F394604

General Info

Members Datasets Scaffolds Average Seq Length
299 200 598 268

Family's Representative Sequence

Representative Sequence 3300001989|JGI24739J22299_10047264|JGI24739J22299_100472641
Length 268
Sequence MSTLSFKVLDLDFPAGSKNKTATLVTGENEALLVDAGFTRADGHRLVAEILDSGKTLTTVFISHGDPDFYFGAEVIADAFPEARFVATPIVIEHIQHSYEGKLKAWAALGPNLPTRLVDLEPLTGDLTLEGHRFELKGGPAGLPDRHYLWQAEQRALLGGVLLFQQEHVWVADXPTPGDRAAWIDLLDEMAALDPELVVPGHRLPGAPADASAIAATREYLLAFEEELGKAADGAALTEALVKRYPGNGMQIAAQIGAKVAKGEMKWG

Samples

Sample ID Description Type Environment
1 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
23 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
32 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
43 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
50 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
51 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
54 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
55 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
58 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
59 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
60 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
61 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
62 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
65 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
66 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
67 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
70 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
71 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
72 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
73 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
74 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
75 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
76 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
77 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
78 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
79 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
80 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
84 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
85 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
86 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
87 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
93 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
98 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
99 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
100 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
101 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
102 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
103 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
104 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
107 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
110 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
111 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
112 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
113 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
114 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
132 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
133 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
136 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
137 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
138 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
139 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
140 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
141 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
142 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
143 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
144 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
148 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
151 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
152 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
153 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
154 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
155 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
156 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
157 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
158 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
159 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
160 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
161 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
162 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
163 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
164 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
165 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
166 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
167 2508501039 Frankia saprophytica CN3 Isolate Nodule
168 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
169 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
170 2643221647 Streptomyces sp. Root369 Isolate Unclassified
171 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
172 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
173 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
174 2643221714 Streptomyces sp. Root264 Isolate Unclassified
175 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
176 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
177 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
178 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
179 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
180 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
181 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
182 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
183 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
184 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
185 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
186 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
187 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
188 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
189 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
190 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
191 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
192 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
193 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
194 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
195 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
196 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
197 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
198 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
199 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
200 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.29
Metatranscriptomes 0.67
Isolates 12.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.05
Nodule 1.67
Rhizoplane 0.67
Rhizosphere 62.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10047264 3300001989 Bacteria 1405
2 JGI24738J21930_10028554 3300002075 Bacteria 1141
3 rootH2_10038376 3300003320 Bacteria 2145
4 rootL2_10103223 3300003322 Bacteria 3463
5 Ga0006562J51391_1119893 3300003578 Bacteria 1250
6 Ga0065714_10027701 3300005288 Bacteria 1598
7 Ga0070668_100010871 3300005347 Bacteria 6772
8 Ga0070667_100022584 3300005367 Bacteria 5217
9 Ga0070667_100023587 3300005367 Bacteria 5106
10 Ga0070714_100166847 3300005435 Bacteria 1996
11 Ga0068855_100788109 3300005563 Bacteria 1011
12 Ga0068859_100345702 3300005617 Bacteria 1582
13 Ga0068864_100637131 3300005618 Bacteria 1037
14 Ga0068863_100301210 3300005841 Bacteria 1555
15 Ga0068863_100455995 3300005841 Bacteria 1255
16 Ga0068858_100187347 3300005842 Bacteria 1955
17 Ga0068860_100000622 3300005843 Bacteria 41944
18 Ga0068860_100016768 3300005843 Bacteria 7141
19 Ga0075365_10024364 3300006038 Bacteria 3816
20 Ga0075368_10003156 3300006042 Bacteria 5478
21 Ga0075368_10077446 3300006042 Bacteria 1350
22 Ga0075363_100018545 3300006048 Bacteria 3469
23 Ga0075363_100032167 3300006048 Bacteria 2723
24 Ga0075363_100036959 3300006048 Bacteria 2563
25 Ga0075363_100298496 3300006048 Bacteria 934
26 Ga0075364_10006644 3300006051 Bacteria 6815
27 Ga0075364_10025026 3300006051 Bacteria 3796
28 Ga0075367_10172414 3300006178 Bacteria 1348
29 Ga0075367_10183475 3300006178 Bacteria 1305
30 Ga0075367_10246753 3300006178 Bacteria 1119
31 Ga0075370_10003692 3300006353 Bacteria 7330
32 Ga0097620_100345666 3300006931 Bacteria 1582
33 Ga0099826_10091588 3300006948 Bacteria 1858
34 Ga0105237_10590100 3300009545 Bacteria 1118
35 Ga0105239_10388186 3300010375 Bacteria 1579
36 Ga0105239_10483504 3300010375 Bacteria 1407
37 Ga0105246_10034262 3300011119 Bacteria 3382
38 Ga0157369_10461993 3300013105 Bacteria 1314
39 Ga0157375_10382427 3300013308 Bacteria 1574
40 Ga0163163_10248998 3300014325 Bacteria 1827
41 Ga0163163_10541119 3300014325 Bacteria 1227
42 Ga0163163_10677389 3300014325 Bacteria 1095
43 Ga0157380_10172537 3300014326 Bacteria 1891
44 Ga0206353_10576871 3300020082 Bacteria 1682
45 Ga0209677_100647 3300025253 Bacteria 18443
46 Ga0207647_10087137 3300025904 Bacteria 1866
47 Ga0207667_10597956 3300025949 Bacteria 1113
48 Ga0207668_10001387 3300025972 Bacteria 14293
49 Ga0207668_10022229 3300025972 Bacteria 4056
50 Ga0207658_10076205 3300025986 Bacteria 2554
51 Ga0207658_10087654 3300025986 Bacteria 2404
52 Ga0207703_10502457 3300026035 Bacteria 1138
53 Ga0207702_10080449 3300026078 Bacteria 2827
54 Ga0207641_10261009 3300026088 Bacteria 1622
55 Ga0207683_10204580 3300026121 Bacteria 1795
56 Ga0209371_1017801 3300027312 Bacteria 1828
57 Ga0209813_10025377 3300027866 Bacteria 1704
58 Ga0209813_10103948 3300027866 Bacteria 970
59 Ga0268264_10000371 3300028381 Bacteria 66158
60 Ga0307517_10057171 3300028786 Bacteria 3786
61 Ga0307517_10068056 3300028786 Bacteria 3249
62 Ga0307517_10124035 3300028786 Bacteria 1894
63 Ga0307515_10000351 3300028794 Bacteria 113208
64 Ga0307515_10002059 3300028794 Bacteria 44330
65 Ga0307515_10003714 3300028794 Bacteria 32026
66 Ga0307515_10057249 3300028794 Bacteria 5645
67 Ga0307515_10151796 3300028794 Bacteria 2417
68 Ga0307515_10217291 3300028794 Bacteria 1739
69 Ga0268256_1022820 3300030500 Bacteria 1635
70 Ga0307511_10002961 3300030521 Bacteria 17599
71 Ga0307511_10142815 3300030521 Bacteria 1400
72 Ga0307512_10001052 3300030522 Bacteria 40344
73 Ga0307512_10052775 3300030522 Bacteria 3238
74 Ga0307512_10190059 3300030522 Bacteria 1134
75 Ga0316177_1011588 3300030731 Bacteria 3135
76 Ga0314311_1023672 3300030733 Bacteria 3020
77 Ga0307513_10007890 3300031456 Bacteria 13716
78 Ga0307513_10059437 3300031456 Bacteria 4057
79 Ga0307509_10001840 3300031507 Bacteria 35075
80 Ga0307509_10013013 3300031507 Bacteria 9879
81 Ga0307509_10016244 3300031507 Bacteria 8623
82 Ga0307509_10301594 3300031507 Bacteria 1350
83 Ga0307508_10004924 3300031616 Bacteria 12852
84 Ga0307508_10013543 3300031616 Bacteria 7454
85 Ga0307508_10060022 3300031616 Bacteria 3364
86 Ga0307508_10079415 3300031616 Bacteria 2861
87 Ga0307508_10125487 3300031616 Bacteria 2169
88 Ga0307514_10014425 3300031649 Bacteria 6541
89 Ga0307516_10002807 3300031730 Bacteria 22950
90 Ga0307516_10019014 3300031730 Bacteria 7128
91 Ga0307516_10111503 3300031730 Bacteria 2537
92 Ga0307409_100060824 3300031995 Bacteria 2948
93 Ga0307409_100601103 3300031995 Bacteria 1087
94 Ga0307415_100309927 3300032126 Bacteria 1311
95 Ga0307507_10000821 3300033179 Bacteria 68944
96 Ga0307507_10009293 3300033179 Bacteria 13163
97 Ga0307507_10050459 3300033179 Bacteria 4016
98 Ga0307510_10195739 3300033180 Bacteria 1563
99 Ga0373938_0011596 3300034957 Bacteria 1641
100 Ga0373951_0000124 3300035091 Bacteria 29147
101 Ga0373942_0000651 3300035207 Bacteria 9742
102 Ga0395900_0028446 3300037418 Bacteria 5725
103 Ga0395898_0004150 3300037466 Bacteria 15886
104 Ga0439436_0003144 3300041404 Bacteria 5005
105 Ga0439439_0012808 3300041406 Bacteria 2028
106 Ga0451853_1850236 3300041512 Bacteria 2651
107 Ga0451853_1955847 3300041512 Bacteria 4351
108 Ga0451853_2656050 3300041512 Bacteria 10418
109 Ga0439449_0001025 3300042007 Bacteria 11016
110 Ga0439455_0038818 3300042012 Bacteria 1213
111 Ga0439457_005009 3300042014 Bacteria 3387
112 Ga0439457_007732 3300042014 Bacteria 2570
113 Ga0450894_001490 3300042131 Bacteria 3344
114 Ga0450895_001671 3300042132 Bacteria 1570
115 Ga0450896_005459 3300042133 Bacteria 1732
116 Ga0450899_000222 3300042135 Bacteria 5964
117 Ga0450903_000112 3300042138 Bacteria 17372
118 Ga0450906_002207 3300042145 Bacteria 4255
119 Ga0466969_0027992 3300044656 Bacteria 2883
120 Ga0466972_0039426 3300044658 Bacteria 2305
121 Ga0466972_0114954 3300044658 Bacteria 1270
122 Ga0466965_0011298 3300044683 Bacteria 4181
123 Ga0466966_0022137 3300044684 Bacteria 4172
124 Ga0466971_0007899 3300044719 Bacteria 4634
125 Ga0466959_0054820 3300045049 Bacteria 2911
126 Ga0495592_0000011 3300046454 Bacteria 156647
127 Ga0495592_0001336 3300046454 Bacteria 17119
128 Ga0495592_0008305 3300046454 Bacteria 7791
129 Ga0495590_0056650 3300046457 Bacteria 1370
130 Ga0495629_0006409 3300046459 Bacteria 8723
131 Ga0495629_0024081 3300046459 Bacteria 4335
132 Ga0495638_0235803 3300046460 Bacteria 1015
133 Ga0495651_0000994 3300046462 Bacteria 21999
134 Ga0495651_0004349 3300046462 Bacteria 10843
135 Ga0495651_0040695 3300046462 Bacteria 3612
136 Ga0495653_0000345 3300046463 Bacteria 37856
137 Ga0495582_0060777 3300046473 Bacteria 2085
138 Ga0495662_0001053 3300046476 Bacteria 13533
139 Ga0495662_0002583 3300046476 Bacteria 9143
140 Ga0495662_0005322 3300046476 Bacteria 6447
141 Ga0495664_0000520 3300046477 Bacteria 19243
142 Ga0495664_0000552 3300046477 Bacteria 18839
143 Ga0495664_0001631 3300046477 Bacteria 11919
144 Ga0495594_0090309 3300046499 Bacteria 1716
145 Ga0495608_0097738 3300046511 Bacteria 1895
146 Ga0495618_0040563 3300046514 Bacteria 2930
147 Ga0495628_0000064 3300046516 Bacteria 85991
148 Ga0495628_0029301 3300046516 Bacteria 4464
149 Ga0495630_0000035 3300046517 Bacteria 118545
150 Ga0495630_0001890 3300046517 Bacteria 14594
151 Ga0495632_0023809 3300046519 Bacteria 3264
152 Ga0495632_0120558 3300046519 Bacteria 1226
153 Ga0495643_0011191 3300046522 Bacteria 5481
154 Ga0495666_0000390 3300046526 Bacteria 19234
155 Ga0495666_0000539 3300046526 Bacteria 16851
156 Ga0495652_0000169 3300046529 Bacteria 74610
157 Ga0495652_0013675 3300046529 Bacteria 7302
158 Ga0495652_0071740 3300046529 Bacteria 2889
159 Ga0495640_0009478 3300046533 Bacteria 7584
160 Ga0495640_0011851 3300046533 Bacteria 6687
161 Ga0495640_0028597 3300046533 Bacteria 4012
162 Ga0495587_0000064 3300046536 Bacteria 90007
163 Ga0495587_0000283 3300046536 Bacteria 35918
164 Ga0495587_0001922 3300046536 Bacteria 13843
165 Ga0495645_0000042 3300046543 Bacteria 91093
166 Ga0495645_0006372 3300046543 Bacteria 8188
167 Ga0495645_0068840 3300046543 Bacteria 2555
168 Ga0495667_0000921 3300046559 Bacteria 19020
169 Ga0495667_0069534 3300046559 Bacteria 2297
170 Ga0495634_0000148 3300046642 Bacteria 62329
171 Ga0495634_0002744 3300046642 Bacteria 14483
172 Ga0495634_0004398 3300046642 Bacteria 11082
173 Ga0495625_0026375 3300046660 Bacteria 4392
174 Ga0495625_0101157 3300046660 Bacteria 1980
175 Ga0495635_0000032 3300046663 Bacteria 109069
176 Ga0495635_0002578 3300046663 Bacteria 12401
177 Ga0495635_0004805 3300046663 Bacteria 9395
178 Ga0495635_0070662 3300046663 Bacteria 2393
179 Ga0495588_0007978 3300046674 Bacteria 4840
180 Ga0495657_0000862 3300046675 Bacteria 26723
181 Ga0495657_0002012 3300046675 Bacteria 17300
182 Ga0495657_0002582 3300046675 Bacteria 15165
183 Ga0495657_0003668 3300046675 Bacteria 12459
184 Ga0495599_0000044 3300046678 Bacteria 89350
185 Ga0495599_0063609 3300046678 Bacteria 2305
186 Ga0495623_0001203 3300046679 Bacteria 17541
187 Ga0495646_0000028 3300046680 Bacteria 92735
188 Ga0495646_0015024 3300046680 Bacteria 4917
189 Ga0495613_0001051 3300046689 Bacteria 21064
190 Ga0495613_0012599 3300046689 Bacteria 6288
191 Ga0495613_0145208 3300046689 Bacteria 1693
192 Ga0495624_0089237 3300046690 Bacteria 1903
193 Ga0495671_0004562 3300046692 Bacteria 8247
194 Ga0495600_0000044 3300046809 Bacteria 71943
195 Ga0495600_0001214 3300046809 Bacteria 14117
196 Ga0495600_0104497 3300046809 Bacteria 1845
197 Ga0495581_0002865 3300047315 Bacteria 9852
198 Ga0495604_0000542 3300047317 Bacteria 33256
199 Ga0495604_0000545 3300047317 Bacteria 33154
200 Ga0495604_0000875 3300047317 Bacteria 25113
201 Ga0495674_0000036 3300047319 Bacteria 103830
202 Ga0495674_0002508 3300047319 Bacteria 17876
203 Ga0495674_0086816 3300047319 Bacteria 2678
204 Ga0495676_0029856 3300047321 Bacteria 4635
205 Ga0495680_0004036 3300047322 Bacteria 14162
206 Ga0495683_0094457 3300047323 Bacteria 1445
207 Ga0495687_001005 3300047443 Bacteria 28145
208 Ga0495687_002958 3300047443 Bacteria 12880
209 Ga0495687_016701 3300047443 Bacteria 3684
210 Ga0495675_0000580 3300047444 Bacteria 23548
211 Ga0495675_0016059 3300047444 Bacteria 4734
212 Ga0495675_0042771 3300047444 Bacteria 2886
213 Ga0495685_005792 3300047447 Bacteria 4036
214 Ga0495681_0005369 3300047470 Bacteria 8595
215 Ga0495684_0000474 3300047471 Bacteria 32805
216 Ga0495684_0001417 3300047471 Bacteria 19212
217 Ga0495684_0155302 3300047471 Bacteria 1709
218 Ga0495593_0003083 3300047673 Bacteria 10021
219 Ga0495593_0058239 3300047673 Bacteria 2027
220 Ga0495602_0000078 3300048088 Bacteria 94384
221 Ga0495602_0001437 3300048088 Bacteria 23643
222 Ga0495602_0011419 3300048088 Bacteria 9185
223 Ga0495614_0000643 3300048089 Bacteria 14601
224 Ga0495614_0025896 3300048089 Bacteria 2528
225 Ga0495615_0080816 3300048090 Bacteria 891
226 Ga0496102_0037245 3300048905 Bacteria 4387
227 Ga0496115_0094695 3300048918 Bacteria 2443
228 Ga0496117_0056380 3300048920 Bacteria 2737
229 nmdc:mga03n38_101259_c1 3300050490 Bacteria 1390
230 nmdc:mga03n38_9174_c1 3300050490 Bacteria 3584
231 nmdc:mga00v17_166063_c1 3300050491 Bacteria 1422
232 nmdc:mga00v17_196172_c1 3300050491 Bacteria 1305
233 nmdc:mga00v17_243674_c1 3300050491 Bacteria 1166
234 nmdc:mga0yw44_31641_c1 3300050492 Bacteria 3078
235 nmdc:mga0k408_6096_c1 3300050493 Bacteria 6423
236 nmdc:mga06z11_46044_c1 3300050494 Bacteria 2208
237 nmdc:mga04h51_43194_c1 3300050495 Bacteria 1482
238 Ga0495601_0003584 3300053077 Bacteria 8930
239 Ga0495655_0008345 3300053083 Bacteria 1964
240 Ga0495619_0071784 3300053085 Bacteria 2317
241 Ga0500578_0068882 3300053086 Bacteria 2255
242 Ga0500644_0007762 3300053088 Bacteria 2806
243 Ga0500646_0026078 3300053090 Bacteria 1583
244 Ga0500651_0043756 3300053093 Bacteria 2820
245 Ga0500640_010582 3300053095 Bacteria 3731
246 Ga0500641_0029531 3300053096 Bacteria 2149
247 Ga0500650_0022624 3300053098 Bacteria 2784
248 Ga0500553_042069 3300053101 Bacteria 2235
249 Ga0500569_109140 3300053109 Bacteria 913
250 Ga0500572_029709 3300053111 Bacteria 1514
251 Ga0500594_0004669 3300053118 Bacteria 3026
252 Ga0500652_020127 3300053131 Bacteria 2491
253 Ga0500658_0015114 3300053134 Bacteria 2862
254 Ga0500561_0023124 3300053137 Bacteria 1485
255 Ga0500574_078440 3300053141 Bacteria 973
256 Ga0500579_088065 3300053143 Bacteria 1694
257 Ga0500600_0014949 3300053149 Bacteria 4715
258 Ga0500616_0054273 3300053153 Bacteria 2099
259 Ga0500622_0143027 3300053156 Bacteria 1139
260 Ga0500633_0003160 3300053160 Bacteria 3537
261 Ga0500634_0023460 3300053161 Bacteria 3353
262 Ga0500656_002621 3300053732 Bacteria 1641
263 Ga0500587_005557 3300053739 Bacteria 1691
264 2508672970 2508501039 Bacteria 9978592
265 2585317241 2582581314 Bacteria 11452267
266 2616701068 2616644814 Bacteria 11555299
267 2644267323 2643221647 Bacteria 10741251
268 2644441303 2643221678 Bacteria 9540101
269 2644504035 2643221690 Bacteria 4654705
270 2644526899 2643221694 Bacteria 4392972
271 2644627328 2643221714 Bacteria 9015452
272 2645722478 2643221961 Bacteria 3919167
273 2645725449 2643221962 Bacteria 3874254
274 2689995010 2687453743 Bacteria 8361025
275 2785340042 2784746763 Bacteria 9783172
276 2785342546 2784746763 Bacteria 9783172
277 2785372109 2784746768 Bacteria 10036182
278 2786674535 2786546132 Bacteria 10419719
279 2808915038 2808606375 Bacteria 9466072
280 2809195035 2808606439 Bacteria 5952208
281 2812353423 2811994879 Bacteria 9313447
282 2862385022 2862382967 Bacteria 10317375
283 2868090348 2868088558 Bacteria 7609351
284 2877677450 2877676314 Bacteria 9512378
285 2877684551 2877676314 Bacteria 9512378
286 2912719034 2912715099 Bacteria 9460473
287 2935396875 2935390628 Bacteria 7043367
288 2945943239 2945941187 Bacteria 4682474
289 2946079845 2946072368 Bacteria 8999607
290 2954008522 2954002825 Bacteria 9173742
291 2954382181 2954380949 Bacteria 10050426
292 2954683288 2954682443 Bacteria 9862841
293 2954692990 2954691527 Bacteria 10720516
294 2954708063 2954701450 Bacteria 10834262
295 2954719890 2954711539 Bacteria 10867210
296 2954729926 2954721474 Bacteria 10456478
297 2954750821 2954749733 Bacteria 10366972
298 8008565129 8008558824 Bacteria 10610750
299 8056055627 8056054917 Bacteria 5736694
300 JGI24739J22299_10047264
301 JGI24738J21930_10028554
302 rootH2_10038376
303 rootL2_10103223
304 Ga0006562J51391_1119893
305 Ga0065714_10027701
306 Ga0070668_100010871
307 Ga0070667_100022584
308 Ga0070667_100023587
309 Ga0070714_100166847
310 Ga0068855_100788109
311 Ga0068859_100345702
312 Ga0068864_100637131
313 Ga0068863_100301210
314 Ga0068863_100455995
315 Ga0068858_100187347
316 Ga0068860_100000622
317 Ga0068860_100016768
318 Ga0075365_10024364
319 Ga0075368_10003156
320 Ga0075368_10077446
321 Ga0075363_100018545
322 Ga0075363_100032167
323 Ga0075363_100036959
324 Ga0075363_100298496
325 Ga0075364_10006644
326 Ga0075364_10025026
327 Ga0075367_10172414
328 Ga0075367_10183475
329 Ga0075367_10246753
330 Ga0075370_10003692
331 Ga0097620_100345666
332 Ga0099826_10091588
333 Ga0105237_10590100
334 Ga0105239_10388186
335 Ga0105239_10483504
336 Ga0105246_10034262
337 Ga0157369_10461993
338 Ga0157375_10382427
339 Ga0163163_10248998
340 Ga0163163_10541119
341 Ga0163163_10677389
342 Ga0157380_10172537
343 Ga0206353_10576871
344 Ga0209677_100647
345 Ga0207647_10087137
346 Ga0207667_10597956
347 Ga0207668_10001387
348 Ga0207668_10022229
349 Ga0207658_10076205
350 Ga0207658_10087654
351 Ga0207703_10502457
352 Ga0207702_10080449
353 Ga0207641_10261009
354 Ga0207683_10204580
355 Ga0209371_1017801
356 Ga0209813_10025377
357 Ga0209813_10103948
358 Ga0268264_10000371
359 Ga0307517_10057171
360 Ga0307517_10068056
361 Ga0307517_10124035
362 Ga0307515_10000351
363 Ga0307515_10002059
364 Ga0307515_10003714
365 Ga0307515_10057249
366 Ga0307515_10151796
367 Ga0307515_10217291
368 Ga0268256_1022820
369 Ga0307511_10002961
370 Ga0307511_10142815
371 Ga0307512_10001052
372 Ga0307512_10052775
373 Ga0307512_10190059
374 Ga0316177_1011588
375 Ga0314311_1023672
376 Ga0307513_10007890
377 Ga0307513_10059437
378 Ga0307509_10001840
379 Ga0307509_10013013
380 Ga0307509_10016244
381 Ga0307509_10301594
382 Ga0307508_10004924
383 Ga0307508_10013543
384 Ga0307508_10060022
385 Ga0307508_10079415
386 Ga0307508_10125487
387 Ga0307514_10014425
388 Ga0307516_10002807
389 Ga0307516_10019014
390 Ga0307516_10111503
391 Ga0307409_100060824
392 Ga0307409_100601103
393 Ga0307415_100309927
394 Ga0307507_10000821
395 Ga0307507_10009293
396 Ga0307507_10050459
397 Ga0307510_10195739
398 Ga0373938_0011596
399 Ga0373951_0000124
400 Ga0373942_0000651
401 Ga0395900_0028446
402 Ga0395898_0004150
403 Ga0439436_0003144
404 Ga0439439_0012808
405 Ga0451853_1850236
406 Ga0451853_1955847
407 Ga0451853_2656050
408 Ga0439449_0001025
409 Ga0439455_0038818
410 Ga0439457_005009
411 Ga0439457_007732
412 Ga0450894_001490
413 Ga0450895_001671
414 Ga0450896_005459
415 Ga0450899_000222
416 Ga0450903_000112
417 Ga0450906_002207
418 Ga0466969_0027992
419 Ga0466972_0039426
420 Ga0466972_0114954
421 Ga0466965_0011298
422 Ga0466966_0022137
423 Ga0466971_0007899
424 Ga0466959_0054820
425 Ga0495592_0000011
426 Ga0495592_0001336
427 Ga0495592_0008305
428 Ga0495590_0056650
429 Ga0495629_0006409
430 Ga0495629_0024081
431 Ga0495638_0235803
432 Ga0495651_0000994
433 Ga0495651_0004349
434 Ga0495651_0040695
435 Ga0495653_0000345
436 Ga0495582_0060777
437 Ga0495662_0001053
438 Ga0495662_0002583
439 Ga0495662_0005322
440 Ga0495664_0000520
441 Ga0495664_0000552
442 Ga0495664_0001631
443 Ga0495594_0090309
444 Ga0495608_0097738
445 Ga0495618_0040563
446 Ga0495628_0000064
447 Ga0495628_0029301
448 Ga0495630_0000035
449 Ga0495630_0001890
450 Ga0495632_0023809
451 Ga0495632_0120558
452 Ga0495643_0011191
453 Ga0495666_0000390
454 Ga0495666_0000539
455 Ga0495652_0000169
456 Ga0495652_0013675
457 Ga0495652_0071740
458 Ga0495640_0009478
459 Ga0495640_0011851
460 Ga0495640_0028597
461 Ga0495587_0000064
462 Ga0495587_0000283
463 Ga0495587_0001922
464 Ga0495645_0000042
465 Ga0495645_0006372
466 Ga0495645_0068840
467 Ga0495667_0000921
468 Ga0495667_0069534
469 Ga0495634_0000148
470 Ga0495634_0002744
471 Ga0495634_0004398
472 Ga0495625_0026375
473 Ga0495625_0101157
474 Ga0495635_0000032
475 Ga0495635_0002578
476 Ga0495635_0004805
477 Ga0495635_0070662
478 Ga0495588_0007978
479 Ga0495657_0000862
480 Ga0495657_0002012
481 Ga0495657_0002582
482 Ga0495657_0003668
483 Ga0495599_0000044
484 Ga0495599_0063609
485 Ga0495623_0001203
486 Ga0495646_0000028
487 Ga0495646_0015024
488 Ga0495613_0001051
489 Ga0495613_0012599
490 Ga0495613_0145208
491 Ga0495624_0089237
492 Ga0495671_0004562
493 Ga0495600_0000044
494 Ga0495600_0001214
495 Ga0495600_0104497
496 Ga0495581_0002865
497 Ga0495604_0000542
498 Ga0495604_0000545
499 Ga0495604_0000875
500 Ga0495674_0000036
501 Ga0495674_0002508
502 Ga0495674_0086816
503 Ga0495676_0029856
504 Ga0495680_0004036
505 Ga0495683_0094457
506 Ga0495687_001005
507 Ga0495687_002958
508 Ga0495687_016701
509 Ga0495675_0000580
510 Ga0495675_0016059
511 Ga0495675_0042771
512 Ga0495685_005792
513 Ga0495681_0005369
514 Ga0495684_0000474
515 Ga0495684_0001417
516 Ga0495684_0155302
517 Ga0495593_0003083
518 Ga0495593_0058239
519 Ga0495602_0000078
520 Ga0495602_0001437
521 Ga0495602_0011419
522 Ga0495614_0000643
523 Ga0495614_0025896
524 Ga0495615_0080816
525 Ga0496102_0037245
526 Ga0496115_0094695
527 Ga0496117_0056380
528 nmdc:mga03n38_101259_c1
529 nmdc:mga03n38_9174_c1
530 nmdc:mga00v17_166063_c1
531 nmdc:mga00v17_196172_c1
532 nmdc:mga00v17_243674_c1
533 nmdc:mga0yw44_31641_c1
534 nmdc:mga0k408_6096_c1
535 nmdc:mga06z11_46044_c1
536 nmdc:mga04h51_43194_c1
537 Ga0495601_0003584
538 Ga0495655_0008345
539 Ga0495619_0071784
540 Ga0500578_0068882
541 Ga0500644_0007762
542 Ga0500646_0026078
543 Ga0500651_0043756
544 Ga0500640_010582
545 Ga0500641_0029531
546 Ga0500650_0022624
547 Ga0500553_042069
548 Ga0500569_109140
549 Ga0500572_029709
550 Ga0500594_0004669
551 Ga0500652_020127
552 Ga0500658_0015114
553 Ga0500561_0023124
554 Ga0500574_078440
555 Ga0500579_088065
556 Ga0500600_0014949
557 Ga0500616_0054273
558 Ga0500622_0143027
559 Ga0500633_0003160
560 Ga0500634_0023460
561 Ga0500656_002621
562 Ga0500587_005557
563 2508672970
564 2585317241
565 2616701068
566 2644267323
567 2644441303
568 2644504035
569 2644526899
570 2644627328
571 2645722478
572 2645725449
573 2689995010
574 2785340042
575 2785342546
576 2785372109
577 2786674535
578 2808915038
579 2809195035
580 2812353423
581 2862385022
582 2868090348
583 2877677450
584 2877684551
585 2912719034
586 2935396875
587 2945943239
588 2946079845
589 2954008522
590 2954382181
591 2954683288
592 2954692990
593 2954708063
594 2954719890
595 2954729926
596 2954750821
597 8008565129
598 8056055627

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

16

202

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.797 5 220
2xf4-assembly1.cif.gz_A-2 crystal structure of salmonella enterica serovar typhimurium ycbl 0.7835 5 220
7l0b-assembly1.cif.gz_A crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme 0.7822 3 188
1bc2-assembly1.cif.gz_B zn-dependent metallo-beta-lactamase from bacillus cereus 0.7687 20 220
5ve5-assembly3.cif.gz_C crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione 0.7687 3 220
ID Description Score Start End Superfamily
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.797 5 220 3.60.15.10
af_K7MDN4_21_187_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.785 5 149 3.60.15.10
2xf4A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7835 5 220 3.60.15.10
af_Q2FY29_1_207_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7831 5 217 3.60.15.10
2zwrB00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.7803 5 220 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A655VQW1-F1-model_v4 Metallo-beta-lactamase family protein 0.9925 164 266
AF-A0A655VL30-F1-model_v4 deleted 0.9841 150 266
AF-A0A356JCF2-F1-model_v4 deleted 0.9825 148 267
AF-A0A2V9SQ71-F1-model_v4 MBL fold metallo-hydrolase 0.9782 161 261 GO:0016787
AF-A0A1Q7S4P7-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9779 148 261

Map