F394408

General Info

Members Datasets Scaffolds Average Seq Length
298 155 596 121

Family's Representative Sequence

Representative Sequence 3300041512|Ga0451853_2321856|Ga0451853_2321856_220_648
Length 142
Sequence MRKQRGVTMIGWIFLLVPVGITVYGGIRVIPEYLNYYKVIQALSESATALKSDDTLTVQSIRGAIVKRFDTGYVDKPSPDDIIIKKSDKGWEMTADYEATTPMFGNLYLLMSFKKTDRMMHPPRHMRAMDGLLSFQLYSFAA

Samples

Sample ID Description Type Environment
1 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
114 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
123 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
124 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
125 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
126 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
127 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
128 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
129 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
148 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
149 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
153 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 4.03
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 8.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451853_2321856 3300041512 Bacteria 725
2 JGI24742J22300_10043552 3300002244 Bacteria 803
3 Ga0065715_10665003 3300005293 Bacteria 671
4 Ga0070676_10161729 3300005328 Bacteria 1441
5 Ga0070690_100052031 3300005330 Bacteria 2617
6 Ga0070690_100212862 3300005330 Bacteria 1350
7 Ga0070670_100711786 3300005331 Bacteria 903
8 Ga0070677_10008755 3300005333 Bacteria 3415
9 Ga0070677_10026755 3300005333 Bacteria 2166
10 Ga0068869_100054434 3300005334 Bacteria 2913
11 Ga0068869_100212577 3300005334 Bacteria 1530
12 Ga0068869_100592330 3300005334 Bacteria 936
13 Ga0070682_100554493 3300005337 Bacteria 900
14 Ga0068868_100717501 3300005338 Unclassified 896
15 Ga0068868_100875500 3300005338 Unclassified 815
16 Ga0070689_100002301 3300005340 Bacteria 12422
17 Ga0070689_100261729 3300005340 Bacteria 1430
18 Ga0070691_10057605 3300005341 Bacteria 1864
19 Ga0070691_10117201 3300005341 Bacteria 1338
20 Ga0070691_10130509 3300005341 Bacteria 1273
21 Ga0070687_100304765 3300005343 Bacteria 1012
22 Ga0070692_10723894 3300005345 Bacteria 672
23 Ga0070668_100079640 3300005347 Bacteria 2565
24 Ga0070668_100422895 3300005347 Bacteria 1141
25 Ga0070669_100106952 3300005353 Bacteria 2118
26 Ga0070675_100004279 3300005354 Bacteria 10872
27 Ga0070675_100029716 3300005354 Bacteria 4409
28 Ga0070671_100355702 3300005355 Bacteria 1250
29 Ga0070671_100714133 3300005355 Bacteria 870
30 Ga0070674_100024236 3300005356 Bacteria 3936
31 Ga0070674_100065806 3300005356 Bacteria 2545
32 Ga0070674_100452989 3300005356 Bacteria 1059
33 Ga0070674_100977074 3300005356 Bacteria 742
34 Ga0070673_100010143 3300005364 Bacteria 6361
35 Ga0070673_100017625 3300005364 Bacteria 5084
36 Ga0070673_101570484 3300005364 Bacteria 621
37 Ga0070673_101975294 3300005364 Unclassified 553
38 Ga0070688_100029207 3300005365 Bacteria 3300
39 Ga0070688_100035678 3300005365 Bacteria 3021
40 Ga0070688_100358791 3300005365 Bacteria 1069
41 Ga0070667_100322203 3300005367 Bacteria 1395
42 Ga0070709_10287841 3300005434 Bacteria 1196
43 Ga0070701_10004699 3300005438 Bacteria 5567
44 Ga0070701_10391826 3300005438 Bacteria 878
45 Ga0070701_11038342 3300005438 Bacteria 574
46 Ga0070711_100100865 3300005439 Bacteria 2100
47 Ga0070705_100179819 3300005440 Bacteria 1432
48 Ga0070705_100284555 3300005440 Bacteria 1177
49 Ga0070705_100412789 3300005440 Unclassified 1003
50 Ga0070700_100300458 3300005441 Bacteria 1172
51 Ga0070700_100771019 3300005441 Bacteria 772
52 Ga0070700_100901460 3300005441 Bacteria 720
53 Ga0070700_101026092 3300005441 Bacteria 679
54 Ga0070694_100061268 3300005444 Bacteria 2568
55 Ga0070694_101959780 3300005444 Unclassified 500
56 Ga0070663_100703992 3300005455 Bacteria 859
57 Ga0070678_100068023 3300005456 Bacteria 2654
58 Ga0070678_100079035 3300005456 Bacteria 2486
59 Ga0070662_101910855 3300005457 Unclassified 513
60 Ga0068867_100141430 3300005459 Bacteria 1881
61 Ga0068867_100262443 3300005459 Bacteria 1409
62 Ga0068867_101934604 3300005459 Unclassified 556
63 Ga0070685_10053201 3300005466 Bacteria 2345
64 Ga0070672_100005085 3300005543 Bacteria 8679
65 Ga0070672_100068414 3300005543 Bacteria 2816
66 Ga0070672_100089962 3300005543 Bacteria 2474
67 Ga0070686_100027858 3300005544 Bacteria 3422
68 Ga0070686_101340865 3300005544 Bacteria 599
69 Ga0070686_101618510 3300005544 Unclassified 548
70 Ga0070686_101745831 3300005544 Bacteria 529
71 Ga0070665_100271447 3300005548 Bacteria 1698
72 Ga0070665_102505042 3300005548 Bacteria 517
73 Ga0070704_100185578 3300005549 Bacteria 1667
74 Ga0070664_100566802 3300005564 Bacteria 1051
75 Ga0068857_100306011 3300005577 Bacteria 1466
76 Ga0068854_101633675 3300005578 Bacteria 588
77 Ga0070702_100008777 3300005615 Bacteria 4915
78 Ga0070702_100029717 3300005615 Bacteria 2974
79 Ga0070702_100179849 3300005615 Bacteria 1383
80 Ga0068859_100101608 3300005617 Bacteria 2932
81 Ga0068859_101153242 3300005617 Bacteria 853
82 Ga0068864_100047250 3300005618 Bacteria 3696
83 Ga0068864_100715677 3300005618 Bacteria 979
84 Ga0068866_10112835 3300005718 Bacteria 1520
85 Ga0068861_100005744 3300005719 Bacteria 8413
86 Ga0068861_100074152 3300005719 Bacteria 2645
87 Ga0068861_100083273 3300005719 Bacteria 2509
88 Ga0068861_100113059 3300005719 Bacteria 2178
89 Ga0068861_100287238 3300005719 Bacteria 1419
90 Ga0068861_102393683 3300005719 Unclassified 531
91 Ga0068870_10003293 3300005840 Bacteria 6825
92 Ga0068863_100184311 3300005841 Bacteria 2004
93 Ga0068863_100471668 3300005841 Bacteria 1233
94 Ga0068863_100916482 3300005841 Bacteria 877
95 Ga0068858_100596653 3300005842 Bacteria 1071
96 Ga0068860_100110822 3300005843 Bacteria 2623
97 Ga0068860_100398563 3300005843 Bacteria 1361
98 Ga0068860_101771653 3300005843 Bacteria 639
99 Ga0068862_100029180 3300005844 Bacteria 4647
100 Ga0068862_100301383 3300005844 Bacteria 1474
101 Ga0068862_100420169 3300005844 Bacteria 1254
102 Ga0068862_101973545 3300005844 Unclassified 594
103 Ga0097621_100093783 3300006237 Bacteria 2516
104 Ga0097621_100150236 3300006237 Bacteria 1997
105 Ga0097621_100281806 3300006237 Bacteria 1463
106 Ga0097621_100741623 3300006237 Bacteria 907
107 Ga0068871_100097715 3300006358 Bacteria 2455
108 Ga0068871_100111751 3300006358 Bacteria 2298
109 Ga0068871_100121059 3300006358 Bacteria 2210
110 Ga0068871_100411203 3300006358 Bacteria 1206
111 Ga0068871_100749353 3300006358 Bacteria 898
112 Ga0068865_100072146 3300006881 Bacteria 2452
113 Ga0068865_100161982 3300006881 Bacteria 1707
114 Ga0068865_100232472 3300006881 Bacteria 1447
115 Ga0068865_100602912 3300006881 Bacteria 928
116 Ga0068865_100956285 3300006881 Bacteria 748
117 Ga0068865_101665856 3300006881 Bacteria 574
118 Ga0097620_100101609 3300006931 Bacteria 2932
119 Ga0097620_101153220 3300006931 Bacteria 853
120 Ga0111539_10180995 3300009094 Bacteria 2462
121 Ga0111539_10976238 3300009094 Bacteria 985
122 Ga0111539_12180245 3300009094 Unclassified 643
123 Ga0105245_12179307 3300009098 Bacteria 608
124 Ga0105243_10178968 3300009148 Bacteria 1843
125 Ga0105243_10710367 3300009148 Bacteria 981
126 Ga0105242_10011618 3300009176 Bacteria 6771
127 Ga0105248_10158444 3300009177 Bacteria 2554
128 Ga0105248_12595109 3300009177 Bacteria 578
129 Ga0105238_10698105 3300009551 Bacteria 1027
130 Ga0105238_11393031 3300009551 Bacteria 728
131 Ga0105249_11054802 3300009553 Bacteria 882
132 Ga0157374_10856249 3300013296 Bacteria 926
133 Ga0157378_11364648 3300013297 Bacteria 751
134 Ga0163162_10056440 3300013306 Bacteria 3955
135 Ga0163162_10695727 3300013306 Bacteria 1138
136 Ga0163162_10704714 3300013306 Bacteria 1131
137 Ga0157375_10043888 3300013308 Bacteria 4338
138 Ga0157375_10330920 3300013308 Bacteria 1688
139 Ga0157375_11106203 3300013308 Unclassified 928
140 Ga0163163_10310995 3300014325 Bacteria 1628
141 Ga0163163_10818616 3300014325 Bacteria 995
142 Ga0157380_10004215 3300014326 Bacteria 9944
143 Ga0157380_10037459 3300014326 Bacteria 3758
144 Ga0157380_10145508 3300014326 Bacteria 2042
145 Ga0157380_10239375 3300014326 Bacteria 1635
146 Ga0157380_10295877 3300014326 Bacteria 1488
147 Ga0157380_10304931 3300014326 Bacteria 1469
148 Ga0157380_10863274 3300014326 Bacteria 928
149 Ga0157380_11575243 3300014326 Bacteria 712
150 Ga0157380_13385613 3300014326 Unclassified 510
151 Ga0157380_13413150 3300014326 Unclassified 508
152 Ga0157377_11130864 3300014745 Unclassified 602
153 Ga0157379_10345621 3300014968 Bacteria 1361
154 Ga0157376_10164049 3300014969 Bacteria 2017
155 Ga0157376_10301049 3300014969 Bacteria 1518
156 Ga0163161_10112659 3300017792 Bacteria 2035
157 Ga0163161_10204568 3300017792 Bacteria 1523
158 Ga0163161_10219945 3300017792 Bacteria 1470
159 Ga0163161_10462728 3300017792 Bacteria 1027
160 Ga0207682_10000686 3300025893 Bacteria 15721
161 Ga0207682_10006464 3300025893 Bacteria 4718
162 Ga0207642_10548997 3300025899 Bacteria 713
163 Ga0207688_10503690 3300025901 Bacteria 758
164 Ga0207699_10160363 3300025906 Bacteria 1496
165 Ga0207645_10147952 3300025907 Bacteria 1532
166 Ga0207645_10508764 3300025907 Bacteria 816
167 Ga0207643_10017116 3300025908 Bacteria 3958
168 Ga0207662_10322838 3300025918 Bacteria 1031
169 Ga0207681_10027485 3300025923 Bacteria 3679
170 Ga0207681_10206283 3300025923 Bacteria 1512
171 Ga0207694_10624797 3300025924 Bacteria 907
172 Ga0207650_10226949 3300025925 Bacteria 1505
173 Ga0207659_10008076 3300025926 Bacteria 6515
174 Ga0207659_10023389 3300025926 Bacteria 4123
175 Ga0207644_10462646 3300025931 Unclassified 1043
176 Ga0207706_11716126 3300025933 Unclassified 505
177 Ga0207686_10096258 3300025934 Bacteria 1966
178 Ga0207709_10429178 3300025935 Bacteria 1017
179 Ga0207709_10668573 3300025935 Bacteria 828
180 Ga0207670_10085861 3300025936 Bacteria 2213
181 Ga0207670_10126904 3300025936 Bacteria 1863
182 Ga0207669_10009009 3300025937 Bacteria 4723
183 Ga0207669_10037715 3300025937 Bacteria 2775
184 Ga0207669_10048097 3300025937 Bacteria 2531
185 Ga0207704_10025223 3300025938 Bacteria 3241
186 Ga0207704_10031354 3300025938 Bacteria 2993
187 Ga0207704_10142299 3300025938 Bacteria 1680
188 Ga0207704_10838658 3300025938 Bacteria 770
189 Ga0207691_10016948 3300025940 Bacteria 6913
190 Ga0207691_10023826 3300025940 Bacteria 5761
191 Ga0207691_10081193 3300025940 Bacteria 2915
192 Ga0207691_11403218 3300025940 Unclassified 574
193 Ga0207711_10239262 3300025941 Bacteria 1664
194 Ga0207689_10032475 3300025942 Bacteria 4343
195 Ga0207689_10090513 3300025942 Bacteria 2514
196 Ga0207689_10862638 3300025942 Unclassified 764
197 Ga0207679_11057298 3300025945 Bacteria 744
198 Ga0207651_10005709 3300025960 Bacteria 6424
199 Ga0207651_10280140 3300025960 Bacteria 1377
200 Ga0207651_10747088 3300025960 Bacteria 864
201 Ga0207712_10904573 3300025961 Bacteria 780
202 Ga0207668_10073304 3300025972 Bacteria 2453
203 Ga0207668_10273018 3300025972 Bacteria 1383
204 Ga0207640_11541480 3300025981 Bacteria 598
205 Ga0207658_10294333 3300025986 Bacteria 1396
206 Ga0207658_11345484 3300025986 Bacteria 653
207 Ga0207658_11374466 3300025986 Unclassified 646
208 Ga0207677_11261430 3300026023 Unclassified 678
209 Ga0207703_10497506 3300026035 Bacteria 1144
210 Ga0207678_10210019 3300026067 Bacteria 1665
211 Ga0207708_10023462 3300026075 Bacteria 4663
212 Ga0207708_10048690 3300026075 Bacteria 3227
213 Ga0207708_10116942 3300026075 Bacteria 2075
214 Ga0207708_10124399 3300026075 Bacteria 2012
215 Ga0207708_10971040 3300026075 Bacteria 737
216 Ga0207641_10044430 3300026088 Bacteria 3736
217 Ga0207641_10069136 3300026088 Bacteria 3030
218 Ga0207641_10077604 3300026088 Bacteria 2875
219 Ga0207641_10372865 3300026088 Bacteria 1365
220 Ga0207648_10268718 3300026089 Bacteria 1523
221 Ga0207648_11172456 3300026089 Bacteria 721
222 Ga0207676_10692033 3300026095 Bacteria 987
223 Ga0207674_10079109 3300026116 Bacteria 3293
224 Ga0207675_100002404 3300026118 Bacteria 18537
225 Ga0207675_100007679 3300026118 Bacteria 10175
226 Ga0207675_100090455 3300026118 Bacteria 2878
227 Ga0207675_100327998 3300026118 Bacteria 1495
228 Ga0207675_100801824 3300026118 Bacteria 955
229 Ga0207675_101013288 3300026118 Bacteria 849
230 Ga0207683_10039155 3300026121 Bacteria 4135
231 Ga0207683_10127202 3300026121 Bacteria 2290
232 Ga0207428_10168337 3300027907 Bacteria 1660
233 Ga0268266_12129215 3300028379 Bacteria 533
234 Ga0268265_10017872 3300028380 Bacteria 4903
235 Ga0268265_10048924 3300028380 Bacteria 3177
236 Ga0268265_10057433 3300028380 Bacteria 2966
237 Ga0268264_10057210 3300028381 Bacteria 3261
238 Ga0268264_10783062 3300028381 Bacteria 952
239 Ga0307515_10329415 3300028794 Bacteria 1187
240 Ga0307513_10019379 3300031456 Bacteria 8101
241 Ga0307513_10103059 3300031456 Bacteria 2871
242 Ga0307408_101288886 3300031548 Bacteria 684
243 Ga0307413_10003048 3300031824 Bacteria 6960
244 Ga0307413_11122471 3300031824 Bacteria 680
245 Ga0307410_10070764 3300031852 Bacteria 2417
246 Ga0307406_11497598 3300031901 Bacteria 594
247 Ga0307407_10032039 3300031903 Bacteria 2853
248 Ga0307409_100008553 3300031995 Bacteria 6221
249 Ga0307409_100049651 3300031995 Bacteria 3200
250 Ga0307409_100786838 3300031995 Bacteria 958
251 Ga0307411_10000920 3300032005 Bacteria 11189
252 Ga0307411_10706377 3300032005 Bacteria 879
253 Ga0307411_10781317 3300032005 Bacteria 839
254 Ga0307411_10866181 3300032005 Bacteria 800
255 Ga0451789_0036521 3300041443 Unclassified 1040
256 Ga0451791_0008784 3300041451 Bacteria 1784
257 Ga0451791_0188877 3300041451 Bacteria 936
258 Ga0451793_0070191 3300041452 Bacteria 1410
259 Ga0451795_0170538 3300041456 Bacteria 662
260 Ga0451800_0294001 3300041459 Bacteria 1112
261 Ga0451807_0342670 3300041486 Bacteria 1908
262 Ga0451807_0343574 3300041486 Bacteria 1796
263 Ga0451807_1849278 3300041486 Bacteria 981
264 Ga0451807_2111499 3300041486 Bacteria 672
265 Ga0451841_0365855 3300041498 Bacteria 1136
266 Ga0451853_1748554 3300041512 Bacteria 1434
267 Ga0439459_0083112 3300042438 Unclassified 759
268 Ga0495632_0107610 3300046519 Bacteria 1311
269 Ga0495621_0088560 3300046539 Bacteria 1164
270 Ga0495668_0525878 3300046616 Bacteria 652
271 Ga0495672_0188474 3300047320 Bacteria 1039
272 Ga0495680_0902133 3300047322 Bacteria 571
273 Ga0496105_1124332 3300048908 Bacteria 582
274 Ga0496114_0793865 3300048917 Bacteria 825
275 Ga0501031_0284404 3300049568 Bacteria 1073
276 Ga0501036_0126442 3300049572 Bacteria 2159
277 Ga0501040_0268581 3300049576 Bacteria 1218
278 Ga0501042_0390815 3300049578 Bacteria 1008
279 Ga0501067_0185513 3300049583 Bacteria 1158
280 Ga0501068_0002173 3300049584 Bacteria 10451
281 Ga0501068_0374847 3300049584 Unclassified 916
282 Ga0501070_0007478 3300049586 Bacteria 9280
283 Ga0501071_0115005 3300049587 Bacteria 1991
284 Ga0501073_0000314 3300049589 Bacteria 32139
285 Ga0501073_0290026 3300049589 Bacteria 1129
286 Ga0501074_0016769 3300049590 Bacteria 5315
287 Ga0501077_0000591 3300049593 Bacteria 21943
288 Ga0501079_0000274 3300049741 Bacteria 31680
289 Ga0501080_0007557 3300049742 Bacteria 9823
290 Ga0501080_0850235 3300049742 Bacteria 798
291 nmdc:mga08y16_118275_c1 3300050511 Bacteria 2758
292 nmdc:mga08y16_632043_c1 3300050511 Bacteria 1076
293 Ga0500583_0107786 3300053092 Bacteria 1369
294 Ga0500627_0246962 3300053158 Bacteria 791
295 Ga0500611_014548 3300053727 Bacteria 1375
296 Ga0501084_0632751 3300054114 Bacteria 903
297 Ga0501084_1314347 3300054114 Unclassified 606
298 Ga0530510_1037512 3300061734 Bacteria 628
299 Ga0451853_2321856
300 JGI24742J22300_10043552
301 Ga0065715_10665003
302 Ga0070676_10161729
303 Ga0070690_100052031
304 Ga0070690_100212862
305 Ga0070670_100711786
306 Ga0070677_10008755
307 Ga0070677_10026755
308 Ga0068869_100054434
309 Ga0068869_100212577
310 Ga0068869_100592330
311 Ga0070682_100554493
312 Ga0068868_100717501
313 Ga0068868_100875500
314 Ga0070689_100002301
315 Ga0070689_100261729
316 Ga0070691_10057605
317 Ga0070691_10117201
318 Ga0070691_10130509
319 Ga0070687_100304765
320 Ga0070692_10723894
321 Ga0070668_100079640
322 Ga0070668_100422895
323 Ga0070669_100106952
324 Ga0070675_100004279
325 Ga0070675_100029716
326 Ga0070671_100355702
327 Ga0070671_100714133
328 Ga0070674_100024236
329 Ga0070674_100065806
330 Ga0070674_100452989
331 Ga0070674_100977074
332 Ga0070673_100010143
333 Ga0070673_100017625
334 Ga0070673_101570484
335 Ga0070673_101975294
336 Ga0070688_100029207
337 Ga0070688_100035678
338 Ga0070688_100358791
339 Ga0070667_100322203
340 Ga0070709_10287841
341 Ga0070701_10004699
342 Ga0070701_10391826
343 Ga0070701_11038342
344 Ga0070711_100100865
345 Ga0070705_100179819
346 Ga0070705_100284555
347 Ga0070705_100412789
348 Ga0070700_100300458
349 Ga0070700_100771019
350 Ga0070700_100901460
351 Ga0070700_101026092
352 Ga0070694_100061268
353 Ga0070694_101959780
354 Ga0070663_100703992
355 Ga0070678_100068023
356 Ga0070678_100079035
357 Ga0070662_101910855
358 Ga0068867_100141430
359 Ga0068867_100262443
360 Ga0068867_101934604
361 Ga0070685_10053201
362 Ga0070672_100005085
363 Ga0070672_100068414
364 Ga0070672_100089962
365 Ga0070686_100027858
366 Ga0070686_101340865
367 Ga0070686_101618510
368 Ga0070686_101745831
369 Ga0070665_100271447
370 Ga0070665_102505042
371 Ga0070704_100185578
372 Ga0070664_100566802
373 Ga0068857_100306011
374 Ga0068854_101633675
375 Ga0070702_100008777
376 Ga0070702_100029717
377 Ga0070702_100179849
378 Ga0068859_100101608
379 Ga0068859_101153242
380 Ga0068864_100047250
381 Ga0068864_100715677
382 Ga0068866_10112835
383 Ga0068861_100005744
384 Ga0068861_100074152
385 Ga0068861_100083273
386 Ga0068861_100113059
387 Ga0068861_100287238
388 Ga0068861_102393683
389 Ga0068870_10003293
390 Ga0068863_100184311
391 Ga0068863_100471668
392 Ga0068863_100916482
393 Ga0068858_100596653
394 Ga0068860_100110822
395 Ga0068860_100398563
396 Ga0068860_101771653
397 Ga0068862_100029180
398 Ga0068862_100301383
399 Ga0068862_100420169
400 Ga0068862_101973545
401 Ga0097621_100093783
402 Ga0097621_100150236
403 Ga0097621_100281806
404 Ga0097621_100741623
405 Ga0068871_100097715
406 Ga0068871_100111751
407 Ga0068871_100121059
408 Ga0068871_100411203
409 Ga0068871_100749353
410 Ga0068865_100072146
411 Ga0068865_100161982
412 Ga0068865_100232472
413 Ga0068865_100602912
414 Ga0068865_100956285
415 Ga0068865_101665856
416 Ga0097620_100101609
417 Ga0097620_101153220
418 Ga0111539_10180995
419 Ga0111539_10976238
420 Ga0111539_12180245
421 Ga0105245_12179307
422 Ga0105243_10178968
423 Ga0105243_10710367
424 Ga0105242_10011618
425 Ga0105248_10158444
426 Ga0105248_12595109
427 Ga0105238_10698105
428 Ga0105238_11393031
429 Ga0105249_11054802
430 Ga0157374_10856249
431 Ga0157378_11364648
432 Ga0163162_10056440
433 Ga0163162_10695727
434 Ga0163162_10704714
435 Ga0157375_10043888
436 Ga0157375_10330920
437 Ga0157375_11106203
438 Ga0163163_10310995
439 Ga0163163_10818616
440 Ga0157380_10004215
441 Ga0157380_10037459
442 Ga0157380_10145508
443 Ga0157380_10239375
444 Ga0157380_10295877
445 Ga0157380_10304931
446 Ga0157380_10863274
447 Ga0157380_11575243
448 Ga0157380_13385613
449 Ga0157380_13413150
450 Ga0157377_11130864
451 Ga0157379_10345621
452 Ga0157376_10164049
453 Ga0157376_10301049
454 Ga0163161_10112659
455 Ga0163161_10204568
456 Ga0163161_10219945
457 Ga0163161_10462728
458 Ga0207682_10000686
459 Ga0207682_10006464
460 Ga0207642_10548997
461 Ga0207688_10503690
462 Ga0207699_10160363
463 Ga0207645_10147952
464 Ga0207645_10508764
465 Ga0207643_10017116
466 Ga0207662_10322838
467 Ga0207681_10027485
468 Ga0207681_10206283
469 Ga0207694_10624797
470 Ga0207650_10226949
471 Ga0207659_10008076
472 Ga0207659_10023389
473 Ga0207644_10462646
474 Ga0207706_11716126
475 Ga0207686_10096258
476 Ga0207709_10429178
477 Ga0207709_10668573
478 Ga0207670_10085861
479 Ga0207670_10126904
480 Ga0207669_10009009
481 Ga0207669_10037715
482 Ga0207669_10048097
483 Ga0207704_10025223
484 Ga0207704_10031354
485 Ga0207704_10142299
486 Ga0207704_10838658
487 Ga0207691_10016948
488 Ga0207691_10023826
489 Ga0207691_10081193
490 Ga0207691_11403218
491 Ga0207711_10239262
492 Ga0207689_10032475
493 Ga0207689_10090513
494 Ga0207689_10862638
495 Ga0207679_11057298
496 Ga0207651_10005709
497 Ga0207651_10280140
498 Ga0207651_10747088
499 Ga0207712_10904573
500 Ga0207668_10073304
501 Ga0207668_10273018
502 Ga0207640_11541480
503 Ga0207658_10294333
504 Ga0207658_11345484
505 Ga0207658_11374466
506 Ga0207677_11261430
507 Ga0207703_10497506
508 Ga0207678_10210019
509 Ga0207708_10023462
510 Ga0207708_10048690
511 Ga0207708_10116942
512 Ga0207708_10124399
513 Ga0207708_10971040
514 Ga0207641_10044430
515 Ga0207641_10069136
516 Ga0207641_10077604
517 Ga0207641_10372865
518 Ga0207648_10268718
519 Ga0207648_11172456
520 Ga0207676_10692033
521 Ga0207674_10079109
522 Ga0207675_100002404
523 Ga0207675_100007679
524 Ga0207675_100090455
525 Ga0207675_100327998
526 Ga0207675_100801824
527 Ga0207675_101013288
528 Ga0207683_10039155
529 Ga0207683_10127202
530 Ga0207428_10168337
531 Ga0268266_12129215
532 Ga0268265_10017872
533 Ga0268265_10048924
534 Ga0268265_10057433
535 Ga0268264_10057210
536 Ga0268264_10783062
537 Ga0307515_10329415
538 Ga0307513_10019379
539 Ga0307513_10103059
540 Ga0307408_101288886
541 Ga0307413_10003048
542 Ga0307413_11122471
543 Ga0307410_10070764
544 Ga0307406_11497598
545 Ga0307407_10032039
546 Ga0307409_100008553
547 Ga0307409_100049651
548 Ga0307409_100786838
549 Ga0307411_10000920
550 Ga0307411_10706377
551 Ga0307411_10781317
552 Ga0307411_10866181
553 Ga0451789_0036521
554 Ga0451791_0008784
555 Ga0451791_0188877
556 Ga0451793_0070191
557 Ga0451795_0170538
558 Ga0451800_0294001
559 Ga0451807_0342670
560 Ga0451807_0343574
561 Ga0451807_1849278
562 Ga0451807_2111499
563 Ga0451841_0365855
564 Ga0451853_1748554
565 Ga0439459_0083112
566 Ga0495632_0107610
567 Ga0495621_0088560
568 Ga0495668_0525878
569 Ga0495672_0188474
570 Ga0495680_0902133
571 Ga0496105_1124332
572 Ga0496114_0793865
573 Ga0501031_0284404
574 Ga0501036_0126442
575 Ga0501040_0268581
576 Ga0501042_0390815
577 Ga0501067_0185513
578 Ga0501068_0002173
579 Ga0501068_0374847
580 Ga0501070_0007478
581 Ga0501071_0115005
582 Ga0501073_0000314
583 Ga0501073_0290026
584 Ga0501074_0016769
585 Ga0501077_0000591
586 Ga0501079_0000274
587 Ga0501080_0007557
588 Ga0501080_0850235
589 nmdc:mga08y16_118275_c1
590 nmdc:mga08y16_632043_c1
591 Ga0500583_0107786
592 Ga0500627_0246962
593 Ga0500611_014548
594 Ga0501084_0632751
595 Ga0501084_1314347
596 Ga0530510_1037512

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16137

DUF4845

Domain of unknown function (DUF4845)

28

113

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vcn-assembly2.cif.gz_D crystal structure of pita fragment from pilus islet-2 of streptococcus oralis with tb-xo4 0.7444 93 118
5da9-assembly1.cif.gz_A atp-gamma-s bound rad50 from chaetomium thermophilum in complex with the rad50-binding domain of mre11 0.7047 82 121
3udg-assembly1.cif.gz_A-2 structure of deinococcus radiodurans ssb bound to ssdna 0.6821 81 119
7vcn-assembly2.cif.gz_D crystal structure of pita fragment from pilus islet-2 of streptococcus oralis with tb-xo4 0.6687 93 118
3nm7-assembly2.cif.gz_D crystal structure of borrelia burgdorferi pur-alpha 0.6654 82 120
ID Description Score Start End Superfamily
af_I1N3D0_30_174_2.60.40.1820 Mainly Beta;Sandwich;Immunoglobulin-like; 0.777 91 119 2.60.40.1820
af_Q54WT6_15_161_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7764 75 121 2.60.40.790
af_A0A0P0X7C1_1_100_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.7697 35 78 1.10.10.60
af_F4ID96_3_107_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.765 36 80 1.10.10.60
af_Q656D5_25_440_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7436 81 119 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A534ALA7-F1-model_v4 DUF4845 domain-containing protein 0.947 5 121 GO:0016020
AF-A0A258SQL4-F1-model_v4 Uncharacterized protein 0.9289 77 118
AF-A0A7S6N491-F1-model_v4 DUF4845 domain-containing protein 0.9189 1 120 GO:0016020
AF-A0A7Y3N8A5-F1-model_v4 DUF4845 domain-containing protein 0.918 19 117
AF-A0A2W4Q4V2-F1-model_v4 DUF4845 domain-containing protein 0.9164 1 121 GO:0016020

Map