F395346

General Info

Members Datasets Scaffolds Average Seq Length
300 170 600 130

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10073777|Ga0105248_100737772
Length 129
Sequence MGRGTSLGRVRGLGSAHAGPHHWWMQRVTAAANLVLVIWFVVSIARLPIIDHQALVLWLKSPLVAVPMLLLTLSTFWHMRLGLQVFIEDYLHEEGSKIAALLLLNAYVIAAATLCVFSILKIAFGGVPA

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
95 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
102 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
103 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
106 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
107 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
108 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
109 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
110 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
111 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
112 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
115 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
116 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
117 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
118 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
126 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
127 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
128 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
129 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
133 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
134 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
135 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
136 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
137 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
138 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
139 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
140 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
141 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
142 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
143 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
144 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
145 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
146 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
147 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
148 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
149 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
150 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
151 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
152 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
153 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
154 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
155 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
156 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
157 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
160 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
161 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
162 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
163 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
164 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
165 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
166 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
167 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
168 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.33
Rhizosphere 96.67
Stem 0
Stem Tuber 0
Unclassified 1.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10073777 3300009177 Bacteria 3835
2 MRS1b_contig_6162896 2162886011 Bacteria 1911
3 LJQas_1003470 3300000549 Bacteria 2106
4 Ga0070658_10102496 3300005327 Bacteria 2367
5 Ga0070676_10006654 3300005328 Bacteria 6188
6 Ga0070676_11133284 3300005328 Bacteria 592
7 Ga0070670_100006217 3300005331 Bacteria 10099
8 Ga0070677_10019290 3300005333 Bacteria 2468
9 Ga0070677_10476544 3300005333 Bacteria 672
10 Ga0070666_10270839 3300005335 Bacteria 1205
11 Ga0070660_100107807 3300005339 Bacteria 2213
12 Ga0070660_100211465 3300005339 Bacteria 1575
13 Ga0070660_100616224 3300005339 Bacteria 908
14 Ga0070661_100447017 3300005344 Bacteria 1028
15 Ga0070668_100112961 3300005347 Bacteria 2164
16 Ga0070668_100505785 3300005347 Bacteria 1046
17 Ga0070668_100513466 3300005347 Bacteria 1039
18 Ga0070669_100213975 3300005353 Bacteria 1522
19 Ga0070669_100268796 3300005353 Bacteria 1363
20 Ga0070669_100484840 3300005353 Bacteria 1024
21 Ga0070669_101134531 3300005353 Bacteria 674
22 Ga0070675_100001532 3300005354 Bacteria 17085
23 Ga0070675_100001671 3300005354 Bacteria 16350
24 Ga0070675_100226728 3300005354 Bacteria 1629
25 Ga0070675_100853986 3300005354 Bacteria 833
26 Ga0070671_100001925 3300005355 Bacteria 15910
27 Ga0070671_100019126 3300005355 Bacteria 5571
28 Ga0070671_100296971 3300005355 Bacteria 1375
29 Ga0070674_100007197 3300005356 Bacteria 6549
30 Ga0070674_100177934 3300005356 Bacteria 1627
31 Ga0070674_100202575 3300005356 Bacteria 1533
32 Ga0070673_100008117 3300005364 Bacteria 6965
33 Ga0070659_100166275 3300005366 Bacteria 1805
34 Ga0070667_100044109 3300005367 Bacteria 3744
35 Ga0070667_100168988 3300005367 Bacteria 1930
36 Ga0070667_101327954 3300005367 Bacteria 674
37 Ga0070705_101070605 3300005440 Bacteria 658
38 Ga0070663_101275215 3300005455 Bacteria 648
39 Ga0070662_100018282 3300005457 Bacteria 4740
40 Ga0070662_100043413 3300005457 Bacteria 3216
41 Ga0070662_100071531 3300005457 Bacteria 2558
42 Ga0070662_100479874 3300005457 Bacteria 1035
43 Ga0068867_100792884 3300005459 Bacteria 844
44 Ga0070679_101809445 3300005530 Bacteria 559
45 Ga0070684_100756421 3300005535 Bacteria 907
46 Ga0070672_100225920 3300005543 Bacteria 1571
47 Ga0070672_100335314 3300005543 Bacteria 1287
48 Ga0070696_100381999 3300005546 Bacteria 1098
49 Ga0070665_100056115 3300005548 Bacteria 3950
50 Ga0070665_100074404 3300005548 Bacteria 3403
51 Ga0070665_100327731 3300005548 Bacteria 1536
52 Ga0070664_100257633 3300005564 Bacteria 1569
53 Ga0068859_100121012 3300005617 Bacteria 2684
54 Ga0068859_100167613 3300005617 Bacteria 2276
55 Ga0068859_102006343 3300005617 Bacteria 639
56 Ga0068859_102251967 3300005617 Bacteria 601
57 Ga0068864_101300681 3300005618 Bacteria 727
58 Ga0068861_100429652 3300005719 Unclassified 1179
59 Ga0068863_100000040 3300005841 Bacteria 158465
60 Ga0068863_100353639 3300005841 Bacteria 1431
61 Ga0068858_101511742 3300005842 Bacteria 662
62 Ga0068860_100051285 3300005843 Bacteria 3926
63 Ga0068860_101406672 3300005843 Bacteria 719
64 Ga0068862_100009511 3300005844 Bacteria 8043
65 Ga0075433_11926181 3300006852 Bacteria 507
66 Ga0075434_100775910 3300006871 Bacteria 975
67 Ga0068865_101302051 3300006881 Bacteria 646
68 Ga0097620_100121013 3300006931 Bacteria 2684
69 Ga0097620_100167610 3300006931 Bacteria 2276
70 Ga0097620_102006585 3300006931 Bacteria 639
71 Ga0097620_102251532 3300006931 Bacteria 601
72 Ga0111539_10468865 3300009094 Bacteria 1466
73 Ga0105243_10402294 3300009148 Bacteria 1272
74 Ga0105242_11123944 3300009176 Bacteria 801
75 Ga0105248_10034248 3300009177 Bacteria 5678
76 Ga0105249_10065726 3300009553 Bacteria 3337
77 Ga0157373_10084442 3300013100 Bacteria 2238
78 Ga0157371_10116020 3300013102 Bacteria 1902
79 Ga0157372_10405850 3300013307 Bacteria 1588
80 Ga0157372_10447753 3300013307 Bacteria 1505
81 Ga0157375_10001614 3300013308 Bacteria 19379
82 Ga0163163_10306953 3300014325 Bacteria 1639
83 Ga0157380_10079535 3300014326 Bacteria 2677
84 Ga0213876_10425043 3300021384 Bacteria 707
85 Ga0207697_10258308 3300025315 Bacteria 771
86 Ga0207682_10027089 3300025893 Bacteria 2281
87 Ga0207682_10308487 3300025893 Bacteria 742
88 Ga0207682_10361109 3300025893 Bacteria 685
89 Ga0207688_10109192 3300025901 Bacteria 1604
90 Ga0207680_10259302 3300025903 Bacteria 1203
91 Ga0207680_10448615 3300025903 Bacteria 915
92 Ga0207645_10018979 3300025907 Bacteria 4516
93 Ga0207705_10007414 3300025909 Bacteria 8069
94 Ga0207705_10025552 3300025909 Bacteria 4214
95 Ga0207657_10001115 3300025919 Bacteria 28496
96 Ga0207649_10072437 3300025920 Bacteria 2204
97 Ga0207649_10474928 3300025920 Bacteria 947
98 Ga0207652_10538775 3300025921 Bacteria 1050
99 Ga0207681_10151618 3300025923 Bacteria 1738
100 Ga0207681_10159824 3300025923 Bacteria 1697
101 Ga0207681_10184558 3300025923 Bacteria 1591
102 Ga0207681_10482830 3300025923 Bacteria 1012
103 Ga0207681_10515499 3300025923 Bacteria 981
104 Ga0207650_10001830 3300025925 Bacteria 15029
105 Ga0207650_10108871 3300025925 Bacteria 2142
106 Ga0207650_10907449 3300025925 Bacteria 748
107 Ga0207659_10001761 3300025926 Bacteria 12818
108 Ga0207659_10091410 3300025926 Bacteria 2273
109 Ga0207659_10346872 3300025926 Bacteria 1231
110 Ga0207659_10737313 3300025926 Bacteria 845
111 Ga0207644_10000595 3300025931 Bacteria 23038
112 Ga0207644_10001180 3300025931 Bacteria 16773
113 Ga0207644_10609755 3300025931 Bacteria 907
114 Ga0207690_10690428 3300025932 Bacteria 839
115 Ga0207706_10015425 3300025933 Bacteria 6903
116 Ga0207706_10020491 3300025933 Bacteria 5944
117 Ga0207706_10329796 3300025933 Bacteria 1328
118 Ga0207706_10496857 3300025933 Bacteria 1053
119 Ga0207686_10681083 3300025934 Bacteria 816
120 Ga0207669_10073666 3300025937 Bacteria 2156
121 Ga0207669_10154074 3300025937 Bacteria 1614
122 Ga0207669_10213560 3300025937 Bacteria 1410
123 Ga0207669_11348716 3300025937 Bacteria 607
124 Ga0207669_11379236 3300025937 Bacteria 600
125 Ga0207704_11102017 3300025938 Bacteria 675
126 Ga0207691_10005597 3300025940 Bacteria 12141
127 Ga0207691_10187575 3300025940 Bacteria 1805
128 Ga0207711_10016878 3300025941 Bacteria 6064
129 Ga0207679_10944760 3300025945 Bacteria 789
130 Ga0207679_10946104 3300025945 Bacteria 789
131 Ga0207651_10041551 3300025960 Bacteria 3053
132 Ga0207651_11460141 3300025960 Bacteria 616
133 Ga0207712_10033376 3300025961 Bacteria 3479
134 Ga0207712_10188601 3300025961 Bacteria 1626
135 Ga0207668_10000213 3300025972 Bacteria 39220
136 Ga0207668_10061228 3300025972 Bacteria 2646
137 Ga0207668_10112673 3300025972 Bacteria 2044
138 Ga0207658_10070055 3300025986 Bacteria 2652
139 Ga0207658_10180562 3300025986 Bacteria 1746
140 Ga0207703_10344865 3300026035 Bacteria 1370
141 Ga0207703_10945698 3300026035 Bacteria 826
142 Ga0207678_10052607 3300026067 Bacteria 3512
143 Ga0207708_10141155 3300026075 Bacteria 1890
144 Ga0207641_10000039 3300026088 Bacteria 199453
145 Ga0207641_10279352 3300026088 Bacteria 1570
146 Ga0207676_10204417 3300026095 Bacteria 1747
147 Ga0207698_11572325 3300026142 Unclassified 673
148 Ga0268266_10052192 3300028379 Bacteria 3511
149 Ga0268266_10371435 3300028379 Bacteria 1347
150 Ga0268265_10008441 3300028380 Bacteria 6956
151 Ga0268265_10237360 3300028380 Bacteria 1606
152 Ga0268265_11206446 3300028380 Unclassified 754
153 Ga0268264_10008192 3300028381 Bacteria 8678
154 Ga0307408_100011093 3300031548 Bacteria 5951
155 Ga0307408_101345381 3300031548 Bacteria 671
156 Ga0307408_102228825 3300031548 Bacteria 530
157 Ga0307405_10055649 3300031731 Bacteria 2477
158 Ga0307405_10141896 3300031731 Bacteria 1676
159 Ga0307405_10332501 3300031731 Bacteria 1165
160 Ga0307413_10012246 3300031824 Bacteria 4260
161 Ga0307413_10054365 3300031824 Bacteria 2429
162 Ga0307413_10432394 3300031824 Bacteria 1040
163 Ga0307413_10950773 3300031824 Bacteria 733
164 Ga0307410_10020890 3300031852 Bacteria 4016
165 Ga0307410_10032063 3300031852 Bacteria 3377
166 Ga0307410_10033632 3300031852 Bacteria 3312
167 Ga0307410_10596484 3300031852 Bacteria 921
168 Ga0307410_10811801 3300031852 Bacteria 796
169 Ga0307410_10870371 3300031852 Bacteria 770
170 Ga0307410_11184509 3300031852 Bacteria 665
171 Ga0307406_10531285 3300031901 Bacteria 959
172 Ga0307406_10590214 3300031901 Bacteria 915
173 Ga0307407_10041206 3300031903 Bacteria 2580
174 Ga0307407_10146888 3300031903 Bacteria 1528
175 Ga0307407_10423259 3300031903 Bacteria 960
176 Ga0307407_10884480 3300031903 Bacteria 684
177 Ga0307412_10332641 3300031911 Bacteria 1213
178 Ga0307409_100020818 3300031995 Bacteria 4480
179 Ga0307409_100309437 3300031995 Bacteria 1473
180 Ga0307409_100578668 3300031995 Bacteria 1106
181 Ga0307409_100760505 3300031995 Bacteria 973
182 Ga0307409_101738574 3300031995 Unclassified 652
183 Ga0307409_102506222 3300031995 Bacteria 544
184 Ga0307409_102815199 3300031995 Bacteria 514
185 Ga0307416_100021753 3300032002 Bacteria 4612
186 Ga0307416_100252061 3300032002 Bacteria 1719
187 Ga0307416_100277708 3300032002 Bacteria 1649
188 Ga0307416_100510321 3300032002 Bacteria 1268
189 Ga0307416_101399098 3300032002 Bacteria 805
190 Ga0307416_101760890 3300032002 Bacteria 724
191 Ga0307416_101781315 3300032002 Bacteria 720
192 Ga0307414_10060017 3300032004 Bacteria 2688
193 Ga0307414_10069207 3300032004 Bacteria 2536
194 Ga0307414_10639982 3300032004 Bacteria 957
195 Ga0307414_10852229 3300032004 Bacteria 833
196 Ga0307414_12181095 3300032004 Bacteria 517
197 Ga0307411_10000956 3300032005 Bacteria 11041
198 Ga0307411_10032851 3300032005 Bacteria 3212
199 Ga0307411_10042322 3300032005 Bacteria 2905
200 Ga0307411_10051927 3300032005 Bacteria 2677
201 Ga0307411_10127965 3300032005 Bacteria 1851
202 Ga0307411_10356114 3300032005 Bacteria 1195
203 Ga0307411_11035522 3300032005 Bacteria 737
204 Ga0307411_11072927 3300032005 Bacteria 725
205 Ga0307415_100220008 3300032126 Bacteria 1521
206 Ga0307415_100470757 3300032126 Bacteria 1091
207 Ga0307415_100880272 3300032126 Bacteria 824
208 Ga0307415_101288950 3300032126 Bacteria 692
209 Ga0307415_101486544 3300032126 Bacteria 648
210 Ga0395899_0309670 3300037312 Bacteria 1066
211 Ga0395900_0331627 3300037418 Bacteria 1499
212 Ga0395898_0153167 3300037466 Bacteria 2205
213 Ga0395898_0620930 3300037466 Bacteria 1023
214 Ga0395905_0398956 3300037471 Bacteria 1270
215 Ga0395905_0877131 3300037471 Bacteria 800
216 Ga0395905_1111776 3300037471 Bacteria 693
217 Ga0436365_1236252 3300039437 Bacteria 887
218 Ga0439438_146629 3300041405 Bacteria 564
219 Ga0439465_0024766 3300041413 Bacteria 1892
220 Ga0439465_0046881 3300041413 Bacteria 1408
221 Ga0451807_0955138 3300041486 Bacteria 752
222 Ga0451841_0898907 3300041498 Bacteria 1359
223 Ga0439445_0037652 3300042004 Bacteria 1277
224 Ga0439445_0107685 3300042004 Bacteria 794
225 Ga0439449_0020316 3300042007 Bacteria 2489
226 Ga0439452_039333 3300042010 Bacteria 1120
227 Ga0466965_0150646 3300044683 Bacteria 1216
228 Ga0466961_0348547 3300044693 Bacteria 901
229 Ga0466963_0071106 3300044694 Bacteria 2341
230 Ga0466968_0015208 3300044735 Bacteria 3046
231 Ga0466957_1431749 3300044842 Bacteria 503
232 Ga0466967_0232796 3300045976 Bacteria 1755
233 Ga0466967_0445305 3300045976 Bacteria 1265
234 Ga0495620_0125177 3300046515 Bacteria 1011
235 Ga0495663_0191014 3300046525 Bacteria 712
236 Ga0495598_0069307 3300046537 Bacteria 1107
237 Ga0495621_0041499 3300046539 Bacteria 1616
238 Ga0495621_0068272 3300046539 Bacteria 1304
239 Ga0495668_0214642 3300046616 Bacteria 1053
240 Ga0495669_0214390 3300046684 Bacteria 922
241 Ga0496108_0449107 3300048911 Bacteria 1126
242 Ga0496109_0401800 3300048912 Bacteria 1294
243 Ga0496109_0714401 3300048912 Bacteria 940
244 Ga0496109_1284193 3300048912 Bacteria 668
245 Ga0496110_0001374 3300048913 Bacteria 17526
246 Ga0496111_0229397 3300048914 Bacteria 1379
247 Ga0501292_020093 3300049515 Bacteria 1073
248 Ga0501293_010570 3300049516 Bacteria 799
249 Ga0501299_043670 3300049522 Bacteria 907
250 Ga0501300_006846 3300049523 Bacteria 1673
251 Ga0501032_0480555 3300049569 Bacteria 795
252 Ga0501034_0057453 3300049571 Bacteria 3912
253 Ga0501034_0317587 3300049571 Bacteria 1491
254 Ga0501047_0246713 3300049581 Bacteria 1635
255 Ga0501070_0031172 3300049586 Bacteria 4466
256 Ga0501071_0217620 3300049587 Bacteria 1437
257 Ga0501202_067632 3300049652 Bacteria 818
258 Ga0501211_021107 3300049658 Bacteria 685
259 Ga0501214_017537 3300049659 Bacteria 876
260 Ga0501216_036816 3300049660 Unclassified 923
261 Ga0501217_019901 3300049661 Bacteria 1571
262 Ga0501224_001538 3300049664 Bacteria 3073
263 Ga0501227_010706 3300049665 Bacteria 1990
264 Ga0501227_015268 3300049665 Bacteria 1715
265 Ga0501230_037832 3300049667 Bacteria 925
266 Ga0501233_038407 3300049668 Bacteria 1115
267 Ga0501233_053492 3300049668 Bacteria 984
268 Ga0501235_009166 3300049669 Bacteria 2162
269 Ga0501235_049838 3300049669 Bacteria 969
270 Ga0501239_008860 3300049672 Bacteria 1082
271 Ga0501240_033868 3300049673 Bacteria 827
272 Ga0501242_007929 3300049674 Bacteria 1234
273 Ga0501243_045478 3300049675 Bacteria 780
274 Ga0501243_077435 3300049675 Bacteria 642
275 Ga0501247_004365 3300049677 Bacteria 1544
276 Ga0501247_056208 3300049677 Bacteria 595
277 Ga0501248_003911 3300049678 Bacteria 1099
278 Ga0501252_016256 3300049682 Bacteria 935
279 Ga0501253_009657 3300049683 Bacteria 1429
280 Ga0501257_000044 3300049686 Bacteria 35002
281 Ga0501257_014468 3300049686 Bacteria 1816
282 Ga0501258_006015 3300049687 Bacteria 1192
283 Ga0501221_002911 3300049704 Bacteria 2820
284 Ga0501225_0009638 3300049705 Bacteria 2744
285 Ga0501234_010432 3300049707 Bacteria 1447
286 Ga0501245_016134 3300049708 Bacteria 1130
287 Ga0501080_0367809 3300049742 Bacteria 1297
288 Ga0501262_000830 3300049759 Bacteria 3548
289 Ga0501266_014180 3300049763 Bacteria 1043
290 Ga0501267_022777 3300049764 Bacteria 700
291 Ga0501270_005539 3300049767 Bacteria 1472
292 Ga0501271_022594 3300049768 Bacteria 737
293 Ga0501272_002652 3300049769 Bacteria 1777
294 Ga0501273_003825 3300049770 Bacteria 1624
295 Ga0501276_028795 3300049773 Bacteria 570
296 Ga0501279_009411 3300049775 Bacteria 1308
297 Ga0501280_000663 3300049776 Bacteria 7643
298 Ga0501044_0095919 3300049823 Bacteria 2988
299 Ga0501044_1062090 3300049823 Bacteria 680
300 Ga0501212_016814 3300049851 Bacteria 1102
301 Ga0105248_10073777
302 MRS1b_contig_6162896
303 LJQas_1003470
304 Ga0070658_10102496
305 Ga0070676_10006654
306 Ga0070676_11133284
307 Ga0070670_100006217
308 Ga0070677_10019290
309 Ga0070677_10476544
310 Ga0070666_10270839
311 Ga0070660_100107807
312 Ga0070660_100211465
313 Ga0070660_100616224
314 Ga0070661_100447017
315 Ga0070668_100112961
316 Ga0070668_100505785
317 Ga0070668_100513466
318 Ga0070669_100213975
319 Ga0070669_100268796
320 Ga0070669_100484840
321 Ga0070669_101134531
322 Ga0070675_100001532
323 Ga0070675_100001671
324 Ga0070675_100226728
325 Ga0070675_100853986
326 Ga0070671_100001925
327 Ga0070671_100019126
328 Ga0070671_100296971
329 Ga0070674_100007197
330 Ga0070674_100177934
331 Ga0070674_100202575
332 Ga0070673_100008117
333 Ga0070659_100166275
334 Ga0070667_100044109
335 Ga0070667_100168988
336 Ga0070667_101327954
337 Ga0070705_101070605
338 Ga0070663_101275215
339 Ga0070662_100018282
340 Ga0070662_100043413
341 Ga0070662_100071531
342 Ga0070662_100479874
343 Ga0068867_100792884
344 Ga0070679_101809445
345 Ga0070684_100756421
346 Ga0070672_100225920
347 Ga0070672_100335314
348 Ga0070696_100381999
349 Ga0070665_100056115
350 Ga0070665_100074404
351 Ga0070665_100327731
352 Ga0070664_100257633
353 Ga0068859_100121012
354 Ga0068859_100167613
355 Ga0068859_102006343
356 Ga0068859_102251967
357 Ga0068864_101300681
358 Ga0068861_100429652
359 Ga0068863_100000040
360 Ga0068863_100353639
361 Ga0068858_101511742
362 Ga0068860_100051285
363 Ga0068860_101406672
364 Ga0068862_100009511
365 Ga0075433_11926181
366 Ga0075434_100775910
367 Ga0068865_101302051
368 Ga0097620_100121013
369 Ga0097620_100167610
370 Ga0097620_102006585
371 Ga0097620_102251532
372 Ga0111539_10468865
373 Ga0105243_10402294
374 Ga0105242_11123944
375 Ga0105248_10034248
376 Ga0105249_10065726
377 Ga0157373_10084442
378 Ga0157371_10116020
379 Ga0157372_10405850
380 Ga0157372_10447753
381 Ga0157375_10001614
382 Ga0163163_10306953
383 Ga0157380_10079535
384 Ga0213876_10425043
385 Ga0207697_10258308
386 Ga0207682_10027089
387 Ga0207682_10308487
388 Ga0207682_10361109
389 Ga0207688_10109192
390 Ga0207680_10259302
391 Ga0207680_10448615
392 Ga0207645_10018979
393 Ga0207705_10007414
394 Ga0207705_10025552
395 Ga0207657_10001115
396 Ga0207649_10072437
397 Ga0207649_10474928
398 Ga0207652_10538775
399 Ga0207681_10151618
400 Ga0207681_10159824
401 Ga0207681_10184558
402 Ga0207681_10482830
403 Ga0207681_10515499
404 Ga0207650_10001830
405 Ga0207650_10108871
406 Ga0207650_10907449
407 Ga0207659_10001761
408 Ga0207659_10091410
409 Ga0207659_10346872
410 Ga0207659_10737313
411 Ga0207644_10000595
412 Ga0207644_10001180
413 Ga0207644_10609755
414 Ga0207690_10690428
415 Ga0207706_10015425
416 Ga0207706_10020491
417 Ga0207706_10329796
418 Ga0207706_10496857
419 Ga0207686_10681083
420 Ga0207669_10073666
421 Ga0207669_10154074
422 Ga0207669_10213560
423 Ga0207669_11348716
424 Ga0207669_11379236
425 Ga0207704_11102017
426 Ga0207691_10005597
427 Ga0207691_10187575
428 Ga0207711_10016878
429 Ga0207679_10944760
430 Ga0207679_10946104
431 Ga0207651_10041551
432 Ga0207651_11460141
433 Ga0207712_10033376
434 Ga0207712_10188601
435 Ga0207668_10000213
436 Ga0207668_10061228
437 Ga0207668_10112673
438 Ga0207658_10070055
439 Ga0207658_10180562
440 Ga0207703_10344865
441 Ga0207703_10945698
442 Ga0207678_10052607
443 Ga0207708_10141155
444 Ga0207641_10000039
445 Ga0207641_10279352
446 Ga0207676_10204417
447 Ga0207698_11572325
448 Ga0268266_10052192
449 Ga0268266_10371435
450 Ga0268265_10008441
451 Ga0268265_10237360
452 Ga0268265_11206446
453 Ga0268264_10008192
454 Ga0307408_100011093
455 Ga0307408_101345381
456 Ga0307408_102228825
457 Ga0307405_10055649
458 Ga0307405_10141896
459 Ga0307405_10332501
460 Ga0307413_10012246
461 Ga0307413_10054365
462 Ga0307413_10432394
463 Ga0307413_10950773
464 Ga0307410_10020890
465 Ga0307410_10032063
466 Ga0307410_10033632
467 Ga0307410_10596484
468 Ga0307410_10811801
469 Ga0307410_10870371
470 Ga0307410_11184509
471 Ga0307406_10531285
472 Ga0307406_10590214
473 Ga0307407_10041206
474 Ga0307407_10146888
475 Ga0307407_10423259
476 Ga0307407_10884480
477 Ga0307412_10332641
478 Ga0307409_100020818
479 Ga0307409_100309437
480 Ga0307409_100578668
481 Ga0307409_100760505
482 Ga0307409_101738574
483 Ga0307409_102506222
484 Ga0307409_102815199
485 Ga0307416_100021753
486 Ga0307416_100252061
487 Ga0307416_100277708
488 Ga0307416_100510321
489 Ga0307416_101399098
490 Ga0307416_101760890
491 Ga0307416_101781315
492 Ga0307414_10060017
493 Ga0307414_10069207
494 Ga0307414_10639982
495 Ga0307414_10852229
496 Ga0307414_12181095
497 Ga0307411_10000956
498 Ga0307411_10032851
499 Ga0307411_10042322
500 Ga0307411_10051927
501 Ga0307411_10127965
502 Ga0307411_10356114
503 Ga0307411_11035522
504 Ga0307411_11072927
505 Ga0307415_100220008
506 Ga0307415_100470757
507 Ga0307415_100880272
508 Ga0307415_101288950
509 Ga0307415_101486544
510 Ga0395899_0309670
511 Ga0395900_0331627
512 Ga0395898_0153167
513 Ga0395898_0620930
514 Ga0395905_0398956
515 Ga0395905_0877131
516 Ga0395905_1111776
517 Ga0436365_1236252
518 Ga0439438_146629
519 Ga0439465_0024766
520 Ga0439465_0046881
521 Ga0451807_0955138
522 Ga0451841_0898907
523 Ga0439445_0037652
524 Ga0439445_0107685
525 Ga0439449_0020316
526 Ga0439452_039333
527 Ga0466965_0150646
528 Ga0466961_0348547
529 Ga0466963_0071106
530 Ga0466968_0015208
531 Ga0466957_1431749
532 Ga0466967_0232796
533 Ga0466967_0445305
534 Ga0495620_0125177
535 Ga0495663_0191014
536 Ga0495598_0069307
537 Ga0495621_0041499
538 Ga0495621_0068272
539 Ga0495668_0214642
540 Ga0495669_0214390
541 Ga0496108_0449107
542 Ga0496109_0401800
543 Ga0496109_0714401
544 Ga0496109_1284193
545 Ga0496110_0001374
546 Ga0496111_0229397
547 Ga0501292_020093
548 Ga0501293_010570
549 Ga0501299_043670
550 Ga0501300_006846
551 Ga0501032_0480555
552 Ga0501034_0057453
553 Ga0501034_0317587
554 Ga0501047_0246713
555 Ga0501070_0031172
556 Ga0501071_0217620
557 Ga0501202_067632
558 Ga0501211_021107
559 Ga0501214_017537
560 Ga0501216_036816
561 Ga0501217_019901
562 Ga0501224_001538
563 Ga0501227_010706
564 Ga0501227_015268
565 Ga0501230_037832
566 Ga0501233_038407
567 Ga0501233_053492
568 Ga0501235_009166
569 Ga0501235_049838
570 Ga0501239_008860
571 Ga0501240_033868
572 Ga0501242_007929
573 Ga0501243_045478
574 Ga0501243_077435
575 Ga0501247_004365
576 Ga0501247_056208
577 Ga0501248_003911
578 Ga0501252_016256
579 Ga0501253_009657
580 Ga0501257_000044
581 Ga0501257_014468
582 Ga0501258_006015
583 Ga0501221_002911
584 Ga0501225_0009638
585 Ga0501234_010432
586 Ga0501245_016134
587 Ga0501080_0367809
588 Ga0501262_000830
589 Ga0501266_014180
590 Ga0501267_022777
591 Ga0501270_005539
592 Ga0501271_022594
593 Ga0501272_002652
594 Ga0501273_003825
595 Ga0501276_028795
596 Ga0501279_009411
597 Ga0501280_000663
598 Ga0501044_0095919
599 Ga0501044_1062090
600 Ga0501212_016814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

1

113

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lum-assembly1.cif.gz_N structure of mycobacterium smegmatis succinate dehydrogenase 2 0.8991 26 122
4yxd-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with flutolanil 0.8716 25 120
4ytp-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-[(4-tert-butylphenyl)methyl]-2-(trifluoromethyl)benzamide 0.8687 25 120
3abv-assembly1.cif.gz_D crystal structure of porcine heart mitochondrial complex ii bound with n-biphenyl-3-yl-2-trifluoromethyl-benzamide 0.8609 25 116
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.8217 26 129
ID Description Score Start End Superfamily
4ytpD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8687 25 120 1.20.1300.10
3ae3D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8632 25 116 1.20.1300.10
3aedD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.863 25 116 1.20.1300.10
3abvD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8609 25 116 1.20.1300.10
3ae1D00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.86 25 116 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A838UDD3-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9859 54 127 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A527GFI1-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9853 58 129 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A4U7EYN9-F1-model_v4 Succinate dehydrogenase, hydrophobic membrane anchor protein 0.9814 59 129 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A2E5H4T6-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9778 24 127 GO:0006099
GO:0016020
GO:0020037
GO:0046872
AF-A0A2E2WTE4-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9723 25 129 GO:0006099
GO:0016020
GO:0020037
GO:0046872

Map