506999 3300025909 Bacteria 937
145 Ga0207654_10005866 3300025911 Bacteria 6192
146 Ga0207654_10008911 3300025911 Bacteria 5089
147 Ga0207654_10148205 3300025911 Bacteria 1503
148 Ga0207654_10376772 3300025911 Bacteria 982
149 Ga0207654_10543136 3300025911 Bacteria 825
150 Ga0207707_10403356 3300025912 Bacteria 1173
151 Ga0207695_10067233 3300025913 Bacteria 3677
152 Ga0207695_10079371 3300025913 Bacteria 3327
153 Ga0207695_10157333 3300025913 Bacteria 2206
154 Ga0207695_10459333 3300025913 Bacteria 1156
155 Ga0207671_10064947 3300025914 Bacteria 2714
156 Ga0207657_10004729 3300025919 Bacteria 14373
157 Ga0207657_10013506 3300025919 Bacteria 8009
158 Ga0207649_10106288 3300025920 Bacteria 1867
159 Ga0207649_10267444 3300025920 Bacteria 1238
160 Ga0207652_10018172 3300025921 Bacteria 5763
161 Ga0207652_10882693 3300025921 Unclassified 791
162 Ga0207681_10023652 3300025923 Bacteria 3933
163 Ga0207694_10168267 3300025924 Bacteria 1773
164 Ga0207694_10330665 3300025924 Bacteria 1259
165 Ga0207650_10580525 3300025925 Bacteria 941
166 Ga0207650_10759154 3300025925 Unclassified 821
167 Ga0207659_10062352 3300025926 Bacteria 2691
168 Ga0207687_10585340 3300025927 Bacteria 939
169 Ga0207690_10242255 3300025932 Bacteria 1389
170 Ga0207706_10727253 3300025933 Bacteria 847
171 Ga0207686_10049477 3300025934 Bacteria 2610
172 Ga0207686_10245089 3300025934 Bacteria 1306
173 Ga0207709_10017501 3300025935 Bacteria 4000
174 Ga0207704_10237401 3300025938 Bacteria 1360
175 Ga0207665_10558276 3300025939 Bacteria 890
176 Ga0207691_10075822 3300025940 Bacteria 3032
177 Ga0207711_10061109 3300025941 Bacteria 3248
178 Ga0207689_10244603 3300025942 Bacteria 1483
179 Ga0207689_10460283 3300025942 Unclassified 1064
180 Ga0207661_10238318 3300025944 Bacteria 1613
181 Ga0207679_10550083 3300025945 Bacteria 1035
182 Ga0207667_10072405 3300025949 Bacteria 3582
183 Ga0207667_10385308 3300025949 Bacteria 1428
184 Ga0207667_10621766 3300025949 Unclassified 1088
185 Ga0207651_10580665 3300025960 Bacteria 978
186 Ga0207651_10980511 3300025960 Bacteria 755
187 Ga0207651_11165222 3300025960 Bacteria 691
188 Ga0207712_10117749 3300025961 Bacteria 2004
189 Ga0207640_10059391 3300025981 Bacteria 2524
190 Ga0207640_10287347 3300025981 Bacteria 1295
191 Ga0207658_10008678 3300025986 Bacteria 6904
192 Ga0207658_10072338 3300025986 Bacteria 2613
193 Ga0207677_10147217 3300026023 Bacteria 1812
194 Ga0207677_10308256 3300026023 Bacteria 1311
195 Ga0207703_10031788 3300026035 Bacteria 4175
196 Ga0207703_10054740 3300026035 Bacteria 3245
197 Ga0207703_10845053 3300026035 Bacteria 875
198 Ga0207639_10080024 3300026041 Bacteria 2584
199 Ga0207708_10203523 3300026075 Bacteria 1580
200 Ga0207702_10028753 3300026078 Bacteria 4623
201 Ga0207702_10121736 3300026078 Bacteria 2336
202 Ga0207702_10218143 3300026078 Unclassified 1777
203 Ga0207648_10009752 3300026089 Bacteria 9178
204 Ga0207648_10309925 3300026089 Bacteria 1417
205 Ga0207676_10048446 3300026095 Bacteria 3299
206 Ga0207676_10121417 3300026095 Bacteria 2204
207 Ga0207675_100741854 3300026118 Bacteria 993
208 Ga0207683_10089943 3300026121 Bacteria 2733
209 Ga0207683_10246009 3300026121 Bacteria 1632
210 Ga0207683_10943402 3300026121 Bacteria 801
211 Ga0207698_10550006 3300026142 Bacteria 1131
212 Ga0207698_11961014 3300026142 Bacteria 600
213 Ga0268266_10000463 3300028379 Bacteria 59089
214 Ga0268266_10016894 3300028379 Bacteria 6235
215 Ga0268266_10072397 3300028379 Bacteria 2989
216 Ga0268265_11129830 3300028380 Bacteria 779
217 Ga0268264_10572608 3300028381 Bacteria 1110
218 Ga0265338_10001087 3300028800 Bacteria 45161
219 Ga0265330_10012852 3300031235 Bacteria 3908
220 Ga0265325_10002373 3300031241 Bacteria 12725
221 Ga0265329_10056135 3300031242 Bacteria 1249
222 Ga0265339_10033618 3300031249 Bacteria 2886
223 Ga0265339_10049351 3300031249 Bacteria 2305
224 Ga0265331_10013085 3300031250 Bacteria 4469
225 Ga0265316_10035563 3300031344 Bacteria 4035
226 Ga0265313_10002778 3300031595 Bacteria 14762
227 Ga0307508_10572683 3300031616 Unclassified 729
228 Ga0265314_10032836 3300031711 Bacteria 3813
229 Ga0265314_10077477 3300031711 Bacteria 2205
230 Ga0265314_10087821 3300031711 Bacteria 2032
231 Ga0265342_10050038 3300031712 Bacteria 2498
232 Ga0307516_10044047 3300031730 Bacteria 4418
233 Ga0307516_10165563 3300031730 Unclassified 1956
234 Ga0373956_0120925 3300035119 Bacteria 1223
235 Ga0373957_0268916 3300035120 Unclassified 719
236 Ga0436360_0253152 3300039438 Bacteria 910
237 Ga0436362_0621304 3300039453 Bacteria 940
238 Ga0451793_0336818 3300041452 Bacteria 1143
239 Ga0439460_0161174 3300042461 Unclassified 752
240 Ga0495651_0281672 3300046462 Bacteria 1123
241 Ga0495618_0554014 3300046514 Bacteria 688
242 Ga0495654_0080506 3300046530 Bacteria 1528
243 Ga0495587_0555840 3300046536 Bacteria 633
244 Ga0495609_0050783 3300046538 Bacteria 1848
245 Ga0495625_0313678 3300046660 Unclassified 1000
246 Ga0495649_0543913 3300046694 Bacteria 575
247 Ga0495683_0320182 3300047323 Unclassified 661
248 Ga0496121_0010217 3300048924 Bacteria 10624
249 Ga0496126_0042508 3300048929 Bacteria 4197
250 Ga0501032_0447073 3300049569 Bacteria 828
251 Ga0501032_0494497 3300049569 Bacteria 782
252 Ga0501033_0002118 3300049570 Bacteria 17169
253 Ga0501033_0036435 3300049570 Bacteria 3686
254 Ga0501033_0676645 3300049570 Bacteria 703
255 Ga0501034_0026448 3300049571 Bacteria 5909
256 Ga0501034_0027440 3300049571 Bacteria 5792
257 Ga0501034_0168816 3300049571 Bacteria 2156
258 Ga0501034_0248363 3300049571 Bacteria 1724
259 Ga0501034_0512057 3300049571 Bacteria 1113
260 Ga0501036_0685207 3300049572 Bacteria 847
261 Ga0501037_0068584 3300049573 Bacteria 2582
262 Ga0501038_0033216 3300049574 Bacteria 4546
263 Ga0501043_0106556 3300049579 Bacteria 2202
264 Ga0501046_0428122 3300049580 Bacteria 953
265 Ga0501047_0010064 3300049581 Bacteria 8941
266 Ga0501047_0010368 3300049581 Bacteria 8815
267 Ga0501047_0069409 3300049581 Bacteria 3394
268 Ga0501047_0197112 3300049581 Bacteria 1876
269 Ga0501047_0332786 3300049581 Bacteria 1357
270 Ga0501047_0388118 3300049581 Bacteria 1230
271 Ga0501047_0617141 3300049581 Bacteria 905
272 Ga0501048_0100230 3300049582 Bacteria 2043
273 Ga0501080_0222856 3300049742 Bacteria 1725
274 Ga0501083_0076132 3300049744 Bacteria 2227
275 Ga0501035_0002523 3300049822 Bacteria 17906
276 Ga0501035_0014040 3300049822 Bacteria 7390
277 Ga0501035_0153214 3300049822 Bacteria 1999
278 Ga0501035_0233626 3300049822 Bacteria 1566
279 Ga0501035_0921660 3300049822 Bacteria 691
280 Ga0501044_0007608 3300049823 Bacteria 11911
281 Ga0501044_0174439 3300049823 Bacteria 2119
282 Ga0501044_0378212 3300049823 Bacteria 1331
283 Ga0501044_0382521 3300049823 Bacteria 1322
284 Ga0501044_0463598 3300049823 Bacteria 1172
285 Ga0501044_0486183 3300049823 Bacteria 1137
286 Ga0501044_0672788 3300049823 Unclassified 922
287 Ga0500635_0031242 3300053080 Bacteria 1723
288 Ga0500643_000027 3300053087 Bacteria 251062
289 Ga0500646_0093577 3300053090 Bacteria 934
290 Ga0500641_0310813 3300053096 Bacteria 644
291 Ga0500555_026912 3300053103 Unclassified 1642
292 Ga0500555_031722 3300053103 Unclassified 1496
293 Ga0500592_028600 3300053116 Bacteria 899
294 Ga0500595_043676 3300053119 Bacteria 1425
295 Ga0500595_044539 3300053119 Bacteria 1405
296 Ga0500642_0198730 3300053130 Bacteria 934
297 Ga0500568_0063464 3300053139 Bacteria 1425
298 Ga0500573_0000032 3300053140 Bacteria 131098
299 Ga0500645_072300 3300053730 Bacteria 989
300 Ga0501082_0007696 3300060353 Bacteria 9302
301 Ga0501033_0630378
302 JGI25165J46597_1000035
303 Ga0070658_10005258
304 Ga0070658_10047043
305 Ga0070658_10063946
306 Ga0070676_10001376
307 Ga0070683_100025508
308 Ga0070683_100032417
309 Ga0070690_100018184
310 Ga0070670_101084089
311 Ga0068869_100116264
312 Ga0070666_10010153
313 Ga0070680_100375949
314 Ga0068868_100023583
315 Ga0068868_100050623
316 Ga0068868_101103748
317 Ga0070660_100053981
318 Ga0070660_100167826
319 Ga0070661_100071985
320 Ga0070661_100282164
321 Ga0070675_100083418
322 Ga0070674_100288658
323 Ga0070688_100335512
324 Ga0070659_100133774
325 Ga0070667_100011320
326 Ga0070667_100176844
327 Ga0070678_100230461
328 Ga0070662_101406199
329 Ga0070681_10107480
330 Ga0068867_100009845
331 Ga0070685_10241289
332 Ga0070679_100013853
333 Ga0070679_100934837
334 Ga0070684_100068978
335 Ga0068853_100337515
336 Ga0068853_100758035
337 Ga0070672_100787477
338 Ga0070693_100308723
339 Ga0070665_100000943
340 Ga0070665_100291323
341 Ga0070665_100317286
342 Ga0068855_100090716
343 Ga0068855_100841967
344 Ga0070664_100592209
345 Ga0068857_101116092
346 Ga0068854_100155158
347 Ga0068856_100035238
348 Ga0068856_100062911
349 Ga0068856_100098490
350 Ga0068856_100398099
351 Ga0070702_100079117
352 Ga0070702_100387017
353 Ga0068852_100641846
354 Ga0068864_100130554
355 Ga0068866_11019384
356 Ga0068861_100384938
357 Ga0068851_10058067
358 Ga0068863_100596833
359 Ga0068858_100044564
360 Ga0068860_100089223
361 Ga0068860_100113478
362 Ga0068860_100301701
363 Ga0068862_100261093
364 Ga0097621_100002964
365 Ga0097621_100022475
366 Ga0097621_100142797
367 Ga0097621_100159929
368 Ga0097621_100247257
369 Ga0068871_100001250
370 Ga0068871_100014477
371 Ga0068871_100075994
372 Ga0068871_100398004
373 Ga0068865_100657620
374 Ga0105250_10082330
375 Ga0105240_10038579
376 Ga0105240_10072282
377 Ga0105240_10074440
378 Ga0105240_10076332
379 Ga0105240_10253678
380 Ga0105240_10294065
381 Ga0105240_11707538
382 Ga0105245_10876810
383 Ga0105243_10036052
384 Ga0105243_10468159
385 Ga0105243_11407477
386 Ga0105241_10009812
387 Ga0105241_10113035
388 Ga0105241_10143348
389 Ga0105241_10386184
390 Ga0105241_10408755
391 Ga0105242_10026481
392 Ga0105242_10036803
393 Ga0105242_10798226
394 Ga0105248_10323947
395 Ga0105237_10038414
396 Ga0105237_10493231
397 Ga0105237_10752741
398 Ga0105237_11662229
399 Ga0105238_10030554
400 Ga0105238_10074658
401 Ga0105238_10228092
402 Ga0105238_10373226
403 Ga0105249_10016114
404 Ga0105249_12368430
405 Ga0105239_10054643
406 Ga0105239_10139770
407 Ga0105239_10252692
408 Ga0105239_10521337
409 Ga0105239_10746303
410 Ga0105239_12160285
411 Ga0105246_10009740
412 Ga0105246_10017403
413 Ga0157370_10065059
414 Ga0157370_10623994
415 Ga0157369_10216696
416 Ga0157369_10377322
417 Ga0157374_10100273
418 Ga0157374_10444701
419 Ga0157378_10029713
420 Ga0157378_10167200
421 Ga0157378_10411493
422 Ga0163162_10026910
423 Ga0163162_10051586
424 Ga0163162_10195162
425 Ga0157372_10023327
426 Ga0157375_10757201
427 Ga0163163_10044744
428 Ga0163163_10137903
429 Ga0163163_10623955
430 Ga0157380_10111173
431 Ga0157379_10250516
432 Ga0157379_10320061
433 Ga0157376_10341510
434 Ga0157376_11684153
435 Ga0157376_12046992
436 Ga0213871_10035658
437 Ga0209233_1000006
438 Ga0209233_1005387
439 Ga0207680_10040875
440 Ga0207680_10041662
441 Ga0207680_10722121
442 Ga0207645_10005584
443 Ga0207705_10025387
444 Ga0207705_10506999
445 Ga0207654_10005866
446 Ga0207654_10008911
447 Ga0207654_10148205
448 Ga0207654_10376772
449 Ga0207654_10543136
450 Ga0207707_10403356
451 Ga0207695_10067233
452 Ga0207695_10079371
453 Ga0207695_10157333
454 Ga0207695_10459333
455 Ga0207671_10064947
456 Ga0207657_10004729
457 Ga0207657_10013506
458 Ga0207649_10106288
459 Ga0207649_10267444
460 Ga0207652_10018172
461 Ga0207652_10882693
462 Ga0207681_10023652
463 Ga0207694_10168267
464 Ga0207694_10330665
465 Ga0207650_10580525
466 Ga0207650_10759154
467 Ga0207659_10062352
468 Ga0207687_10585340
469 Ga0207690_10242255
470 Ga0207706_10727253
471 Ga0207686_10049477
472 Ga0207686_10245089
473 Ga0207709_10017501
474 Ga0207704_10237401
475 Ga0207665_10558276
476 Ga0207691_10075822
477 Ga0207711_10061109
478 Ga0207689_10244603
479 Ga0207689_10460283
480 Ga0207661_10238318
481 Ga0207679_10550083
482 Ga0207667_10072405
483 Ga0207667_10385308
484 Ga0207667_10621766
485 Ga0207651_10580665
486 Ga0207651_10980511
487 Ga0207651_11165222
488 Ga0207712_10117749
489 Ga0207640_10059391
490 Ga0207640_10287347
491 Ga0207658_10008678
492 Ga0207658_10072338
493 Ga0207677_10147217
494 Ga0207677_10308256
495 Ga0207703_10031788
496 Ga0207703_10054740
497 Ga0207703_10845053
498 Ga0207639_10080024
499 Ga0207708_10203523
500 Ga0207702_10028753
501 Ga0207702_10121736
502 Ga0207702_10218143
503 Ga0207648_10009752
504 Ga0207648_10309925
505 Ga0207676_10048446
506 Ga0207676_10121417
507 Ga0207675_100741854
508 Ga0207683_10089943
509 Ga0207683_10246009
510 Ga0207683_10943402
511 Ga0207698_10550006
512 Ga0207698_11961014
513 Ga0268266_10000463
514 Ga0268266_10016894
515 Ga0268266_10072397
516 Ga0268265_11129830
517 Ga0268264_10572608
518 Ga0265338_10001087
519 Ga0265330_10012852
520 Ga0265325_10002373
521 Ga0265329_10056135
522 Ga0265339_10033618
523 Ga0265339_10049351
524 Ga0265331_10013085
525 Ga0265316_10035563
526 Ga0265313_10002778
527 Ga0307508_10572683
528 Ga0265314_10032836
529 Ga0265314_10077477
530 Ga0265314_10087821
531 Ga0265342_10050038
532 Ga0307516_10044047
533 Ga0307516_10165563
534 Ga0373956_0120925
535 Ga0373957_0268916
536 Ga0436360_0253152
537 Ga0436362_0621304
538 Ga0451793_0336818
539 Ga0439460_0161174
540 Ga0495651_0281672
541 Ga0495618_0554014
542 Ga0495654_0080506
543 Ga0495587_0555840
544 Ga0495609_0050783
545 Ga0495625_0313678
546 Ga0495649_0543913
547 Ga0495683_0320182
548 Ga0496121_0010217
549 Ga0496126_0042508
550 Ga0501032_0447073
551 Ga0501032_0494497
552 Ga0501033_0002118
553 Ga0501033_0036435
554 Ga0501033_0676645
555 Ga0501034_0026448
556 Ga0501034_0027440
557 Ga0501034_0168816
558 Ga0501034_0248363
559 Ga0501034_0512057
560 Ga0501036_0685207
561 Ga0501037_0068584
562 Ga0501038_0033216
563 Ga0501043_0106556
564 Ga0501046_0428122
565 Ga0501047_0010064
566 Ga0501047_0010368
567 Ga0501047_0069409
568 Ga0501047_0197112
569 Ga0501047_0332786
570 Ga0501047_0388118
571 Ga0501047_0617141
572 Ga0501048_0100230
573 Ga0501080_0222856
574 Ga0501083_0076132
575 Ga0501035_0002523
576 Ga0501035_0014040
577 Ga0501035_0153214
578 Ga0501035_0233626
579 Ga0501035_0921660
580 Ga0501044_0007608
581 Ga0501044_0174439
582 Ga0501044_0378212
583 Ga0501044_0382521
584 Ga0501044_0463598
585 Ga0501044_0486183
586 Ga0501044_0672788
587 Ga0500635_0031242
588 Ga0500643_000027
589 Ga0500646_0093577
590 Ga0500641_0310813
591 Ga0500555_026912
592 Ga0500555_031722
593 Ga0500592_028600
594 Ga0500595_043676
595 Ga0500595_044539
596 Ga0500642_0198730
597 Ga0500568_0063464
598 Ga0500573_0000032
599 Ga0500645_072300
600 Ga0501082_0007696

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03734

YkuD

L,D-transpeptidase catalytic domain

3

166

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k73-assembly1.cif.gz_A x-ray crystal structure of an l,d-transpeptidase from mycobacterium tuberculosis h37rv 0.5999 2 167
6fj1-assembly2.cif.gz_B structure of the ldtfm-avibactam carbamoyl enzyme 0.5995 12 167
2hkl-assembly3.cif.gz_C crystal structure of enterococcus faecium l,d-transpeptidase c442s mutant 0.5901 2 167
4a1i-assembly1.cif.gz_A ykud from b.subtilis 0.5757 2 167
5e5l-assembly2.cif.gz_B crystal structure of mycobacterium tuberculosis l,d-transpeptidase 1 at 1.89 angstrom 0.5656 3 166
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.6551 2 167 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.6003 2 167 2.40.440.10
af_P75954_98_241_2.40.440.10 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.5771 12 167 2.40.440.10
6d5aA03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.5462 1 167 2.40.440.10
af_D3ZTW7_50_112_3.30.2180.10 Alpha Beta;2-Layer Sandwich;ATP12-like;ATP12-like 0.5374 1 21 3.30.2180.10
ID Description Score Start End GO Terms
AF-B6R1X9-F1-model_v4 deleted 0.9701 33 167
AF-A0A4R3M1C4-F1-model_v4 L,D-transpeptidase-like protein 0.9668 23 167 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A165RYS3-F1-model_v4 L,D-transpeptidase catalytic domain 0.9666 2 167 GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-A0A7V8DSG7-F1-model_v4 ErfK/YbiS/YcfS/YnhG family protein 0.9662 1 167 GO:0004180
GO:0008360
GO:0009252
GO:0016740
GO:0071555
AF-U7FN90-F1-model_v4 deleted 0.9655 3 167

Map