F395435

General Info

Members Datasets Scaffolds Average Seq Length
300 154 600 258

Family's Representative Sequence

Representative Sequence 3300031344|Ga0265316_10087984|Ga0265316_100879842
Length 281
Sequence VKVPAKLGGAKSPATRSPALRVLVKLGGTLLDSAESRERLAAQIAAARGRGIEMVVVHGGGKQMTRYLAERGIESRFVGGLRVTSPETLDAVLKVLAGSVNHELVASLNRAGALAVGLSGIDAFLVEAEQMSPALGAVGRVTKSNPALLELLTANGYLPVVACVAGDRHGQVYNVNADQMAVACAAAFGARQLIFLTDVEGVLDGAGRVRPVLTAAESRGLVADGVATGGMQAKLNAALAALAGGVEQVRIAPGAAEGVLERVLAGDGIGTRMALDEVPTT

Samples

Sample ID Description Type Environment
1 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
90 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
96 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
97 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
101 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
107 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
108 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
116 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
117 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
124 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
154 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 0.67
Rhizosphere 95.67
Stem 0
Stem Tuber 0
Unclassified 11.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265316_10087984 3300031344 Bacteria 2372
2 Ga0070658_10146804 3300005327 Bacteria 1973
3 Ga0070658_10385870 3300005327 Unclassified 1202
4 Ga0070683_100000001 3300005329 Bacteria 529385
5 Ga0070683_100300857 3300005329 Bacteria 1526
6 Ga0070680_100452287 3300005336 Bacteria 1097
7 Ga0068868_100049349 3300005338 Bacteria 3303
8 Ga0070660_100075972 3300005339 Bacteria 2631
9 Ga0070689_100093987 3300005340 Bacteria 2367
10 Ga0070675_100334060 3300005354 Unclassified 1341
11 Ga0070671_100094650 3300005355 Bacteria 2504
12 Ga0070674_100204082 3300005356 Unclassified 1528
13 Ga0070673_100214377 3300005364 Bacteria 1664
14 Ga0070659_100324183 3300005366 Bacteria 1288
15 Ga0070709_10085511 3300005434 Bacteria 2068
16 Ga0070709_10178560 3300005434 Bacteria 1489
17 Ga0070714_100021389 3300005435 Bacteria 5293
18 Ga0070714_100025411 3300005435 Bacteria 4888
19 Ga0070713_100011413 3300005436 Bacteria 6471
20 Ga0070713_100098191 3300005436 Bacteria 2532
21 Ga0070713_100105907 3300005436 Bacteria 2444
22 Ga0070713_100289036 3300005436 Bacteria 1506
23 Ga0070711_100018512 3300005439 Bacteria 4450
24 Ga0070681_10000540 3300005458 Bacteria 31122
25 Ga0070681_10167335 3300005458 Bacteria 2121
26 Ga0070681_10518345 3300005458 Bacteria 1105
27 Ga0068867_100208380 3300005459 Bacteria 1569
28 Ga0070706_100174141 3300005467 Bacteria 2009
29 Ga0070698_100410943 3300005471 Unclassified 1287
30 Ga0070699_100107424 3300005518 Bacteria 2449
31 Ga0070679_100065593 3300005530 Bacteria 3619
32 Ga0070684_100000055 3300005535 Bacteria 76528
33 Ga0070684_100614190 3300005535 Unclassified 1011
34 Ga0070684_100731403 3300005535 Unclassified 923
35 Ga0068853_100065185 3300005539 Bacteria 3161
36 Ga0068853_100254405 3300005539 Bacteria 1613
37 Ga0070665_100010346 3300005548 Bacteria 9437
38 Ga0070665_100013143 3300005548 Bacteria 8337
39 Ga0068855_100001771 3300005563 Bacteria 26987
40 Ga0068855_100017177 3300005563 Bacteria 8706
41 Ga0068855_100074678 3300005563 Bacteria 3937
42 Ga0068855_100274938 3300005563 Unclassified 1872
43 Ga0068855_100478017 3300005563 Bacteria 1357
44 Ga0068856_100060635 3300005614 Bacteria 3737
45 Ga0068856_100104673 3300005614 Bacteria 2824
46 Ga0068856_100186022 3300005614 Bacteria 2091
47 Ga0068852_100002975 3300005616 Bacteria 11771
48 Ga0068864_100101784 3300005618 Bacteria 2549
49 Ga0068866_10027081 3300005718 Bacteria 2714
50 Ga0068863_100058415 3300005841 Bacteria 3650
51 Ga0068863_100707886 3300005841 Bacteria 1001
52 Ga0068858_100086354 3300005842 Bacteria 2919
53 Ga0068858_100088496 3300005842 Bacteria 2881
54 Ga0068860_100458077 3300005843 Bacteria 1269
55 Ga0070717_10193517 3300006028 Bacteria 1778
56 Ga0070717_10296255 3300006028 Unclassified 1437
57 Ga0070716_100121157 3300006173 Bacteria 1638
58 Ga0068871_100114490 3300006358 Archaea 2272
59 Ga0068871_100803812 3300006358 Bacteria 867
60 Ga0075430_100018232 3300006846 Bacteria 5974
61 Ga0075430_100237878 3300006846 Bacteria 1509
62 Ga0068865_100283181 3300006881 Bacteria 1320
63 Ga0075436_100004456 3300006914 Bacteria 9610
64 Ga0105240_10001309 3300009093 Bacteria 42943
65 Ga0105240_10001665 3300009093 Bacteria 37718
66 Ga0105240_10027864 3300009093 Bacteria 7391
67 Ga0105240_10173727 3300009093 Unclassified 2549
68 Ga0105240_10709972 3300009093 Bacteria 1097
69 Ga0105245_10002890 3300009098 Bacteria 15420
70 Ga0105245_10287715 3300009098 Bacteria 1609
71 Ga0105245_10370847 3300009098 Unclassified 1423
72 Ga0114129_10251775 3300009147 Bacteria 2371
73 Ga0114129_10988366 3300009147 Bacteria 1061
74 Ga0105241_10077883 3300009174 Bacteria 2589
75 Ga0105242_10035151 3300009176 Bacteria 4018
76 Ga0105242_10330382 3300009176 Bacteria 1401
77 Ga0105242_10357650 3300009176 Unclassified 1350
78 Ga0105248_10006545 3300009177 Bacteria 12771
79 Ga0105248_10105389 3300009177 Bacteria 3179
80 Ga0105248_10241891 3300009177 Unclassified 2032
81 Ga0105248_10287847 3300009177 Bacteria 1850
82 Ga0105248_10586261 3300009177 Unclassified 1258
83 Ga0105248_10594002 3300009177 Unclassified 1249
84 Ga0105237_10001398 3300009545 Bacteria 31871
85 Ga0105237_10004447 3300009545 Bacteria 16232
86 Ga0105237_10012137 3300009545 Bacteria 9088
87 Ga0105238_10031403 3300009551 Bacteria 5406
88 Ga0105249_10003456 3300009553 Bacteria 13682
89 Ga0105249_10036211 3300009553 Bacteria 4477
90 Ga0105249_10111330 3300009553 Unclassified 2589
91 Ga0105249_10243888 3300009553 Bacteria 1778
92 Ga0105239_10002231 3300010375 Bacteria 24794
93 Ga0105239_10010808 3300010375 Bacteria 10198
94 Ga0105239_10144424 3300010375 Bacteria 2653
95 Ga0105239_10180157 3300010375 Bacteria 2364
96 Ga0105239_10185927 3300010375 Bacteria 2325
97 Ga0105246_10006956 3300011119 Bacteria 6918
98 Ga0157373_10416062 3300013100 Bacteria 965
99 Ga0157370_10009219 3300013104 Bacteria 10579
100 Ga0157369_10006002 3300013105 Bacteria 14112
101 Ga0157369_10022910 3300013105 Bacteria 6964
102 Ga0157369_10098056 3300013105 Bacteria 3126
103 Ga0157369_10107030 3300013105 Bacteria 2975
104 Ga0157374_10094360 3300013296 Bacteria 2859
105 Ga0157374_10108309 3300013296 Unclassified 2671
106 Ga0157374_10217403 3300013296 Bacteria 1875
107 Ga0157378_10067843 3300013297 Unclassified 3197
108 Ga0157378_10188259 3300013297 Bacteria 1945
109 Ga0157378_10378423 3300013297 Bacteria 1390
110 Ga0163162_10153496 3300013306 Bacteria 2421
111 Ga0157372_10075336 3300013307 Bacteria 3807
112 Ga0157372_10082783 3300013307 Bacteria 3634
113 Ga0157372_10189552 3300013307 Bacteria 2381
114 Ga0157372_10842654 3300013307 Bacteria 1064
115 Ga0157375_10021425 3300013308 Bacteria 5926
116 Ga0157375_10165697 3300013308 Bacteria 2354
117 Ga0157375_10656900 3300013308 Bacteria 1204
118 Ga0163163_10081579 3300014325 Bacteria 3236
119 Ga0163163_10116748 3300014325 Bacteria 2700
120 Ga0163163_10143674 3300014325 Bacteria 2429
121 Ga0163163_10204823 3300014325 Unclassified 2021
122 Ga0157379_10019211 3300014968 Bacteria 6035
123 Ga0157379_10421423 3300014968 Archaea 1229
124 Ga0213876_10092700 3300021384 Bacteria 1600
125 Ga0207680_10118928 3300025903 Bacteria 1725
126 Ga0207699_10019928 3300025906 Bacteria 3586
127 Ga0207699_10224405 3300025906 Bacteria 1284
128 Ga0207654_10038041 3300025911 Bacteria 2697
129 Ga0207707_10054260 3300025912 Bacteria 3489
130 Ga0207707_10085579 3300025912 Bacteria 2754
131 Ga0207707_10393750 3300025912 Bacteria 1190
132 Ga0207695_10008503 3300025913 Bacteria 12837
133 Ga0207695_10026012 3300025913 Bacteria 6538
134 Ga0207695_10028925 3300025913 Bacteria 6134
135 Ga0207695_10071025 3300025913 Bacteria 3556
136 Ga0207695_10076960 3300025913 Bacteria 3390
137 Ga0207695_10402915 3300025913 Bacteria 1252
138 Ga0207671_10016355 3300025914 Bacteria 5768
139 Ga0207671_10093711 3300025914 Bacteria 2265
140 Ga0207663_10018404 3300025916 Bacteria 3915
141 Ga0207657_10406701 3300025919 Bacteria 1070
142 Ga0207649_10227358 3300025920 Bacteria 1332
143 Ga0207652_10167100 3300025921 Bacteria 1973
144 Ga0207694_10267351 3300025924 Bacteria 1402
145 Ga0207687_10004542 3300025927 Bacteria 9234
146 Ga0207687_10021960 3300025927 Bacteria 4244
147 Ga0207700_10009106 3300025928 Bacteria 6184
148 Ga0207700_10075000 3300025928 Bacteria 2619
149 Ga0207700_10093598 3300025928 Bacteria 2378
150 Ga0207700_10281278 3300025928 Bacteria 1431
151 Ga0207644_10224723 3300025931 Bacteria 1490
152 Ga0207686_10034725 3300025934 Bacteria 3020
153 Ga0207686_10172656 3300025934 Bacteria 1526
154 Ga0207686_10300548 3300025934 Unclassified 1192
155 Ga0207711_10022488 3300025941 Bacteria 5272
156 Ga0207711_10187666 3300025941 Bacteria 1883
157 Ga0207711_10228652 3300025941 Bacteria 1703
158 Ga0207711_10236504 3300025941 Bacteria 1674
159 Ga0207711_10604452 3300025941 Unclassified 1023
160 Ga0207661_10000005 3300025944 Bacteria 557888
161 Ga0207661_10031585 3300025944 Bacteria 4093
162 Ga0207661_10061519 3300025944 Bacteria 3034
163 Ga0207661_10243947 3300025944 Bacteria 1595
164 Ga0207661_10304530 3300025944 Bacteria 1429
165 Ga0207661_10562207 3300025944 Bacteria 1045
166 Ga0207667_10010573 3300025949 Bacteria 10778
167 Ga0207667_10011072 3300025949 Bacteria 10506
168 Ga0207667_10059892 3300025949 Bacteria 3986
169 Ga0207651_10158506 3300025960 Bacteria 1771
170 Ga0207712_10067718 3300025961 Bacteria 2556
171 Ga0207703_10236803 3300026035 Bacteria 1639
172 Ga0207639_10123180 3300026041 Bacteria 2134
173 Ga0207639_10215436 3300026041 Bacteria 1655
174 Ga0207702_10041781 3300026078 Bacteria 3845
175 Ga0207702_10085332 3300026078 Bacteria 2751
176 Ga0207641_10009003 3300026088 Bacteria 8246
177 Ga0207641_10322498 3300026088 Bacteria 1465
178 Ga0207698_10002972 3300026142 Bacteria 10156
179 Ga0268266_10079549 3300028379 Bacteria 2854
180 Ga0265323_10000450 3300028653 Bacteria 23541
181 Ga0265338_10055501 3300028800 Bacteria 3523
182 Ga0265325_10001985 3300031241 Bacteria 14090
183 Ga0265325_10097080 3300031241 Unclassified 1447
184 Ga0265325_10136829 3300031241 Bacteria 1168
185 Ga0265331_10068692 3300031250 Bacteria 1661
186 Ga0265316_10008129 3300031344 Bacteria 9770
187 Ga0265316_10025959 3300031344 Bacteria 4881
188 Ga0265316_10138469 3300031344 Bacteria 1830
189 Ga0265316_10169138 3300031344 Bacteria 1631
190 Ga0265316_10208679 3300031344 Bacteria 1446
191 Ga0307509_10500926 3300031507 Unclassified 899
192 Ga0265313_10092780 3300031595 Bacteria 1352
193 Ga0265314_10011671 3300031711 Bacteria 7228
194 Ga0265342_10202154 3300031712 Bacteria 1079
195 Ga0373926_0007282 3300035083 Bacteria 3690
196 Ga0373926_0124481 3300035083 Bacteria 973
197 Ga0373944_0134427 3300035089 Unclassified 862
198 Ga0373923_0163197 3300035111 Bacteria 1017
199 Ga0373953_0057067 3300035117 Bacteria 1589
200 Ga0373953_0080887 3300035117 Bacteria 1350
201 Ga0373954_0071731 3300035118 Unclassified 1646
202 Ga0373956_0054168 3300035119 Unclassified 1807
203 Ga0373943_0023372 3300035170 Bacteria 2874
204 Ga0373946_0031615 3300035171 Bacteria 2122
205 Ga0373955_0159534 3300035172 Bacteria 1330
206 Ga0373935_0046702 3300035692 Bacteria 2736
207 Ga0373927_0000160 3300035695 Bacteria 52914
208 Ga0373927_0006012 3300035695 Bacteria 8314
209 Ga0373927_0007235 3300035695 Bacteria 7531
210 Ga0373933_0029332 3300035724 Unclassified 3181
211 Ga0373933_0035234 3300035724 Unclassified 2922
212 Ga0373933_0238723 3300035724 Bacteria 1169
213 Ga0373947_0000074 3300035725 Bacteria 51177
214 Ga0373947_0054811 3300035725 Bacteria 2407
215 Ga0373947_0153190 3300035725 Bacteria 1486
216 Ga0373937_0004297 3300036401 Bacteria 12074
217 Ga0373937_0010474 3300036401 Bacteria 8096
218 Ga0373937_0079462 3300036401 Bacteria 3031
219 Ga0373937_0142729 3300036401 Bacteria 2241
220 Ga0373937_0203231 3300036401 Unclassified 1862
221 Ga0373925_0000394 3300037068 Bacteria 44652
222 Ga0373925_0038413 3300037068 Bacteria 3540
223 Ga0373925_0086832 3300037068 Bacteria 2387
224 Ga0373925_0130765 3300037068 Bacteria 1957
225 Ga0395900_0137953 3300037418 Bacteria 2499
226 Ga0436364_0264065 3300037853 Bacteria 4090
227 Ga0436364_0604629 3300037853 Bacteria 6119
228 Ga0436364_0916023 3300037853 Unclassified 2921
229 Ga0436364_1200098 3300037853 Bacteria 3970
230 Ga0436365_0259549 3300039437 Bacteria 4895
231 Ga0436365_0492758 3300039437 Bacteria 5709
232 Ga0436365_1921576 3300039437 Bacteria 9957
233 Ga0436363_0952055 3300039450 Bacteria 8111
234 Ga0453684_0196902 3300044712 Bacteria 2352
235 Ga0451576_0066866 3300045051 Bacteria 3741
236 Ga0451576_0135449 3300045051 Bacteria 2568
237 Ga0451576_0277415 3300045051 Bacteria 1753
238 Ga0466958_0213540 3300045836 Unclassified 1230
239 Ga0495592_0062640 3300046454 Bacteria 2730
240 Ga0495651_0037210 3300046462 Bacteria 3788
241 Ga0495651_0198076 3300046462 Bacteria 1408
242 Ga0495580_0003200 3300046472 Bacteria 14024
243 Ga0495580_0030447 3300046472 Bacteria 3908
244 Ga0495580_0068636 3300046472 Bacteria 2479
245 Ga0495580_0243097 3300046472 Bacteria 1234
246 Ga0495582_0023351 3300046473 Bacteria 3384
247 Ga0495662_0136288 3300046476 Bacteria 1207
248 Ga0495664_0084112 3300046477 Bacteria 1909
249 Ga0495594_0164484 3300046499 Unclassified 1262
250 Ga0495628_0065229 3300046516 Bacteria 2849
251 Ga0495628_0444462 3300046516 Bacteria 942
252 Ga0495630_0038873 3300046517 Bacteria 3559
253 Ga0495652_0060657 3300046529 Bacteria 3196
254 Ga0495652_0224771 3300046529 Bacteria 1408
255 Ga0495665_0079637 3300046531 Bacteria 1724
256 Ga0495665_0130440 3300046531 Bacteria 1316
257 Ga0495640_0197994 3300046533 Bacteria 1274
258 Ga0495586_0113424 3300046535 Bacteria 1510
259 Ga0495587_0007454 3300046536 Bacteria 7085
260 Ga0495645_0017407 3300046543 Bacteria 5147
261 Ga0495645_0031500 3300046543 Bacteria 3865
262 Ga0495645_0079134 3300046543 Bacteria 2362
263 Ga0495667_0030327 3300046559 Bacteria 3635
264 Ga0495667_0179304 3300046559 Bacteria 1360
265 Ga0495634_0031290 3300046642 Bacteria 3666
266 Ga0495635_0017997 3300046663 Bacteria 4933
267 Ga0495635_0053275 3300046663 Bacteria 2788
268 Ga0495635_0233853 3300046663 Bacteria 1241
269 Ga0495635_0372287 3300046663 Bacteria 951
270 Ga0495635_0470779 3300046663 Unclassified 829
271 Ga0495623_0060001 3300046679 Bacteria 2388
272 Ga0495623_0086749 3300046679 Unclassified 1929
273 Ga0495623_0096194 3300046679 Bacteria 1810
274 Ga0495624_0062668 3300046690 Bacteria 2326
275 Ga0495600_0056395 3300046809 Bacteria 2567
276 Ga0495600_0185888 3300046809 Bacteria 1338
277 Ga0495604_0178717 3300047317 Bacteria 1486
278 Ga0495674_0048764 3300047319 Bacteria 3746
279 Ga0495674_0108265 3300047319 Bacteria 2358
280 Ga0495680_0277685 3300047322 Bacteria 1181
281 Ga0495675_0010929 3300047444 Bacteria 5690
282 Ga0495684_0015487 3300047471 Bacteria 5868
283 Ga0495684_0017714 3300047471 Bacteria 5486
284 Ga0495684_0024620 3300047471 Bacteria 4632
285 Ga0495684_0059472 3300047471 Bacteria 2910
286 Ga0495684_0157560 3300047471 Bacteria 1695
287 Ga0495602_0027293 3300048088 Bacteria 5489
288 Ga0495602_0039457 3300048088 Bacteria 4348
289 Ga0495602_0305822 3300048088 Unclassified 1162
290 Ga0495614_0096216 3300048089 Bacteria 1291
291 Ga0495614_0168755 3300048089 Bacteria 981
292 Ga0496112_0440959 3300048915 Bacteria 1240
293 Ga0496115_0065966 3300048918 Bacteria 2925
294 Ga0501034_0176841 3300049571 Bacteria 2100
295 Ga0501081_0373525 3300049743 Bacteria 1053
296 nmdc:mga0qj67_217037_c1 3300050509 Bacteria 1553
297 nmdc:mga06r32_31126_c1 3300050510 Bacteria 5009
298 nmdc:mga08x19_719_c1 3300050514 Bacteria 21175
299 Ga0495601_0364963 3300053077 Bacteria 938
300 Ga0500568_0000362 3300053139 Bacteria 35157
301 Ga0265316_10087984
302 Ga0070658_10146804
303 Ga0070658_10385870
304 Ga0070683_100000001
305 Ga0070683_100300857
306 Ga0070680_100452287
307 Ga0068868_100049349
308 Ga0070660_100075972
309 Ga0070689_100093987
310 Ga0070675_100334060
311 Ga0070671_100094650
312 Ga0070674_100204082
313 Ga0070673_100214377
314 Ga0070659_100324183
315 Ga0070709_10085511
316 Ga0070709_10178560
317 Ga0070714_100021389
318 Ga0070714_100025411
319 Ga0070713_100011413
320 Ga0070713_100098191
321 Ga0070713_100105907
322 Ga0070713_100289036
323 Ga0070711_100018512
324 Ga0070681_10000540
325 Ga0070681_10167335
326 Ga0070681_10518345
327 Ga0068867_100208380
328 Ga0070706_100174141
329 Ga0070698_100410943
330 Ga0070699_100107424
331 Ga0070679_100065593
332 Ga0070684_100000055
333 Ga0070684_100614190
334 Ga0070684_100731403
335 Ga0068853_100065185
336 Ga0068853_100254405
337 Ga0070665_100010346
338 Ga0070665_100013143
339 Ga0068855_100001771
340 Ga0068855_100017177
341 Ga0068855_100074678
342 Ga0068855_100274938
343 Ga0068855_100478017
344 Ga0068856_100060635
345 Ga0068856_100104673
346 Ga0068856_100186022
347 Ga0068852_100002975
348 Ga0068864_100101784
349 Ga0068866_10027081
350 Ga0068863_100058415
351 Ga0068863_100707886
352 Ga0068858_100086354
353 Ga0068858_100088496
354 Ga0068860_100458077
355 Ga0070717_10193517
356 Ga0070717_10296255
357 Ga0070716_100121157
358 Ga0068871_100114490
359 Ga0068871_100803812
360 Ga0075430_100018232
361 Ga0075430_100237878
362 Ga0068865_100283181
363 Ga0075436_100004456
364 Ga0105240_10001309
365 Ga0105240_10001665
366 Ga0105240_10027864
367 Ga0105240_10173727
368 Ga0105240_10709972
369 Ga0105245_10002890
370 Ga0105245_10287715
371 Ga0105245_10370847
372 Ga0114129_10251775
373 Ga0114129_10988366
374 Ga0105241_10077883
375 Ga0105242_10035151
376 Ga0105242_10330382
377 Ga0105242_10357650
378 Ga0105248_10006545
379 Ga0105248_10105389
380 Ga0105248_10241891
381 Ga0105248_10287847
382 Ga0105248_10586261
383 Ga0105248_10594002
384 Ga0105237_10001398
385 Ga0105237_10004447
386 Ga0105237_10012137
387 Ga0105238_10031403
388 Ga0105249_10003456
389 Ga0105249_10036211
390 Ga0105249_10111330
391 Ga0105249_10243888
392 Ga0105239_10002231
393 Ga0105239_10010808
394 Ga0105239_10144424
395 Ga0105239_10180157
396 Ga0105239_10185927
397 Ga0105246_10006956
398 Ga0157373_10416062
399 Ga0157370_10009219
400 Ga0157369_10006002
401 Ga0157369_10022910
402 Ga0157369_10098056
403 Ga0157369_10107030
404 Ga0157374_10094360
405 Ga0157374_10108309
406 Ga0157374_10217403
407 Ga0157378_10067843
408 Ga0157378_10188259
409 Ga0157378_10378423
410 Ga0163162_10153496
411 Ga0157372_10075336
412 Ga0157372_10082783
413 Ga0157372_10189552
414 Ga0157372_10842654
415 Ga0157375_10021425
416 Ga0157375_10165697
417 Ga0157375_10656900
418 Ga0163163_10081579
419 Ga0163163_10116748
420 Ga0163163_10143674
421 Ga0163163_10204823
422 Ga0157379_10019211
423 Ga0157379_10421423
424 Ga0213876_10092700
425 Ga0207680_10118928
426 Ga0207699_10019928
427 Ga0207699_10224405
428 Ga0207654_10038041
429 Ga0207707_10054260
430 Ga0207707_10085579
431 Ga0207707_10393750
432 Ga0207695_10008503
433 Ga0207695_10026012
434 Ga0207695_10028925
435 Ga0207695_10071025
436 Ga0207695_10076960
437 Ga0207695_10402915
438 Ga0207671_10016355
439 Ga0207671_10093711
440 Ga0207663_10018404
441 Ga0207657_10406701
442 Ga0207649_10227358
443 Ga0207652_10167100
444 Ga0207694_10267351
445 Ga0207687_10004542
446 Ga0207687_10021960
447 Ga0207700_10009106
448 Ga0207700_10075000
449 Ga0207700_10093598
450 Ga0207700_10281278
451 Ga0207644_10224723
452 Ga0207686_10034725
453 Ga0207686_10172656
454 Ga0207686_10300548
455 Ga0207711_10022488
456 Ga0207711_10187666
457 Ga0207711_10228652
458 Ga0207711_10236504
459 Ga0207711_10604452
460 Ga0207661_10000005
461 Ga0207661_10031585
462 Ga0207661_10061519
463 Ga0207661_10243947
464 Ga0207661_10304530
465 Ga0207661_10562207
466 Ga0207667_10010573
467 Ga0207667_10011072
468 Ga0207667_10059892
469 Ga0207651_10158506
470 Ga0207712_10067718
471 Ga0207703_10236803
472 Ga0207639_10123180
473 Ga0207639_10215436
474 Ga0207702_10041781
475 Ga0207702_10085332
476 Ga0207641_10009003
477 Ga0207641_10322498
478 Ga0207698_10002972
479 Ga0268266_10079549
480 Ga0265323_10000450
481 Ga0265338_10055501
482 Ga0265325_10001985
483 Ga0265325_10097080
484 Ga0265325_10136829
485 Ga0265331_10068692
486 Ga0265316_10008129
487 Ga0265316_10025959
488 Ga0265316_10138469
489 Ga0265316_10169138
490 Ga0265316_10208679
491 Ga0307509_10500926
492 Ga0265313_10092780
493 Ga0265314_10011671
494 Ga0265342_10202154
495 Ga0373926_0007282
496 Ga0373926_0124481
497 Ga0373944_0134427
498 Ga0373923_0163197
499 Ga0373953_0057067
500 Ga0373953_0080887
501 Ga0373954_0071731
502 Ga0373956_0054168
503 Ga0373943_0023372
504 Ga0373946_0031615
505 Ga0373955_0159534
506 Ga0373935_0046702
507 Ga0373927_0000160
508 Ga0373927_0006012
509 Ga0373927_0007235
510 Ga0373933_0029332
511 Ga0373933_0035234
512 Ga0373933_0238723
513 Ga0373947_0000074
514 Ga0373947_0054811
515 Ga0373947_0153190
516 Ga0373937_0004297
517 Ga0373937_0010474
518 Ga0373937_0079462
519 Ga0373937_0142729
520 Ga0373937_0203231
521 Ga0373925_0000394
522 Ga0373925_0038413
523 Ga0373925_0086832
524 Ga0373925_0130765
525 Ga0395900_0137953
526 Ga0436364_0264065
527 Ga0436364_0604629
528 Ga0436364_0916023
529 Ga0436364_1200098
530 Ga0436365_0259549
531 Ga0436365_0492758
532 Ga0436365_1921576
533 Ga0436363_0952055
534 Ga0453684_0196902
535 Ga0451576_0066866
536 Ga0451576_0135449
537 Ga0451576_0277415
538 Ga0466958_0213540
539 Ga0495592_0062640
540 Ga0495651_0037210
541 Ga0495651_0198076
542 Ga0495580_0003200
543 Ga0495580_0030447
544 Ga0495580_0068636
545 Ga0495580_0243097
546 Ga0495582_0023351
547 Ga0495662_0136288
548 Ga0495664_0084112
549 Ga0495594_0164484
550 Ga0495628_0065229
551 Ga0495628_0444462
552 Ga0495630_0038873
553 Ga0495652_0060657
554 Ga0495652_0224771
555 Ga0495665_0079637
556 Ga0495665_0130440
557 Ga0495640_0197994
558 Ga0495586_0113424
559 Ga0495587_0007454
560 Ga0495645_0017407
561 Ga0495645_0031500
562 Ga0495645_0079134
563 Ga0495667_0030327
564 Ga0495667_0179304
565 Ga0495634_0031290
566 Ga0495635_0017997
567 Ga0495635_0053275
568 Ga0495635_0233853
569 Ga0495635_0372287
570 Ga0495635_0470779
571 Ga0495623_0060001
572 Ga0495623_0086749
573 Ga0495623_0096194
574 Ga0495624_0062668
575 Ga0495600_0056395
576 Ga0495600_0185888
577 Ga0495604_0178717
578 Ga0495674_0048764
579 Ga0495674_0108265
580 Ga0495680_0277685
581 Ga0495675_0010929
582 Ga0495684_0015487
583 Ga0495684_0017714
584 Ga0495684_0024620
585 Ga0495684_0059472
586 Ga0495684_0157560
587 Ga0495602_0027293
588 Ga0495602_0039457
589 Ga0495602_0305822
590 Ga0495614_0096216
591 Ga0495614_0168755
592 Ga0496112_0440959
593 Ga0496115_0065966
594 Ga0501034_0176841
595 Ga0501081_0373525
596 nmdc:mga0qj67_217037_c1
597 nmdc:mga06r32_31126_c1
598 nmdc:mga08x19_719_c1
599 Ga0495601_0364963
600 Ga0500568_0000362

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

20

253

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rd5-assembly1.cif.gz_B structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana 0.9517 2 251
2v5h-assembly1.cif.gz_D controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 0.9509 2 251
2buf-assembly1.cif.gz_D arginine feed-back inhibitable acetylglutamate kinase 0.9501 3 252
2buf-assembly1.cif.gz_E arginine feed-back inhibitable acetylglutamate kinase 0.9465 2 250
2buf-assembly2.cif.gz_H arginine feed-back inhibitable acetylglutamate kinase 0.9459 2 249
ID Description Score Start End Superfamily
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9506 2 251 3.40.1160.10
af_P9WQ01_4_294_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9364 2 251 3.40.1160.10
1uvdA00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9343 3 250 3.40.1160.10
af_Q2G1H6_1_252_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9051 2 250 3.40.1160.10
3d2mA01 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.8965 2 252 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A257VFZ9-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9867 46 251 GO:0003991
GO:0005524
GO:0005737
GO:0006526
AF-A0A7C6E5D8-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9866 1 251 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A3N5KE65-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9829 112 250 GO:0003991
GO:0005524
GO:0006526
AF-G8DPL8-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9809 1 256 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450
AF-A0A7X8UEF7-F1-model_v4 Acetylglutamate kinase (EC 2.7.2.8) (N-acetyl-L-glutamate 5-phosphotransferase) (NAG kinase) (NAGK) 0.9797 1 251 GO:0003991
GO:0005524
GO:0005737
GO:0006526
GO:0042450

Map