F395074

General Info

Members Datasets Scaffolds Average Seq Length
299 215 598 123

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_23088_c1|nmdc:mga00v17_23088_c1_2070_2438
Length 117
Sequence MKTVAVIGASSNRAKFGNRAVRAFERQGYTVIPINPHEAEVEGHKAYASVLDVPGPIDMATVYGVKVLDEIARKGIPEVWINPGADEAPVLDRARALGLNVIVACSIIGAGDSPWRD

Samples

Sample ID Description Type Environment
1 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
140 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
157 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
158 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
159 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
160 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
161 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.69
Nodule 0
Rhizoplane 6.35
Rhizosphere 86.96
Stem 0
Stem Tuber 0
Unclassified 22.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga00v17_23088_c1 3300050491 Bacteria 3595
2 Ga0065704_10406884 3300005289 Bacteria 746
3 Ga0065715_10260031 3300005293 Bacteria 1141
4 Ga0065715_10361697 3300005293 Bacteria 934
5 Ga0065715_10978617 3300005293 Unclassified 551
6 Ga0065707_10013140 3300005295 Bacteria 2124
7 Ga0065707_10361735 3300005295 Unclassified 903
8 Ga0065707_10422310 3300005295 Unclassified 829
9 Ga0065707_10591150 3300005295 Bacteria 696
10 Ga0070676_10003472 3300005328 Bacteria 8214
11 Ga0070676_10643002 3300005328 Bacteria 769
12 Ga0070683_100111076 3300005329 Bacteria 2586
13 Ga0070690_100235755 3300005330 Bacteria 1288
14 Ga0070670_100112779 3300005331 Bacteria 2344
15 Ga0070677_10045122 3300005333 Bacteria 1757
16 Ga0068869_100191934 3300005334 Bacteria 1607
17 Ga0068869_101127851 3300005334 Bacteria 687
18 Ga0070666_10931067 3300005335 Bacteria 643
19 Ga0070680_100721454 3300005336 Bacteria 858
20 Ga0068868_100521127 3300005338 Bacteria 1043
21 Ga0070660_101509249 3300005339 Unclassified 571
22 Ga0070689_100093609 3300005340 Bacteria 2372
23 Ga0070689_101363005 3300005340 Bacteria 640
24 Ga0070691_10057444 3300005341 Bacteria 1867
25 Ga0070687_100199010 3300005343 Bacteria 1212
26 Ga0070687_100868059 3300005343 Bacteria 644
27 Ga0070668_100762818 3300005347 Bacteria 857
28 Ga0070669_100098956 3300005353 Bacteria 2197
29 Ga0070675_100414363 3300005354 Bacteria 1204
30 Ga0070675_100556514 3300005354 Bacteria 1038
31 Ga0070671_100017565 3300005355 Bacteria 5797
32 Ga0070674_100759689 3300005356 Bacteria 834
33 Ga0070673_100030098 3300005364 Bacteria 4057
34 Ga0070673_100539016 3300005364 Bacteria 1059
35 Ga0070659_100121639 3300005366 Bacteria 2115
36 Ga0070659_100224355 3300005366 Bacteria 1552
37 Ga0070659_101298514 3300005366 Unclassified 645
38 Ga0070667_100652915 3300005367 Bacteria 971
39 Ga0070667_100725179 3300005367 Bacteria 921
40 Ga0070709_10283326 3300005434 Unclassified 1205
41 Ga0070713_100180898 3300005436 Unclassified 1894
42 Ga0070701_10890842 3300005438 Bacteria 613
43 Ga0070700_100360596 3300005441 Bacteria 1081
44 Ga0070694_100461134 3300005444 Bacteria 1005
45 Ga0070708_100064345 3300005445 Bacteria 3286
46 Ga0070678_100510591 3300005456 Bacteria 1062
47 Ga0070662_101279903 3300005457 Unclassified 631
48 Ga0068867_100037552 3300005459 Bacteria 3521
49 Ga0068867_100476688 3300005459 Bacteria 1068
50 Ga0070706_101107499 3300005467 Unclassified 729
51 Ga0070707_101237286 3300005468 Bacteria 713
52 Ga0070699_100821661 3300005518 Bacteria 851
53 Ga0070679_100160573 3300005530 Bacteria 2222
54 Ga0070684_100454749 3300005535 Bacteria 1184
55 Ga0068853_100935961 3300005539 Bacteria 833
56 Ga0070672_100129667 3300005543 Bacteria 2071
57 Ga0070686_100118986 3300005544 Bacteria 1811
58 Ga0070686_100128966 3300005544 Bacteria 1746
59 Ga0070695_100839136 3300005545 Bacteria 739
60 Ga0070695_101611740 3300005545 Unclassified 542
61 Ga0070696_100229978 3300005546 Bacteria 1395
62 Ga0070696_101737151 3300005546 Unclassified 538
63 Ga0070693_100024111 3300005547 Bacteria 3259
64 Ga0070665_100590197 3300005548 Bacteria 1124
65 Ga0070665_101154349 3300005548 Bacteria 786
66 Ga0070704_100078710 3300005549 Bacteria 2419
67 Ga0070664_100735555 3300005564 Bacteria 920
68 Ga0070664_101199270 3300005564 Unclassified 716
69 Ga0070664_101205247 3300005564 Unclassified 714
70 Ga0068854_100327339 3300005578 Bacteria 1247
71 Ga0070702_101172940 3300005615 Bacteria 617
72 Ga0068852_100186948 3300005616 Bacteria 1952
73 Ga0068859_100217766 3300005617 Bacteria 1997
74 Ga0068859_100625178 3300005617 Bacteria 1169
75 Ga0068864_100162505 3300005618 Bacteria 2031
76 Ga0068864_101858233 3300005618 Unclassified 608
77 Ga0068866_10462117 3300005718 Bacteria 832
78 Ga0068861_100525152 3300005719 Bacteria 1074
79 Ga0068851_10649636 3300005834 Unclassified 646
80 Ga0068860_100311132 3300005843 Bacteria 1545
81 Ga0068862_100218281 3300005844 Bacteria 1725
82 Ga0081455_10483094 3300005937 Unclassified 837
83 Ga0081539_10022069 3300005985 Bacteria 4225
84 Ga0075365_10124872 3300006038 Bacteria 1778
85 Ga0075368_10120311 3300006042 Bacteria 1087
86 Ga0075364_10007900 3300006051 Bacteria 6336
87 Ga0075364_10106488 3300006051 Bacteria 1868
88 Ga0075362_10013647 3300006177 Bacteria 3258
89 Ga0075362_10270318 3300006177 Bacteria 839
90 Ga0075367_10093186 3300006178 Bacteria 1834
91 Ga0075366_10018198 3300006195 Bacteria 4056
92 Ga0075366_10024302 3300006195 Bacteria 3534
93 Ga0097621_100884574 3300006237 Unclassified 831
94 Ga0075430_100644162 3300006846 Unclassified 874
95 Ga0075431_100890884 3300006847 Bacteria 860
96 Ga0075434_100047595 3300006871 Bacteria 4256
97 Ga0075434_100763575 3300006871 Bacteria 984
98 Ga0075429_101220396 3300006880 Unclassified 656
99 Ga0068865_100183722 3300006881 Bacteria 1612
100 Ga0068865_101625060 3300006881 Unclassified 581
101 Ga0097620_100217761 3300006931 Bacteria 1997
102 Ga0097620_100625170 3300006931 Bacteria 1169
103 Ga0075435_100030350 3300007076 Bacteria 4249
104 Ga0075435_100797853 3300007076 Bacteria 822
105 Ga0105240_10079619 3300009093 Bacteria 4031
106 Ga0105240_11331841 3300009093 Bacteria 756
107 Ga0111539_10003652 3300009094 Bacteria 20266
108 Ga0111539_11769347 3300009094 Bacteria 717
109 Ga0105245_10334769 3300009098 Bacteria 1495
110 Ga0114129_10010180 3300009147 Bacteria 13405
111 Ga0114129_10210987 3300009147 Unclassified 2625
112 Ga0114129_10350404 3300009147 Bacteria 1956
113 Ga0105243_10017926 3300009148 Bacteria 5359
114 Ga0105241_10636478 3300009174 Bacteria 967
115 Ga0105242_10053751 3300009176 Bacteria 3290
116 Ga0105242_11263987 3300009176 Unclassified 760
117 Ga0105242_12479183 3300009176 Bacteria 567
118 Ga0105248_10159885 3300009177 Bacteria 2541
119 Ga0105248_11675166 3300009177 Bacteria 721
120 Ga0105248_12107617 3300009177 Bacteria 641
121 Ga0105248_12249336 3300009177 Bacteria 621
122 Ga0105248_12499603 3300009177 Bacteria 589
123 Ga0105239_10293320 3300010375 Bacteria 1831
124 Ga0105239_11403246 3300010375 Bacteria 806
125 Ga0105246_12505652 3300011119 Unclassified 508
126 Ga0157374_12317389 3300013296 Bacteria 564
127 Ga0157378_10484698 3300013297 Bacteria 1233
128 Ga0157378_12307341 3300013297 Unclassified 590
129 Ga0163162_10704754 3300013306 Bacteria 1131
130 Ga0157375_11774494 3300013308 Unclassified 731
131 Ga0163163_10096774 3300014325 Bacteria 2972
132 Ga0157380_10402155 3300014326 Bacteria 1300
133 Ga0157380_10801205 3300014326 Bacteria 959
134 Ga0157380_12219430 3300014326 Unclassified 613
135 Ga0157379_11139944 3300014968 Unclassified 748
136 Ga0157376_10212493 3300014969 Bacteria 1787
137 Ga0157376_10991592 3300014969 Unclassified 862
138 Ga0207697_10164487 3300025315 Bacteria 969
139 Ga0207682_10008365 3300025893 Bacteria 4092
140 Ga0207642_10555869 3300025899 Bacteria 709
141 Ga0207688_10029999 3300025901 Unclassified 2997
142 Ga0207680_10156306 3300025903 Bacteria 1525
143 Ga0207647_10101839 3300025904 Bacteria 1703
144 Ga0207645_10527931 3300025907 Bacteria 800
145 Ga0207654_10289186 3300025911 Bacteria 1111
146 Ga0207695_11329915 3300025913 Bacteria 599
147 Ga0207662_10002674 3300025918 Bacteria 8990
148 Ga0207657_10653327 3300025919 Bacteria 818
149 Ga0207652_10214700 3300025921 Bacteria 1733
150 Ga0207646_10503512 3300025922 Unclassified 1091
151 Ga0207646_11877144 3300025922 Bacteria 511
152 Ga0207681_10245190 3300025923 Bacteria 1396
153 Ga0207650_10167256 3300025925 Bacteria 1745
154 Ga0207659_10836269 3300025926 Unclassified 791
155 Ga0207659_11234918 3300025926 Bacteria 642
156 Ga0207687_10119879 3300025927 Bacteria 1966
157 Ga0207700_10273231 3300025928 Unclassified 1451
158 Ga0207700_11797471 3300025928 Bacteria 539
159 Ga0207644_10266434 3300025931 Bacteria 1371
160 Ga0207644_10602346 3300025931 Bacteria 912
161 Ga0207690_10229302 3300025932 Bacteria 1425
162 Ga0207686_10015526 3300025934 Bacteria 4259
163 Ga0207709_10023707 3300025935 Bacteria 3495
164 Ga0207709_11247016 3300025935 Unclassified 613
165 Ga0207670_10057305 3300025936 Bacteria 2642
166 Ga0207669_10344346 3300025937 Bacteria 1149
167 Ga0207704_10579636 3300025938 Bacteria 916
168 Ga0207704_10630190 3300025938 Bacteria 881
169 Ga0207704_11366176 3300025938 Unclassified 607
170 Ga0207691_10019361 3300025940 Bacteria 6440
171 Ga0207711_10510961 3300025941 Bacteria 1120
172 Ga0207711_10656354 3300025941 Bacteria 978
173 Ga0207711_11327403 3300025941 Bacteria 662
174 Ga0207711_11653915 3300025941 Bacteria 584
175 Ga0207689_10050017 3300025942 Bacteria 3447
176 Ga0207661_10038392 3300025944 Bacteria 3753
177 Ga0207651_10162263 3300025960 Bacteria 1753
178 Ga0207651_10232868 3300025960 Bacteria 1496
179 Ga0207712_11445489 3300025961 Unclassified 615
180 Ga0207640_10261802 3300025981 Bacteria 1348
181 Ga0207677_10117215 3300026023 Bacteria 1995
182 Ga0207703_10065963 3300026035 Unclassified 2976
183 Ga0207708_10008272 3300026075 Bacteria 7706
184 Ga0207641_11036366 3300026088 Bacteria 818
185 Ga0207648_10031440 3300026089 Bacteria 4694
186 Ga0207683_10003404 3300026121 Bacteria 13845
187 Ga0207698_10095204 3300026142 Bacteria 2451
188 Ga0209813_10101938 3300027866 Bacteria 978
189 Ga0207428_10700013 3300027907 Bacteria 725
190 Ga0268266_10487388 3300028379 Bacteria 1176
191 Ga0268265_10727596 3300028380 Bacteria 961
192 Ga0268264_10281388 3300028381 Bacteria 1558
193 Ga0307408_100269406 3300031548 Bacteria 1413
194 Ga0307405_11226125 3300031731 Bacteria 650
195 Ga0307406_11152757 3300031901 Unclassified 671
196 Ga0307407_10823719 3300031903 Unclassified 707
197 Ga0307409_101734236 3300031995 Unclassified 653
198 Ga0307416_100322738 3300032002 Bacteria 1547
199 Ga0307416_101250777 3300032002 Unclassified 848
200 Ga0307411_12350984 3300032005 Unclassified 501
201 Ga0373932_0156390 3300035112 Bacteria 786
202 Ga0373941_0124189 3300035115 Bacteria 923
203 Ga0373943_0040895 3300035170 Bacteria 2240
204 Ga0373943_0125475 3300035170 Bacteria 1368
205 Ga0373946_0401195 3300035171 Bacteria 692
206 Ga0373961_0269769 3300035241 Unclassified 621
207 Ga0373962_0080607 3300035242 Bacteria 987
208 Ga0373931_0337866 3300035691 Unclassified 940
209 Ga0373937_0301190 3300036401 Bacteria 1515
210 Ga0373925_0068976 3300037068 Bacteria 2670
211 Ga0373925_0293340 3300037068 Bacteria 1312
212 Ga0373925_1279502 3300037068 Unclassified 602
213 Ga0395900_1568347 3300037418 Unclassified 570
214 Ga0395905_0642496 3300037471 Unclassified 963
215 Ga0439436_0055620 3300041404 Unclassified 1112
216 Ga0439431_0052403 3300041997 Unclassified 1060
217 Ga0439433_0014975 3300041999 Bacteria 1711
218 Ga0439449_0018881 3300042007 Bacteria 2585
219 Ga0450923_119503 3300042125 Unclassified 621
220 Ga0450897_025431 3300042128 Unclassified 652
221 Ga0450894_070447 3300042131 Unclassified 535
222 Ga0439435_0031214 3300042436 Bacteria 1447
223 Ga0495629_0173631 3300046459 Bacteria 1495
224 Ga0495582_0932148 3300046473 Unclassified 502
225 Ga0495630_0394868 3300046517 Bacteria 1060
226 Ga0495621_0033662 3300046539 Bacteria 1768
227 Ga0495634_0184669 3300046642 Bacteria 1304
228 Ga0495658_0418265 3300046683 Unclassified 855
229 Ga0495600_0728076 3300046809 Bacteria 595
230 Ga0495684_0201927 3300047471 Bacteria 1465
231 Ga0496101_0624463 3300048904 Unclassified 852
232 Ga0496101_1093743 3300048904 Bacteria 626
233 Ga0496102_0033730 3300048905 Bacteria 4603
234 Ga0496103_0321540 3300048906 Bacteria 995
235 Ga0496104_0596383 3300048907 Bacteria 1015
236 Ga0496105_0776320 3300048908 Bacteria 730
237 Ga0496106_0417653 3300048909 Bacteria 1078
238 Ga0496106_0475951 3300048909 Bacteria 1003
239 Ga0496108_0502021 3300048911 Bacteria 1059
240 Ga0496109_0512394 3300048912 Bacteria 1132
241 Ga0496109_0540166 3300048912 Bacteria 1100
242 Ga0496109_1168221 3300048912 Bacteria 706
243 Ga0496110_1000408 3300048913 Unclassified 743
244 Ga0496110_1236487 3300048913 Bacteria 656
245 Ga0496112_0031949 3300048915 Bacteria 5110
246 Ga0496112_0072276 3300048915 Bacteria 3410
247 Ga0496112_0544281 3300048915 Bacteria 1095
248 Ga0496113_0052768 3300048916 Bacteria 3038
249 Ga0496113_1252256 3300048916 Unclassified 578
250 Ga0501032_0408828 3300049569 Bacteria 871
251 Ga0501034_0028202 3300049571 Bacteria 5712
252 Ga0501034_0030035 3300049571 Bacteria 5525
253 Ga0501034_0062784 3300049571 Bacteria 3730
254 Ga0501034_0077908 3300049571 Bacteria 3320
255 Ga0501036_1282311 3300049572 Bacteria 596
256 Ga0501037_0103478 3300049573 Bacteria 2054
257 Ga0501038_0632441 3300049574 Bacteria 807
258 Ga0501041_0766460 3300049577 Archaea 618
259 Ga0501043_0170892 3300049579 Bacteria 1696
260 Ga0501047_0046383 3300049581 Bacteria 4200
261 Ga0501047_0373054 3300049581 Bacteria 1262
262 Ga0501048_0147384 3300049582 Bacteria 1665
263 Ga0501070_0590068 3300049586 Bacteria 886
264 Ga0501071_1349120 3300049587 Unclassified 551
265 Ga0501073_0514005 3300049589 Bacteria 828
266 Ga0501074_1074444 3300049590 Unclassified 565
267 Ga0501075_0295873 3300049591 Bacteria 1233
268 Ga0501075_1374580 3300049591 Unclassified 535
269 Ga0501079_0402243 3300049741 Bacteria 1074
270 Ga0501079_0451989 3300049741 Bacteria 1009
271 Ga0501081_0140938 3300049743 Bacteria 1728
272 Ga0501081_0297401 3300049743 Unclassified 1184
273 Ga0501081_0745489 3300049743 Bacteria 736
274 Ga0501083_0828484 3300049744 Archaea 602
275 Ga0501268_121235 3300049765 Unclassified 580
276 Ga0501044_0024597 3300049823 Bacteria 6390
277 Ga0501044_0862285 3300049823 Unclassified 782
278 nmdc:mga03683_278392_c1 3300050489 Bacteria 781
279 nmdc:mga03683_4465_c1 3300050489 Bacteria 4647
280 nmdc:mga00v17_34195_c1 3300050491 Bacteria 3017
281 nmdc:mga0k408_11323_c1 3300050493 Bacteria 4854
282 nmdc:mga0k408_33724_c1 3300050493 Bacteria 2929
283 nmdc:mga0k408_900213_c1 3300050493 Bacteria 513
284 nmdc:mga04h51_104246_c1 3300050495 Bacteria 1037
285 nmdc:mga04h51_120172_c1 3300050495 Bacteria 978
286 nmdc:mga05p37_195588_c1 3300050507 Unclassified 2452
287 nmdc:mga0qj67_572430_c1 3300050509 Unclassified 905
288 nmdc:mga06r32_84337_c1 3300050510 Bacteria 3096
289 nmdc:mga08y16_7453_c1 3300050511 Bacteria 11461
290 nmdc:mga0n895_724326_c1 3300050512 Bacteria 989
291 nmdc:mga0n895_88284_c1 3300050512 Bacteria 3100
292 nmdc:mga0rr50_416847_c1 3300050513 Bacteria 1136
293 nmdc:mga08x19_1038189_c1 3300050514 Bacteria 582
294 nmdc:mga0a205_47177_c1 3300050515 Bacteria 4156
295 Ga0495601_0559900 3300053077 Unclassified 735
296 Ga0495619_0091268 3300053085 Bacteria 2062
297 Ga0500628_122489 3300053129 Unclassified 707
298 Ga0501084_1138211 3300054114 Unclassified 655
299 Ga0501084_1598283 3300054114 Archaea 545
300 nmdc:mga00v17_23088_c1
301 Ga0065704_10406884
302 Ga0065715_10260031
303 Ga0065715_10361697
304 Ga0065715_10978617
305 Ga0065707_10013140
306 Ga0065707_10361735
307 Ga0065707_10422310
308 Ga0065707_10591150
309 Ga0070676_10003472
310 Ga0070676_10643002
311 Ga0070683_100111076
312 Ga0070690_100235755
313 Ga0070670_100112779
314 Ga0070677_10045122
315 Ga0068869_100191934
316 Ga0068869_101127851
317 Ga0070666_10931067
318 Ga0070680_100721454
319 Ga0068868_100521127
320 Ga0070660_101509249
321 Ga0070689_100093609
322 Ga0070689_101363005
323 Ga0070691_10057444
324 Ga0070687_100199010
325 Ga0070687_100868059
326 Ga0070668_100762818
327 Ga0070669_100098956
328 Ga0070675_100414363
329 Ga0070675_100556514
330 Ga0070671_100017565
331 Ga0070674_100759689
332 Ga0070673_100030098
333 Ga0070673_100539016
334 Ga0070659_100121639
335 Ga0070659_100224355
336 Ga0070659_101298514
337 Ga0070667_100652915
338 Ga0070667_100725179
339 Ga0070709_10283326
340 Ga0070713_100180898
341 Ga0070701_10890842
342 Ga0070700_100360596
343 Ga0070694_100461134
344 Ga0070708_100064345
345 Ga0070678_100510591
346 Ga0070662_101279903
347 Ga0068867_100037552
348 Ga0068867_100476688
349 Ga0070706_101107499
350 Ga0070707_101237286
351 Ga0070699_100821661
352 Ga0070679_100160573
353 Ga0070684_100454749
354 Ga0068853_100935961
355 Ga0070672_100129667
356 Ga0070686_100118986
357 Ga0070686_100128966
358 Ga0070695_100839136
359 Ga0070695_101611740
360 Ga0070696_100229978
361 Ga0070696_101737151
362 Ga0070693_100024111
363 Ga0070665_100590197
364 Ga0070665_101154349
365 Ga0070704_100078710
366 Ga0070664_100735555
367 Ga0070664_101199270
368 Ga0070664_101205247
369 Ga0068854_100327339
370 Ga0070702_101172940
371 Ga0068852_100186948
372 Ga0068859_100217766
373 Ga0068859_100625178
374 Ga0068864_100162505
375 Ga0068864_101858233
376 Ga0068866_10462117
377 Ga0068861_100525152
378 Ga0068851_10649636
379 Ga0068860_100311132
380 Ga0068862_100218281
381 Ga0081455_10483094
382 Ga0081539_10022069
383 Ga0075365_10124872
384 Ga0075368_10120311
385 Ga0075364_10007900
386 Ga0075364_10106488
387 Ga0075362_10013647
388 Ga0075362_10270318
389 Ga0075367_10093186
390 Ga0075366_10018198
391 Ga0075366_10024302
392 Ga0097621_100884574
393 Ga0075430_100644162
394 Ga0075431_100890884
395 Ga0075434_100047595
396 Ga0075434_100763575
397 Ga0075429_101220396
398 Ga0068865_100183722
399 Ga0068865_101625060
400 Ga0097620_100217761
401 Ga0097620_100625170
402 Ga0075435_100030350
403 Ga0075435_100797853
404 Ga0105240_10079619
405 Ga0105240_11331841
406 Ga0111539_10003652
407 Ga0111539_11769347
408 Ga0105245_10334769
409 Ga0114129_10010180
410 Ga0114129_10210987
411 Ga0114129_10350404
412 Ga0105243_10017926
413 Ga0105241_10636478
414 Ga0105242_10053751
415 Ga0105242_11263987
416 Ga0105242_12479183
417 Ga0105248_10159885
418 Ga0105248_11675166
419 Ga0105248_12107617
420 Ga0105248_12249336
421 Ga0105248_12499603
422 Ga0105239_10293320
423 Ga0105239_11403246
424 Ga0105246_12505652
425 Ga0157374_12317389
426 Ga0157378_10484698
427 Ga0157378_12307341
428 Ga0163162_10704754
429 Ga0157375_11774494
430 Ga0163163_10096774
431 Ga0157380_10402155
432 Ga0157380_10801205
433 Ga0157380_12219430
434 Ga0157379_11139944
435 Ga0157376_10212493
436 Ga0157376_10991592
437 Ga0207697_10164487
438 Ga0207682_10008365
439 Ga0207642_10555869
440 Ga0207688_10029999
441 Ga0207680_10156306
442 Ga0207647_10101839
443 Ga0207645_10527931
444 Ga0207654_10289186
445 Ga0207695_11329915
446 Ga0207662_10002674
447 Ga0207657_10653327
448 Ga0207652_10214700
449 Ga0207646_10503512
450 Ga0207646_11877144
451 Ga0207681_10245190
452 Ga0207650_10167256
453 Ga0207659_10836269
454 Ga0207659_11234918
455 Ga0207687_10119879
456 Ga0207700_10273231
457 Ga0207700_11797471
458 Ga0207644_10266434
459 Ga0207644_10602346
460 Ga0207690_10229302
461 Ga0207686_10015526
462 Ga0207709_10023707
463 Ga0207709_11247016
464 Ga0207670_10057305
465 Ga0207669_10344346
466 Ga0207704_10579636
467 Ga0207704_10630190
468 Ga0207704_11366176
469 Ga0207691_10019361
470 Ga0207711_10510961
471 Ga0207711_10656354
472 Ga0207711_11327403
473 Ga0207711_11653915
474 Ga0207689_10050017
475 Ga0207661_10038392
476 Ga0207651_10162263
477 Ga0207651_10232868
478 Ga0207712_11445489
479 Ga0207640_10261802
480 Ga0207677_10117215
481 Ga0207703_10065963
482 Ga0207708_10008272
483 Ga0207641_11036366
484 Ga0207648_10031440
485 Ga0207683_10003404
486 Ga0207698_10095204
487 Ga0209813_10101938
488 Ga0207428_10700013
489 Ga0268266_10487388
490 Ga0268265_10727596
491 Ga0268264_10281388
492 Ga0307408_100269406
493 Ga0307405_11226125
494 Ga0307406_11152757
495 Ga0307407_10823719
496 Ga0307409_101734236
497 Ga0307416_100322738
498 Ga0307416_101250777
499 Ga0307411_12350984
500 Ga0373932_0156390
501 Ga0373941_0124189
502 Ga0373943_0040895
503 Ga0373943_0125475
504 Ga0373946_0401195
505 Ga0373961_0269769
506 Ga0373962_0080607
507 Ga0373931_0337866
508 Ga0373937_0301190
509 Ga0373925_0068976
510 Ga0373925_0293340
511 Ga0373925_1279502
512 Ga0395900_1568347
513 Ga0395905_0642496
514 Ga0439436_0055620
515 Ga0439431_0052403
516 Ga0439433_0014975
517 Ga0439449_0018881
518 Ga0450923_119503
519 Ga0450897_025431
520 Ga0450894_070447
521 Ga0439435_0031214
522 Ga0495629_0173631
523 Ga0495582_0932148
524 Ga0495630_0394868
525 Ga0495621_0033662
526 Ga0495634_0184669
527 Ga0495658_0418265
528 Ga0495600_0728076
529 Ga0495684_0201927
530 Ga0496101_0624463
531 Ga0496101_1093743
532 Ga0496102_0033730
533 Ga0496103_0321540
534 Ga0496104_0596383
535 Ga0496105_0776320
536 Ga0496106_0417653
537 Ga0496106_0475951
538 Ga0496108_0502021
539 Ga0496109_0512394
540 Ga0496109_0540166
541 Ga0496109_1168221
542 Ga0496110_1000408
543 Ga0496110_1236487
544 Ga0496112_0031949
545 Ga0496112_0072276
546 Ga0496112_0544281
547 Ga0496113_0052768
548 Ga0496113_1252256
549 Ga0501032_0408828
550 Ga0501034_0028202
551 Ga0501034_0030035
552 Ga0501034_0062784
553 Ga0501034_0077908
554 Ga0501036_1282311
555 Ga0501037_0103478
556 Ga0501038_0632441
557 Ga0501041_0766460
558 Ga0501043_0170892
559 Ga0501047_0046383
560 Ga0501047_0373054
561 Ga0501048_0147384
562 Ga0501070_0590068
563 Ga0501071_1349120
564 Ga0501073_0514005
565 Ga0501074_1074444
566 Ga0501075_0295873
567 Ga0501075_1374580
568 Ga0501079_0402243
569 Ga0501079_0451989
570 Ga0501081_0140938
571 Ga0501081_0297401
572 Ga0501081_0745489
573 Ga0501083_0828484
574 Ga0501268_121235
575 Ga0501044_0024597
576 Ga0501044_0862285
577 nmdc:mga03683_278392_c1
578 nmdc:mga03683_4465_c1
579 nmdc:mga00v17_34195_c1
580 nmdc:mga0k408_11323_c1
581 nmdc:mga0k408_33724_c1
582 nmdc:mga0k408_900213_c1
583 nmdc:mga04h51_104246_c1
584 nmdc:mga04h51_120172_c1
585 nmdc:mga05p37_195588_c1
586 nmdc:mga0qj67_572430_c1
587 nmdc:mga06r32_84337_c1
588 nmdc:mga08y16_7453_c1
589 nmdc:mga0n895_724326_c1
590 nmdc:mga0n895_88284_c1
591 nmdc:mga0rr50_416847_c1
592 nmdc:mga08x19_1038189_c1
593 nmdc:mga0a205_47177_c1
594 Ga0495601_0559900
595 Ga0495619_0091268
596 Ga0500628_122489
597 Ga0501084_1138211
598 Ga0501084_1598283

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

2

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9126 2 116
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9079 2 114
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.9057 2 116
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.9005 1 115
3q9u-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8938 2 114
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9079 2 114 3.40.50.720
af_Q5A3M0_1_157_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8873 2 104 3.40.50.720
4xymA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8725 3 111 3.40.50.720
2duwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8657 2 116 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8655 2 114 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X4I2S9-F1-model_v4 CoA-binding protein 0.9872 4 123
AF-A0A5E4HRV0-F1-model_v4 Acetate--CoA ligase [ADP-forming] II subunit alpha (EC 6.2.1.13) 0.9871 4 123 GO:0043758
AF-A0A7V0YTK5-F1-model_v4 CoA-binding protein 0.987 1 82
AF-A0A2V8E4Y9-F1-model_v4 CoA-binding protein 0.9863 1 108
AF-A0A1E3Y9S6-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9853 2 118 GO:0003824
GO:0071949

Map