F395007

General Info

Members Datasets Scaffolds Average Seq Length
299 142 598 181

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0091857|Ga0495613_0091857_389_985
Length 198
Sequence MGDIEQPEHPTEPDELGEELMLDSPAMESMGPIQMLSLAFPGNRFKGEILPELERLKKAEIVRIIDLLLVRKDELGNVMVTTATDLDWEEAVSFGSYVGALAGYAAAGPAGIEKGAMAGAAELADGHLFDEDDVFRVTQSLPKNMSAVLVLLEHLWVKPLLDAVDRAAGVELSNDWIRPEEIVSVVHRAVRPSDPAES

Samples

Sample ID Description Type Environment
1 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
5 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
14 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
15 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
16 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
19 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
27 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
40 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
41 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
42 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
43 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
44 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
45 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
46 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
47 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
48 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
49 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
50 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
55 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
56 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
57 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
58 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
59 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
60 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
61 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
62 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
63 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
64 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
65 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
66 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
67 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
68 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
69 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
70 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
71 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
72 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
73 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
74 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
75 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
76 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
77 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
78 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
79 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
80 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
81 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
82 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
83 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
84 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
85 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
86 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
87 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
88 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
89 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
90 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
91 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
92 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
93 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
94 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
98 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
99 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
100 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
103 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
104 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
105 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
106 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
107 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
108 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
109 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
110 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
118 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
119 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
127 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
128 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
129 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
130 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
131 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
142 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.34
Nodule 0
Rhizoplane 15.72
Rhizosphere 82.94
Stem 0
Stem Tuber 0
Unclassified 25.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495613_0091857 3300046689 Bacteria 2199
2 Ga0070683_100063142 3300005329 Bacteria 3445
3 Ga0068868_100692682 3300005338 Bacteria 911
4 Ga0070689_100398958 3300005340 Unclassified 1162
5 Ga0070671_100025296 3300005355 Bacteria 4870
6 Ga0070674_100147864 3300005356 Bacteria 1770
7 Ga0070714_100001300 3300005435 Bacteria 18068
8 Ga0070714_100480415 3300005435 Unclassified 1183
9 Ga0070713_100044804 3300005436 Bacteria 3622
10 Ga0070713_100242158 3300005436 Bacteria 1643
11 Ga0070713_100376904 3300005436 Bacteria 1321
12 Ga0070713_100644879 3300005436 Unclassified 1008
13 Ga0070678_100063650 3300005456 Bacteria 2730
14 Ga0070684_100459562 3300005535 Unclassified 1177
15 Ga0070686_100443309 3300005544 Bacteria 996
16 Ga0068856_101717853 3300005614 Bacteria 640
17 Ga0068864_100882943 3300005618 Bacteria 882
18 Ga0070717_10026014 3300006028 Bacteria 4664
19 Ga0070717_10091257 3300006028 Bacteria 2572
20 Ga0070717_10153997 3300006028 Bacteria 1990
21 Ga0075365_10007601 3300006038 Bacteria 6087
22 Ga0075365_10147734 3300006038 Bacteria 1634
23 Ga0070712_100029556 3300006175 Bacteria 3674
24 Ga0070712_100411551 3300006175 Bacteria 1119
25 Ga0075367_10374648 3300006178 Unclassified 899
26 Ga0075431_100331269 3300006847 Unclassified 1533
27 Ga0111539_10355892 3300009094 Bacteria 1704
28 Ga0111539_10509542 3300009094 Bacteria 1401
29 Ga0105245_10743724 3300009098 Bacteria 1016
30 Ga0114129_12496321 3300009147 Bacteria 618
31 Ga0105243_10492892 3300009148 Unclassified 1159
32 Ga0105242_10022185 3300009176 Bacteria 4990
33 Ga0105242_10701910 3300009176 Bacteria 990
34 Ga0105248_10194251 3300009177 Bacteria 2287
35 Ga0163163_10993752 3300014325 Unclassified 902
36 Ga0157376_10445187 3300014969 Unclassified 1262
37 Ga0207692_10414439 3300025898 Bacteria 842
38 Ga0207693_10035960 3300025915 Bacteria 3903
39 Ga0207687_11136914 3300025927 Unclassified 671
40 Ga0207700_10182025 3300025928 Bacteria 1760
41 Ga0207664_10249805 3300025929 Bacteria 1548
42 Ga0207690_10124754 3300025932 Bacteria 1876
43 Ga0207706_11126200 3300025933 Unclassified 655
44 Ga0207686_10003756 3300025934 Bacteria 8149
45 Ga0207711_10300008 3300025941 Unclassified 1482
46 Ga0207640_10472989 3300025981 Bacteria 1038
47 Ga0207676_11577332 3300026095 Bacteria 654
48 Ga0207683_10222915 3300026121 Bacteria 1718
49 Ga0265327_10121313 3300031251 Bacteria 1238
50 Ga0307416_100311881 3300032002 Bacteria 1570
51 Ga0316583_10095453 3300032133 Bacteria 1037
52 Ga0373926_0053745 3300035083 Bacteria 1458
53 Ga0373944_0021602 3300035089 Bacteria 1864
54 Ga0373945_0006338 3300035116 Bacteria 3813
55 Ga0373943_0000775 3300035170 Bacteria 13958
56 Ga0373943_0001085 3300035170 Bacteria 12115
57 Ga0373946_0019734 3300035171 Bacteria 2600
58 Ga0373946_0049768 3300035171 Unclassified 1748
59 Ga0373946_0074175 3300035171 Unclassified 1476
60 Ga0373935_0186251 3300035692 Bacteria 1427
61 Ga0373935_0457997 3300035692 Unclassified 922
62 Ga0373927_0102967 3300035695 Unclassified 1857
63 Ga0373927_0127416 3300035695 Bacteria 1662
64 Ga0373947_0006135 3300035725 Bacteria 6991
65 Ga0373947_0007932 3300035725 Bacteria 6123
66 Ga0373947_0042140 3300035725 Bacteria 2724
67 Ga0373947_0403428 3300035725 Unclassified 922
68 Ga0373925_0009739 3300037068 Bacteria 6981
69 Ga0373925_0018940 3300037068 Bacteria 5003
70 Ga0395900_0156083 3300037418 Bacteria 2331
71 Ga0395898_0212771 3300037466 Bacteria 1844
72 Ga0395901_0461961 3300038443 Bacteria 1297
73 Ga0395901_0485047 3300038443 Unclassified 1260
74 Ga0451791_0890979 3300041451 Bacteria 616
75 Ga0451800_0370328 3300041459 Archaea 968
76 Ga0466963_0126886 3300044694 Bacteria 1759
77 Ga0466967_0174909 3300045976 Bacteria 2022
78 Ga0495592_0087684 3300046454 Bacteria 2238
79 Ga0495592_0333526 3300046454 Unclassified 977
80 Ga0495592_0378082 3300046454 Unclassified 902
81 Ga0495603_0040222 3300046455 Unclassified 2799
82 Ga0495603_0043455 3300046455 Bacteria 2683
83 Ga0495629_0000259 3300046459 Bacteria 46161
84 Ga0495629_0053364 3300046459 Unclassified 2829
85 Ga0495629_0080468 3300046459 Unclassified 2274
86 Ga0495629_0439852 3300046459 Unclassified 884
87 Ga0495641_0000362 3300046461 Bacteria 37539
88 Ga0495641_0015931 3300046461 Bacteria 3982
89 Ga0495641_0093907 3300046461 Bacteria 1340
90 Ga0495641_0221507 3300046461 Bacteria 849
91 Ga0495651_0007108 3300046462 Bacteria 8558
92 Ga0495651_0024320 3300046462 Bacteria 4713
93 Ga0495651_0259621 3300046462 Unclassified 1183
94 Ga0495653_0015223 3300046463 Bacteria 6268
95 Ga0495653_0044327 3300046463 Bacteria 3452
96 Ga0495653_0213094 3300046463 Bacteria 1303
97 Ga0495653_0366819 3300046463 Bacteria 923
98 Ga0495580_0447210 3300046472 Bacteria 867
99 Ga0495582_0001127 3300046473 Bacteria 15031
100 Ga0495582_0079065 3300046473 Unclassified 1825
101 Ga0495582_0133331 3300046473 Unclassified 1404
102 Ga0495582_0189776 3300046473 Bacteria 1172
103 Ga0495582_0322728 3300046473 Bacteria 888
104 Ga0495639_0000867 3300046475 Bacteria 13713
105 Ga0495639_0022552 3300046475 Unclassified 2762
106 Ga0495662_0000661 3300046476 Bacteria 16220
107 Ga0495662_0020125 3300046476 Unclassified 3229
108 Ga0495664_0039285 3300046477 Unclassified 2796
109 Ga0495664_0455991 3300046477 Bacteria 765
110 Ga0495594_0152136 3300046499 Bacteria 1314
111 Ga0495594_0188750 3300046499 Unclassified 1174
112 Ga0495608_0008179 3300046511 Bacteria 7343
113 Ga0495608_0100473 3300046511 Bacteria 1865
114 Ga0495618_0013434 3300046514 Bacteria 4981
115 Ga0495618_0034357 3300046514 Bacteria 3179
116 Ga0495618_0079792 3300046514 Unclassified 2088
117 Ga0495618_0161673 3300046514 Bacteria 1427
118 Ga0495628_0132614 3300046516 Unclassified 1904
119 Ga0495628_0254170 3300046516 Unclassified 1311
120 Ga0495628_0517157 3300046516 Unclassified 860
121 Ga0495630_0003282 3300046517 Bacteria 11286
122 Ga0495630_0015292 3300046517 Bacteria 5601
123 Ga0495630_0093198 3300046517 Bacteria 2276
124 Ga0495644_0117068 3300046523 Bacteria 1013
125 Ga0495666_0000481 3300046526 Bacteria 17768
126 Ga0495666_0431225 3300046526 Bacteria 591
127 Ga0495642_0287576 3300046528 Bacteria 720
128 Ga0495652_0011402 3300046529 Bacteria 8039
129 Ga0495652_0042116 3300046529 Bacteria 3938
130 Ga0495652_0091519 3300046529 Bacteria 2486
131 Ga0495652_0106490 3300046529 Bacteria 2264
132 Ga0495652_0308214 3300046529 Bacteria 1148
133 Ga0495665_0006418 3300046531 Bacteria 6349
134 Ga0495665_0012163 3300046531 Bacteria 4656
135 Ga0495665_0452997 3300046531 Bacteria 648
136 Ga0495640_0002482 3300046533 Bacteria 14838
137 Ga0495640_0008657 3300046533 Bacteria 7975
138 Ga0495640_0098856 3300046533 Unclassified 1917
139 Ga0495640_0334398 3300046533 Bacteria 936
140 Ga0495586_0079203 3300046535 Bacteria 1803
141 Ga0495587_0242400 3300046536 Bacteria 1014
142 Ga0495667_0002704 3300046559 Bacteria 11857
143 Ga0495667_0008281 3300046559 Bacteria 7049
144 Ga0495667_0024613 3300046559 Bacteria 4055
145 Ga0495667_0123813 3300046559 Unclassified 1669
146 Ga0495667_0541429 3300046559 Unclassified 728
147 Ga0495656_0344975 3300046615 Bacteria 771
148 Ga0495634_0023565 3300046642 Bacteria 4323
149 Ga0495634_0032826 3300046642 Bacteria 3568
150 Ga0495634_0062861 3300046642 Bacteria 2464
151 Ga0495634_0083571 3300046642 Unclassified 2083
152 Ga0495634_0092722 3300046642 Bacteria 1959
153 Ga0495634_0129709 3300046642 Bacteria 1608
154 Ga0495634_0274830 3300046642 Bacteria 1024
155 Ga0495635_0004639 3300046663 Bacteria 9536
156 Ga0495635_0027306 3300046663 Bacteria 3970
157 Ga0495635_0211179 3300046663 Bacteria 1314
158 Ga0495635_0488301 3300046663 Unclassified 812
159 Ga0495635_0503688 3300046663 Unclassified 797
160 Ga0495657_0044313 3300046675 Unclassified 3027
161 Ga0495657_0080062 3300046675 Bacteria 2115
162 Ga0495623_0399861 3300046679 Bacteria 739
163 Ga0495646_0039458 3300046680 Bacteria 2911
164 Ga0495647_0000566 3300046681 Bacteria 10910
165 Ga0495647_0002533 3300046681 Bacteria 5785
166 Ga0495647_0242551 3300046681 Bacteria 800
167 Ga0495658_0000993 3300046683 Bacteria 15016
168 Ga0495658_0002162 3300046683 Bacteria 9949
169 Ga0495658_0049216 3300046683 Unclassified 2380
170 Ga0495658_0259219 3300046683 Bacteria 1095
171 Ga0495613_0029803 3300046689 Bacteria 4056
172 Ga0495613_0067691 3300046689 Unclassified 2606
173 Ga0495613_0153587 3300046689 Unclassified 1640
174 Ga0495613_0196580 3300046689 Unclassified 1423
175 Ga0495624_0001840 3300046690 Bacteria 16179
176 Ga0495624_0023391 3300046690 Unclassified 4074
177 Ga0495589_0141700 3300046794 Bacteria 1151
178 Ga0495600_0002798 3300046809 Bacteria 10133
179 Ga0495600_0046924 3300046809 Unclassified 2818
180 Ga0495600_0086119 3300046809 Unclassified 2050
181 Ga0495581_0000327 3300047315 Bacteria 23532
182 Ga0495581_0015573 3300047315 Bacteria 4413
183 Ga0495604_0034347 3300047317 Bacteria 4012
184 Ga0495604_0074961 3300047317 Unclassified 2549
185 Ga0495674_0000135 3300047319 Bacteria 56439
186 Ga0495674_0009426 3300047319 Bacteria 9279
187 Ga0495674_0028006 3300047319 Bacteria 5144
188 Ga0495674_0065048 3300047319 Unclassified 3168
189 Ga0495674_0066045 3300047319 Bacteria 3140
190 Ga0495674_0141585 3300047319 Bacteria 2021
191 Ga0495674_0216022 3300047319 Bacteria 1587
192 Ga0495674_0305350 3300047319 Unclassified 1299
193 Ga0495674_0541647 3300047319 Bacteria 927
194 Ga0495676_0000925 3300047321 Bacteria 24604
195 Ga0495676_0146415 3300047321 Bacteria 1686
196 Ga0495676_0267500 3300047321 Unclassified 1161
197 Ga0495680_0000204 3300047322 Bacteria 64223
198 Ga0495680_0001625 3300047322 Bacteria 23901
199 Ga0495680_0016990 3300047322 Bacteria 6230
200 Ga0495680_0235101 3300047322 Unclassified 1303
201 Ga0495680_0505795 3300047322 Bacteria 819
202 Ga0495684_0003153 3300047471 Bacteria 12924
203 Ga0495684_0005134 3300047471 Bacteria 10213
204 Ga0495684_0008680 3300047471 Bacteria 7860
205 Ga0495684_0567192 3300047471 Bacteria 770
206 Ga0495593_0002156 3300047673 Bacteria 11769
207 Ga0495593_0002869 3300047673 Bacteria 10391
208 Ga0495593_0423490 3300047673 Bacteria 666
209 Ga0495602_0086753 3300048088 Bacteria 2612
210 Ga0495602_0427354 3300048088 Bacteria 939
211 Ga0495614_0000268 3300048089 Bacteria 20291
212 Ga0495614_0005733 3300048089 Bacteria 5594
213 Ga0495614_0075036 3300048089 Unclassified 1461
214 Ga0496100_0011579 3300048903 Bacteria 5025
215 Ga0496100_0269198 3300048903 Unclassified 1266
216 Ga0496101_0075335 3300048904 Bacteria 2484
217 Ga0496101_0238346 3300048904 Bacteria 1415
218 Ga0496102_0113906 3300048905 Bacteria 2523
219 Ga0496103_0091725 3300048906 Bacteria 1917
220 Ga0496103_0387595 3300048906 Bacteria 898
221 Ga0496104_0040859 3300048907 Bacteria 4348
222 Ga0496104_0122718 3300048907 Unclassified 2494
223 Ga0496104_0523554 3300048907 Bacteria 1097
224 Ga0496104_0991206 3300048907 Unclassified 744
225 Ga0496105_0010921 3300048908 Bacteria 7154
226 Ga0496105_0926745 3300048908 Bacteria 655
227 Ga0496105_1082627 3300048908 Unclassified 596
228 Ga0496106_0118853 3300048909 Bacteria 2064
229 Ga0496106_0221779 3300048909 Unclassified 1508
230 Ga0496107_0409437 3300048910 Unclassified 1008
231 Ga0496107_0656014 3300048910 Bacteria 773
232 Ga0496108_0041265 3300048911 Bacteria 3852
233 Ga0496108_0237043 3300048911 Bacteria 1587
234 Ga0496108_0869193 3300048911 Bacteria 775
235 Ga0496108_0945216 3300048911 Unclassified 738
236 Ga0496109_0039109 3300048912 Bacteria 4292
237 Ga0496109_0212721 3300048912 Bacteria 1818
238 Ga0496109_0344706 3300048912 Bacteria 1407
239 Ga0496109_0524439 3300048912 Bacteria 1118
240 Ga0496109_0639134 3300048912 Bacteria 1001
241 Ga0496110_0375476 3300048913 Bacteria 1296
242 Ga0496110_0859637 3300048913 Bacteria 812
243 Ga0496111_0522287 3300048914 Bacteria 873
244 Ga0496112_0041640 3300048915 Bacteria 4494
245 Ga0496112_0393674 3300048915 Unclassified 1326
246 Ga0496112_0457558 3300048915 Bacteria 1214
247 Ga0496112_0528597 3300048915 Unclassified 1114
248 Ga0496112_0804526 3300048915 Unclassified 865
249 Ga0496113_0763630 3300048916 Bacteria 769
250 Ga0496114_0014964 3300048917 Bacteria 6236
251 Ga0496114_0021050 3300048917 Bacteria 5301
252 Ga0496114_0035966 3300048917 Bacteria 4092
253 Ga0496114_0177180 3300048917 Bacteria 1861
254 Ga0496114_0304786 3300048917 Bacteria 1407
255 Ga0496114_0458765 3300048917 Bacteria 1128
256 Ga0496115_0008039 3300048918 Bacteria 7786
257 Ga0496115_0012973 3300048918 Bacteria 6287
258 Ga0496115_0152385 3300048918 Bacteria 1909
259 Ga0501034_0017423 3300049571 Bacteria 7367
260 Ga0501039_0145196 3300049575 Bacteria 1865
261 Ga0501039_0361794 3300049575 Unclassified 1140
262 Ga0501040_0062407 3300049576 Bacteria 2564
263 Ga0501046_0043205 3300049580 Bacteria 3589
264 Ga0501047_0767799 3300049581 Bacteria 779
265 Ga0501067_0013888 3300049583 Bacteria 4459
266 Ga0501070_0027918 3300049586 Bacteria 4734
267 Ga0501073_0035403 3300049589 Bacteria 3550
268 Ga0501075_0393860 3300049591 Bacteria 1056
269 Ga0501077_0004574 3300049593 Bacteria 8411
270 Ga0501079_0123479 3300049741 Bacteria 2014
271 Ga0501079_0562163 3300049741 Bacteria 897
272 Ga0501080_0000120 3300049742 Bacteria 54811
273 Ga0501081_0338937 3300049743 Bacteria 1107
274 Ga0501045_0403049 3300049824 Bacteria 1018
275 nmdc:mga0yw44_664916_c1 3300050492 Unclassified 708
276 nmdc:mga06r32_321401_c1 3300050510 Unclassified 1533
277 nmdc:mga08y16_1317448_c1 3300050511 Bacteria 688
278 Ga0495601_0078252 3300053077 Bacteria 2119
279 Ga0495601_0097311 3300053077 Unclassified 1898
280 Ga0495601_0102621 3300053077 Bacteria 1848
281 Ga0495601_0122851 3300053077 Unclassified 1687
282 Ga0495601_0138559 3300053077 Bacteria 1586
283 Ga0495601_0181411 3300053077 Bacteria 1376
284 Ga0495601_0280530 3300053077 Bacteria 1086
285 Ga0495601_0417503 3300053077 Bacteria 869
286 Ga0495601_0660017 3300053077 Bacteria 669
287 Ga0495612_0238182 3300053078 Bacteria 808
288 Ga0495612_0415421 3300053078 Unclassified 612
289 Ga0495595_0000904 3300053084 Bacteria 11434
290 Ga0495595_0031345 3300053084 Unclassified 2389
291 Ga0495595_0242933 3300053084 Unclassified 901
292 Ga0495619_0000619 3300053085 Bacteria 23500
293 Ga0495619_0002979 3300053085 Bacteria 10998
294 Ga0495619_0005524 3300053085 Bacteria 8023
295 Ga0501084_0294561 3300054114 Bacteria 1370
296 Ga0501084_1042405 3300054114 Bacteria 687
297 Ga0501082_0106724 3300060353 Bacteria 2423
298 Ga0530510_0141485 3300061734 Unclassified 1773
299 Ga0530510_0488974 3300061734 Unclassified 932
300 Ga0495613_0091857
301 Ga0070683_100063142
302 Ga0068868_100692682
303 Ga0070689_100398958
304 Ga0070671_100025296
305 Ga0070674_100147864
306 Ga0070714_100001300
307 Ga0070714_100480415
308 Ga0070713_100044804
309 Ga0070713_100242158
310 Ga0070713_100376904
311 Ga0070713_100644879
312 Ga0070678_100063650
313 Ga0070684_100459562
314 Ga0070686_100443309
315 Ga0068856_101717853
316 Ga0068864_100882943
317 Ga0070717_10026014
318 Ga0070717_10091257
319 Ga0070717_10153997
320 Ga0075365_10007601
321 Ga0075365_10147734
322 Ga0070712_100029556
323 Ga0070712_100411551
324 Ga0075367_10374648
325 Ga0075431_100331269
326 Ga0111539_10355892
327 Ga0111539_10509542
328 Ga0105245_10743724
329 Ga0114129_12496321
330 Ga0105243_10492892
331 Ga0105242_10022185
332 Ga0105242_10701910
333 Ga0105248_10194251
334 Ga0163163_10993752
335 Ga0157376_10445187
336 Ga0207692_10414439
337 Ga0207693_10035960
338 Ga0207687_11136914
339 Ga0207700_10182025
340 Ga0207664_10249805
341 Ga0207690_10124754
342 Ga0207706_11126200
343 Ga0207686_10003756
344 Ga0207711_10300008
345 Ga0207640_10472989
346 Ga0207676_11577332
347 Ga0207683_10222915
348 Ga0265327_10121313
349 Ga0307416_100311881
350 Ga0316583_10095453
351 Ga0373926_0053745
352 Ga0373944_0021602
353 Ga0373945_0006338
354 Ga0373943_0000775
355 Ga0373943_0001085
356 Ga0373946_0019734
357 Ga0373946_0049768
358 Ga0373946_0074175
359 Ga0373935_0186251
360 Ga0373935_0457997
361 Ga0373927_0102967
362 Ga0373927_0127416
363 Ga0373947_0006135
364 Ga0373947_0007932
365 Ga0373947_0042140
366 Ga0373947_0403428
367 Ga0373925_0009739
368 Ga0373925_0018940
369 Ga0395900_0156083
370 Ga0395898_0212771
371 Ga0395901_0461961
372 Ga0395901_0485047
373 Ga0451791_0890979
374 Ga0451800_0370328
375 Ga0466963_0126886
376 Ga0466967_0174909
377 Ga0495592_0087684
378 Ga0495592_0333526
379 Ga0495592_0378082
380 Ga0495603_0040222
381 Ga0495603_0043455
382 Ga0495629_0000259
383 Ga0495629_0053364
384 Ga0495629_0080468
385 Ga0495629_0439852
386 Ga0495641_0000362
387 Ga0495641_0015931
388 Ga0495641_0093907
389 Ga0495641_0221507
390 Ga0495651_0007108
391 Ga0495651_0024320
392 Ga0495651_0259621
393 Ga0495653_0015223
394 Ga0495653_0044327
395 Ga0495653_0213094
396 Ga0495653_0366819
397 Ga0495580_0447210
398 Ga0495582_0001127
399 Ga0495582_0079065
400 Ga0495582_0133331
401 Ga0495582_0189776
402 Ga0495582_0322728
403 Ga0495639_0000867
404 Ga0495639_0022552
405 Ga0495662_0000661
406 Ga0495662_0020125
407 Ga0495664_0039285
408 Ga0495664_0455991
409 Ga0495594_0152136
410 Ga0495594_0188750
411 Ga0495608_0008179
412 Ga0495608_0100473
413 Ga0495618_0013434
414 Ga0495618_0034357
415 Ga0495618_0079792
416 Ga0495618_0161673
417 Ga0495628_0132614
418 Ga0495628_0254170
419 Ga0495628_0517157
420 Ga0495630_0003282
421 Ga0495630_0015292
422 Ga0495630_0093198
423 Ga0495644_0117068
424 Ga0495666_0000481
425 Ga0495666_0431225
426 Ga0495642_0287576
427 Ga0495652_0011402
428 Ga0495652_0042116
429 Ga0495652_0091519
430 Ga0495652_0106490
431 Ga0495652_0308214
432 Ga0495665_0006418
433 Ga0495665_0012163
434 Ga0495665_0452997
435 Ga0495640_0002482
436 Ga0495640_0008657
437 Ga0495640_0098856
438 Ga0495640_0334398
439 Ga0495586_0079203
440 Ga0495587_0242400
441 Ga0495667_0002704
442 Ga0495667_0008281
443 Ga0495667_0024613
444 Ga0495667_0123813
445 Ga0495667_0541429
446 Ga0495656_0344975
447 Ga0495634_0023565
448 Ga0495634_0032826
449 Ga0495634_0062861
450 Ga0495634_0083571
451 Ga0495634_0092722
452 Ga0495634_0129709
453 Ga0495634_0274830
454 Ga0495635_0004639
455 Ga0495635_0027306
456 Ga0495635_0211179
457 Ga0495635_0488301
458 Ga0495635_0503688
459 Ga0495657_0044313
460 Ga0495657_0080062
461 Ga0495623_0399861
462 Ga0495646_0039458
463 Ga0495647_0000566
464 Ga0495647_0002533
465 Ga0495647_0242551
466 Ga0495658_0000993
467 Ga0495658_0002162
468 Ga0495658_0049216
469 Ga0495658_0259219
470 Ga0495613_0029803
471 Ga0495613_0067691
472 Ga0495613_0153587
473 Ga0495613_0196580
474 Ga0495624_0001840
475 Ga0495624_0023391
476 Ga0495589_0141700
477 Ga0495600_0002798
478 Ga0495600_0046924
479 Ga0495600_0086119
480 Ga0495581_0000327
481 Ga0495581_0015573
482 Ga0495604_0034347
483 Ga0495604_0074961
484 Ga0495674_0000135
485 Ga0495674_0009426
486 Ga0495674_0028006
487 Ga0495674_0065048
488 Ga0495674_0066045
489 Ga0495674_0141585
490 Ga0495674_0216022
491 Ga0495674_0305350
492 Ga0495674_0541647
493 Ga0495676_0000925
494 Ga0495676_0146415
495 Ga0495676_0267500
496 Ga0495680_0000204
497 Ga0495680_0001625
498 Ga0495680_0016990
499 Ga0495680_0235101
500 Ga0495680_0505795
501 Ga0495684_0003153
502 Ga0495684_0005134
503 Ga0495684_0008680
504 Ga0495684_0567192
505 Ga0495593_0002156
506 Ga0495593_0002869
507 Ga0495593_0423490
508 Ga0495602_0086753
509 Ga0495602_0427354
510 Ga0495614_0000268
511 Ga0495614_0005733
512 Ga0495614_0075036
513 Ga0496100_0011579
514 Ga0496100_0269198
515 Ga0496101_0075335
516 Ga0496101_0238346
517 Ga0496102_0113906
518 Ga0496103_0091725
519 Ga0496103_0387595
520 Ga0496104_0040859
521 Ga0496104_0122718
522 Ga0496104_0523554
523 Ga0496104_0991206
524 Ga0496105_0010921
525 Ga0496105_0926745
526 Ga0496105_1082627
527 Ga0496106_0118853
528 Ga0496106_0221779
529 Ga0496107_0409437
530 Ga0496107_0656014
531 Ga0496108_0041265
532 Ga0496108_0237043
533 Ga0496108_0869193
534 Ga0496108_0945216
535 Ga0496109_0039109
536 Ga0496109_0212721
537 Ga0496109_0344706
538 Ga0496109_0524439
539 Ga0496109_0639134
540 Ga0496110_0375476
541 Ga0496110_0859637
542 Ga0496111_0522287
543 Ga0496112_0041640
544 Ga0496112_0393674
545 Ga0496112_0457558
546 Ga0496112_0528597
547 Ga0496112_0804526
548 Ga0496113_0763630
549 Ga0496114_0014964
550 Ga0496114_0021050
551 Ga0496114_0035966
552 Ga0496114_0177180
553 Ga0496114_0304786
554 Ga0496114_0458765
555 Ga0496115_0008039
556 Ga0496115_0012973
557 Ga0496115_0152385
558 Ga0501034_0017423
559 Ga0501039_0145196
560 Ga0501039_0361794
561 Ga0501040_0062407
562 Ga0501046_0043205
563 Ga0501047_0767799
564 Ga0501067_0013888
565 Ga0501070_0027918
566 Ga0501073_0035403
567 Ga0501075_0393860
568 Ga0501077_0004574
569 Ga0501079_0123479
570 Ga0501079_0562163
571 Ga0501080_0000120
572 Ga0501081_0338937
573 Ga0501045_0403049
574 nmdc:mga0yw44_664916_c1
575 nmdc:mga06r32_321401_c1
576 nmdc:mga08y16_1317448_c1
577 Ga0495601_0078252
578 Ga0495601_0097311
579 Ga0495601_0102621
580 Ga0495601_0122851
581 Ga0495601_0138559
582 Ga0495601_0181411
583 Ga0495601_0280530
584 Ga0495601_0417503
585 Ga0495601_0660017
586 Ga0495612_0238182
587 Ga0495612_0415421
588 Ga0495595_0000904
589 Ga0495595_0031345
590 Ga0495595_0242933
591 Ga0495619_0000619
592 Ga0495619_0002979
593 Ga0495619_0005524
594 Ga0501084_0294561
595 Ga0501084_1042405
596 Ga0501082_0106724
597 Ga0530510_0141485
598 Ga0530510_0488974

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6u73-assembly1.cif.gz_A human angiopoietin-like 4 c-terminal domain (cangptl4) with myristic acid 0.8455 55 76
6xi3-assembly1.cif.gz_AAA crystal structure of tetra-tandem repeat in extending region of large adhesion protein 0.6896 55 76
8ail-assembly1.cif.gz_J bacillus phage vmy22 p56 in complex with bacillus weidmannii ung 0.589 55 83
8ail-assembly2.cif.gz_E bacillus phage vmy22 p56 in complex with bacillus weidmannii ung 0.5837 52 83
8qfl-assembly1.cif.gz_A ergothioneine dioxygenase from thermocatellispora tengchongensis in complex with iron 0.5698 54 79
ID Description Score Start End Superfamily
af_A0A0J9YIY3_201_300_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7472 56 76 2.60.40.10
af_K7KQF7_117_252_3.30.750.44 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA; 0.7188 53 76 3.30.750.44
af_O44870_11_124_2.60.120.1540 Mainly Beta;Sandwich;Jelly Rolls; 0.7096 55 78 2.60.120.1540
af_G5ECX2_917_1013_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6963 55 77 2.60.40.10
af_Q2R7K1_300_442_2.60.40.1470 Mainly Beta;Sandwich;Immunoglobulin-like;ApaG domain 0.6843 54 77 2.60.40.1470
ID Description Score Start End GO Terms
AF-A0A368TH04-F1-model_v4 Putative membrane protein 0.9422 21 180
AF-A0A3B0REK6-F1-model_v4 DUF1269 domain-containing protein 0.9247 20 181
AF-A0A1M4EG51-F1-model_v4 DUF1269 domain-containing protein 0.917 22 180
AF-A0A3B0REK6-F1-model_v4 DUF1269 domain-containing protein 0.9035 20 181
AF-A0A0E3PRA1-F1-model_v4 DUF1269 domain-containing protein 0.8875 22 180

Map