F394364

General Info

Members Datasets Scaffolds Average Seq Length
298 151 596 157

Family's Representative Sequence

Representative Sequence 3300035083|Ga0373926_0111946|Ga0373926_0111946_202_645
Length 147
Sequence MEKATFGAGCFWGVEATFRRLAGVQETQVGYMGGAMRNPSYKDVCTDQTGHAEVVEVTFDPAVISYSDLLNVFWENHDPTTLNRQGPDYGSQYRPGQEATAHASIAEHQKSFRKPIVTQVVPAADFWRAEEYHQQYLEKRGLSHCHL

Samples

Sample ID Description Type Environment
1 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
104 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
108 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
109 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
126 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.99
Metatranscriptomes 2.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.69
Rhizosphere 93.62
Stem 0
Stem Tuber 0
Unclassified 14.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373926_0111946 3300035083 Unclassified 1026
2 Ga0070690_100516139 3300005330 Unclassified 896
3 Ga0068869_101951935 3300005334 Bacteria 526
4 Ga0070680_100032971 3300005336 Bacteria 4171
5 Ga0070682_100270009 3300005337 Bacteria 1235
6 Ga0068868_100001310 3300005338 Bacteria 17153
7 Ga0070691_10027107 3300005341 Bacteria 2673
8 Ga0070669_100000027 3300005353 Bacteria 166637
9 Ga0070671_100122042 3300005355 Unclassified 2193
10 Ga0070673_100127598 3300005364 Unclassified 2130
11 Ga0070673_100405047 3300005364 Unclassified 1220
12 Ga0070709_10007793 3300005434 Bacteria 5881
13 Ga0070709_10134282 3300005434 Bacteria 1693
14 Ga0070709_10491105 3300005434 Bacteria 931
15 Ga0070709_10638398 3300005434 Unclassified 823
16 Ga0070709_11028969 3300005434 Bacteria 656
17 Ga0070709_11656742 3300005434 Bacteria 522
18 Ga0070714_100024947 3300005435 Bacteria 4930
19 Ga0070714_100075000 3300005435 Bacteria 2934
20 Ga0070714_100098471 3300005435 Bacteria 2573
21 Ga0070714_100161471 3300005435 Bacteria 2028
22 Ga0070714_100199060 3300005435 Bacteria 1832
23 Ga0070714_100368710 3300005435 Unclassified 1352
24 Ga0070714_100523248 3300005435 Bacteria 1133
25 Ga0070714_101596973 3300005435 Bacteria 637
26 Ga0070713_100001516 3300005436 Bacteria 14792
27 Ga0070713_100019150 3300005436 Bacteria 5217
28 Ga0070713_100369157 3300005436 Unclassified 1335
29 Ga0070710_10844358 3300005437 Bacteria 657
30 Ga0070711_100101511 3300005439 Bacteria 2093
31 Ga0070711_100899110 3300005439 Unclassified 755
32 Ga0070708_100027707 3300005445 Bacteria 4865
33 Ga0070708_100182577 3300005445 Unclassified 1961
34 Ga0070708_100222245 3300005445 Unclassified 1771
35 Ga0070662_100636571 3300005457 Unclassified 899
36 Ga0070681_10000180 3300005458 Bacteria 48456
37 Ga0068867_101386637 3300005459 Unclassified 651
38 Ga0070706_100000981 3300005467 Bacteria 31071
39 Ga0070706_100114456 3300005467 Bacteria 2512
40 Ga0070706_100136694 3300005467 Bacteria 2288
41 Ga0070707_100107878 3300005468 Bacteria 2701
42 Ga0070707_100225633 3300005468 Unclassified 1824
43 Ga0070707_100339724 3300005468 Bacteria 1459
44 Ga0070707_100381247 3300005468 Bacteria 1370
45 Ga0070707_100527006 3300005468 Bacteria 1143
46 Ga0070699_100123217 3300005518 Bacteria 2280
47 Ga0070699_100176952 3300005518 Unclassified 1892
48 Ga0070699_100631399 3300005518 Unclassified 977
49 Ga0070699_100652596 3300005518 Bacteria 960
50 Ga0070679_100047294 3300005530 Bacteria 4289
51 Ga0070679_100301747 3300005530 Bacteria 1552
52 Ga0070684_100751596 3300005535 Bacteria 910
53 Ga0070697_100003368 3300005536 Bacteria 12288
54 Ga0070697_100097838 3300005536 Unclassified 2435
55 Ga0070697_100116481 3300005536 Bacteria 2231
56 Ga0070697_100375039 3300005536 Bacteria 1231
57 Ga0070697_101440730 3300005536 Archaea 615
58 Ga0068853_100019358 3300005539 Bacteria 5644
59 Ga0070686_100467876 3300005544 Archaea 972
60 Ga0070704_100979443 3300005549 Unclassified 764
61 Ga0068855_100000731 3300005563 Bacteria 40322
62 Ga0068855_100132571 3300005563 Unclassified 2845
63 Ga0068857_100009713 3300005577 Bacteria 8359
64 Ga0068857_100030734 3300005577 Bacteria 4744
65 Ga0068854_100125038 3300005578 Unclassified 1957
66 Ga0068854_100151391 3300005578 Bacteria 1789
67 Ga0068856_100001181 3300005614 Bacteria 27502
68 Ga0068856_100001763 3300005614 Bacteria 22647
69 Ga0068856_100015399 3300005614 Bacteria 7390
70 Ga0068856_100145285 3300005614 Unclassified 2380
71 Ga0068856_100363798 3300005614 Bacteria 1465
72 Ga0068852_100006472 3300005616 Bacteria 8461
73 Ga0068864_100479136 3300005618 Unclassified 1194
74 Ga0068863_100410739 3300005841 Bacteria 1325
75 Ga0068858_100048956 3300005842 Bacteria 3914
76 Ga0070717_10006993 3300006028 Bacteria 8348
77 Ga0070717_10010010 3300006028 Bacteria 7136
78 Ga0070717_10022866 3300006028 Bacteria 4945
79 Ga0070717_10051985 3300006028 Bacteria 3373
80 Ga0070717_10113366 3300006028 Bacteria 2315
81 Ga0070717_10336509 3300006028 Bacteria 1347
82 Ga0070717_10414256 3300006028 Bacteria 1211
83 Ga0070717_10483906 3300006028 Unclassified 1118
84 Ga0070717_10652725 3300006028 Bacteria 955
85 Ga0070716_100047871 3300006173 Unclassified 2414
86 Ga0070716_100353951 3300006173 Bacteria 1040
87 Ga0070716_100561408 3300006173 Bacteria 853
88 Ga0070716_100847983 3300006173 Bacteria 711
89 Ga0070712_100004512 3300006175 Bacteria 8595
90 Ga0070712_100340151 3300006175 Bacteria 1225
91 Ga0070712_100431689 3300006175 Bacteria 1094
92 Ga0070712_101064599 3300006175 Bacteria 701
93 Ga0097621_100001904 3300006237 Bacteria 14250
94 Ga0097621_100002942 3300006237 Bacteria 11702
95 Ga0097621_100009843 3300006237 Bacteria 6960
96 Ga0097621_100020454 3300006237 Bacteria 5100
97 Ga0068871_100001280 3300006358 Bacteria 16810
98 Ga0068871_100005057 3300006358 Bacteria 9209
99 Ga0068871_100540801 3300006358 Unclassified 1054
100 Ga0075433_10020953 3300006852 Bacteria 5475
101 Ga0075433_10189143 3300006852 Bacteria 1832
102 Ga0075434_100000976 3300006871 Bacteria 23086
103 Ga0075434_100020259 3300006871 Bacteria 6447
104 Ga0075434_100191788 3300006871 Bacteria 2064
105 Ga0075434_102558469 3300006871 Unclassified 511
106 Ga0075436_100005684 3300006914 Bacteria 8560
107 Ga0075436_100429508 3300006914 Bacteria 960
108 Ga0075435_100001744 3300007076 Bacteria 14157
109 Ga0105240_10022887 3300009093 Bacteria 8277
110 Ga0105240_10063897 3300009093 Bacteria 4576
111 Ga0105240_10129715 3300009093 Bacteria 3025
112 Ga0105245_10003875 3300009098 Bacteria 13310
113 Ga0114129_10128046 3300009147 Archaea 3490
114 Ga0114129_10308620 3300009147 Bacteria 2107
115 Ga0105243_10321414 3300009148 Bacteria 1410
116 Ga0105241_10137862 3300009174 Bacteria 1983
117 Ga0105241_10271277 3300009174 Bacteria 1445
118 Ga0105242_10339956 3300009176 Unclassified 1383
119 Ga0105248_10053100 3300009177 Bacteria 4548
120 Ga0105237_10042181 3300009545 Unclassified 4602
121 Ga0105237_10084747 3300009545 Bacteria 3159
122 Ga0105237_10127460 3300009545 Bacteria 2539
123 Ga0105237_10537624 3300009545 Bacteria 1175
124 Ga0105238_10001772 3300009551 Bacteria 21641
125 Ga0105238_10070770 3300009551 Bacteria 3487
126 Ga0105238_10567976 3300009551 Bacteria 1140
127 Ga0105239_10042257 3300010375 Bacteria 4996
128 Ga0105239_10552822 3300010375 Bacteria 1311
129 Ga0157373_10091205 3300013100 Bacteria 2146
130 Ga0157371_10073879 3300013102 Bacteria 2415
131 Ga0157370_10023874 3300013104 Bacteria 6065
132 Ga0157370_10141338 3300013104 Bacteria 2243
133 Ga0157370_10372704 3300013104 Unclassified 1315
134 Ga0157370_10495195 3300013104 Bacteria 1123
135 Ga0157369_10011369 3300013105 Bacteria 10109
136 Ga0157369_10013526 3300013105 Bacteria 9222
137 Ga0157369_10114127 3300013105 Unclassified 2869
138 Ga0157369_10534450 3300013105 Bacteria 1212
139 Ga0157374_10001767 3300013296 Bacteria 18181
140 Ga0157378_10001446 3300013297 Bacteria 21385
141 Ga0157378_10042731 3300013297 Bacteria 4023
142 Ga0157372_10003447 3300013307 Bacteria 17063
143 Ga0157372_10009957 3300013307 Bacteria 10110
144 Ga0157372_10025392 3300013307 Bacteria 6441
145 Ga0157372_10028307 3300013307 Bacteria 6116
146 Ga0157372_10037689 3300013307 Bacteria 5334
147 Ga0157372_10274520 3300013307 Bacteria 1959
148 Ga0157372_10477461 3300013307 Unclassified 1453
149 Ga0157372_10582277 3300013307 Bacteria 1304
150 Ga0163163_10344082 3300014325 Bacteria 1547
151 Ga0163163_11381143 3300014325 Bacteria 766
152 Ga0157376_10042952 3300014969 Bacteria 3708
153 Ga0157376_10710344 3300014969 Bacteria 1011
154 Ga0206352_10597861 3300020078 Bacteria 799
155 Ga0206350_11046989 3300020080 Bacteria 995
156 Ga0213875_10000016 3300021388 Bacteria 260448
157 Ga0224712_10113818 3300022467 Bacteria 1163
158 Ga0224712_10309388 3300022467 Bacteria 740
159 Ga0207692_10454457 3300025898 Bacteria 807
160 Ga0207699_10172276 3300025906 Bacteria 1449
161 Ga0207699_10181710 3300025906 Unclassified 1414
162 Ga0207705_10763823 3300025909 Bacteria 751
163 Ga0207684_10001086 3300025910 Bacteria 30481
164 Ga0207684_10105275 3300025910 Bacteria 2413
165 Ga0207684_10279791 3300025910 Unclassified 1439
166 Ga0207654_10048256 3300025911 Bacteria 2436
167 Ga0207654_10094274 3300025911 Bacteria 1832
168 Ga0207654_11376646 3300025911 Bacteria 514
169 Ga0207707_10004722 3300025912 Bacteria 11954
170 Ga0207707_10263827 3300025912 Bacteria 1494
171 Ga0207695_10004832 3300025913 Bacteria 18190
172 Ga0207695_10014233 3300025913 Bacteria 9437
173 Ga0207695_10248599 3300025913 Bacteria 1678
174 Ga0207671_10001449 3300025914 Bacteria 27408
175 Ga0207671_10127753 3300025914 Bacteria 1949
176 Ga0207671_10335007 3300025914 Bacteria 1198
177 Ga0207693_10001742 3300025915 Bacteria 19096
178 Ga0207693_10012158 3300025915 Bacteria 6954
179 Ga0207660_10033843 3300025917 Bacteria 3538
180 Ga0207657_10011772 3300025919 Bacteria 8666
181 Ga0207652_10008012 3300025921 Bacteria 8479
182 Ga0207652_10470293 3300025921 Bacteria 1133
183 Ga0207646_10003703 3300025922 Bacteria 17067
184 Ga0207646_10137595 3300025922 Bacteria 2199
185 Ga0207681_10000016 3300025923 Bacteria 345352
186 Ga0207694_10003915 3300025924 Bacteria 11759
187 Ga0207694_10011772 3300025924 Bacteria 6599
188 Ga0207694_10074473 3300025924 Unclassified 2657
189 Ga0207694_10502294 3300025924 Bacteria 1015
190 Ga0207659_10479503 3300025926 Unclassified 1051
191 Ga0207687_10859699 3300025927 Bacteria 775
192 Ga0207700_10003670 3300025928 Bacteria 8951
193 Ga0207700_10186076 3300025928 Unclassified 1742
194 Ga0207700_10279103 3300025928 Bacteria 1437
195 Ga0207700_11060099 3300025928 Unclassified 725
196 Ga0207664_10012535 3300025929 Bacteria 6067
197 Ga0207664_10026697 3300025929 Bacteria 4367
198 Ga0207664_10093025 3300025929 Bacteria 2476
199 Ga0207664_10768056 3300025929 Bacteria 867
200 Ga0207664_10834101 3300025929 Bacteria 829
201 Ga0207664_10867047 3300025929 Bacteria 811
202 Ga0207664_10921959 3300025929 Bacteria 784
203 Ga0207664_10937585 3300025929 Bacteria 777
204 Ga0207644_10425691 3300025931 Unclassified 1088
205 Ga0207665_10287928 3300025939 Bacteria 1224
206 Ga0207665_10451414 3300025939 Bacteria 987
207 Ga0207689_10936355 3300025942 Bacteria 731
208 Ga0207661_10017178 3300025944 Bacteria 5350
209 Ga0207667_10013824 3300025949 Bacteria 9222
210 Ga0207651_10091422 3300025960 Unclassified 2228
211 Ga0207658_11017597 3300025986 Bacteria 756
212 Ga0207703_10065073 3300026035 Bacteria 2995
213 Ga0207639_10027686 3300026041 Bacteria 4132
214 Ga0207702_10000120 3300026078 Bacteria 91853
215 Ga0207702_10472227 3300026078 Bacteria 1220
216 Ga0207702_10494848 3300026078 Bacteria 1191
217 Ga0207641_10758144 3300026088 Bacteria 958
218 Ga0207648_10636559 3300026089 Bacteria 985
219 Ga0207674_10001768 3300026116 Bacteria 27613
220 Ga0207674_10018616 3300026116 Bacteria 7543
221 Ga0207698_10008046 3300026142 Bacteria 6648
222 Ga0207698_11185501 3300026142 Bacteria 777
223 Ga0268264_10752851 3300028381 Unclassified 971
224 Ga0265762_1001165 3300030760 Bacteria 4750
225 Ga0265760_10133108 3300031090 Bacteria 805
226 Ga0373926_0168930 3300035083 Archaea 836
227 Ga0373923_0694029 3300035111 Bacteria 505
228 Ga0373936_0483006 3300035113 Bacteria 575
229 Ga0373945_0207842 3300035116 Archaea 815
230 Ga0373943_0017798 3300035170 Archaea 3256
231 Ga0373942_0259913 3300035207 Bacteria 592
232 Ga0373935_0001104 3300035692 Bacteria 14717
233 Ga0373927_0001859 3300035695 Bacteria 15641
234 Ga0373927_0052671 3300035695 Archaea 2632
235 Ga0373933_0413464 3300035724 Bacteria 881
236 Ga0373947_0092301 3300035725 Archaea 1890
237 Ga0373937_0121256 3300036401 Bacteria 2437
238 Ga0373937_0409046 3300036401 Bacteria 1287
239 Ga0373937_0946646 3300036401 Bacteria 810
240 Ga0373925_0003516 3300037068 Bacteria 12104
241 Ga0373925_0026669 3300037068 Bacteria 4229
242 Ga0436364_0063026 3300037853 Bacteria 95697
243 Ga0436365_0590482 3300039437 Bacteria 1049
244 Ga0436365_1155589 3300039437 Bacteria 5888
245 Ga0436365_1597617 3300039437 Unclassified 664
246 Ga0436363_1474234 3300039450 Bacteria 2309
247 Ga0436362_0808793 3300039453 Bacteria 1293
248 Ga0451839_1225591 3300041496 Unclassified 666
249 Ga0453683_0175202 3300044673 Bacteria 1359
250 Ga0466963_0022396 3300044694 Bacteria 4002
251 Ga0466957_0013118 3300044842 Bacteria 4803
252 Ga0466957_0265315 3300044842 Bacteria 1145
253 Ga0466967_0236506 3300045976 Bacteria 1741
254 Ga0495580_0002295 3300046472 Bacteria 16698
255 Ga0495580_0032099 3300046472 Bacteria 3791
256 Ga0495580_0033062 3300046472 Bacteria 3728
257 Ga0495580_0065654 3300046472 Bacteria 2541
258 Ga0495580_0086623 3300046472 Bacteria 2181
259 Ga0495580_0217638 3300046472 Bacteria 1313
260 Ga0495582_0000304 3300046473 Bacteria 27144
261 Ga0495630_1380869 3300046517 Archaea 530
262 Ga0495665_0005547 3300046531 Bacteria 6799
263 Ga0495635_0367023 3300046663 Bacteria 959
264 Ga0495657_0758750 3300046675 Bacteria 556
265 Ga0495658_0554828 3300046683 Archaea 736
266 Ga0495581_0182439 3300047315 Archaea 1227
267 Ga0495636_0446197 3300047318 Bacteria 621
268 Ga0495674_0059511 3300047319 Bacteria 3336
269 Ga0495675_0528451 3300047444 Bacteria 675
270 Ga0495593_0374476 3300047673 Bacteria 712
271 Ga0495602_0063451 3300048088 Bacteria 3201
272 Ga0495602_0306309 3300048088 Bacteria 1161
273 Ga0496101_0487219 3300048904 Bacteria 974
274 Ga0496102_0066454 3300048905 Bacteria 3304
275 Ga0496104_0594605 3300048907 Bacteria 1017
276 Ga0496104_1678433 3300048907 Bacteria 538
277 Ga0496111_1284032 3300048914 Bacteria 516
278 Ga0496112_0001485 3300048915 Bacteria 18040
279 Ga0496112_0119701 3300048915 Bacteria 2603
280 Ga0496112_0335324 3300048915 Bacteria 1456
281 Ga0496112_0384609 3300048915 Bacteria 1344
282 Ga0496112_0522617 3300048915 Bacteria 1121
283 Ga0496113_0534072 3300048916 Bacteria 941
284 Ga0496125_0238758 3300048928 Unclassified 1156
285 nmdc:mga05p37_231555_c1 3300050507 Bacteria 2225
286 nmdc:mga05p37_253732_c1 3300050507 Archaea 2108
287 nmdc:mga06r32_1061951_c1 3300050510 Bacteria 760
288 nmdc:mga0n895_1218_c1 3300050512 Bacteria 19003
289 nmdc:mga0n895_17402_c1 3300050512 Bacteria 6623
290 nmdc:mga0n895_274494_c1 3300050512 Bacteria 1710
291 nmdc:mga0rr50_10697_c1 3300050513 Bacteria 5841
292 nmdc:mga08x19_12762_c1 3300050514 Bacteria 5068
293 nmdc:mga08x19_402725_c1 3300050514 Bacteria 960
294 nmdc:mga08x19_421821_c1 3300050514 Unclassified 937
295 nmdc:mga08x19_924859_c1 3300050514 Bacteria 619
296 nmdc:mga0a205_145370_c1 3300050515 Bacteria 2271
297 nmdc:mga0a205_25965_c1 3300050515 Bacteria 5581
298 Ga0466962_0096141 3300061719 Bacteria 1420
299 Ga0373926_0111946
300 Ga0070690_100516139
301 Ga0068869_101951935
302 Ga0070680_100032971
303 Ga0070682_100270009
304 Ga0068868_100001310
305 Ga0070691_10027107
306 Ga0070669_100000027
307 Ga0070671_100122042
308 Ga0070673_100127598
309 Ga0070673_100405047
310 Ga0070709_10007793
311 Ga0070709_10134282
312 Ga0070709_10491105
313 Ga0070709_10638398
314 Ga0070709_11028969
315 Ga0070709_11656742
316 Ga0070714_100024947
317 Ga0070714_100075000
318 Ga0070714_100098471
319 Ga0070714_100161471
320 Ga0070714_100199060
321 Ga0070714_100368710
322 Ga0070714_100523248
323 Ga0070714_101596973
324 Ga0070713_100001516
325 Ga0070713_100019150
326 Ga0070713_100369157
327 Ga0070710_10844358
328 Ga0070711_100101511
329 Ga0070711_100899110
330 Ga0070708_100027707
331 Ga0070708_100182577
332 Ga0070708_100222245
333 Ga0070662_100636571
334 Ga0070681_10000180
335 Ga0068867_101386637
336 Ga0070706_100000981
337 Ga0070706_100114456
338 Ga0070706_100136694
339 Ga0070707_100107878
340 Ga0070707_100225633
341 Ga0070707_100339724
342 Ga0070707_100381247
343 Ga0070707_100527006
344 Ga0070699_100123217
345 Ga0070699_100176952
346 Ga0070699_100631399
347 Ga0070699_100652596
348 Ga0070679_100047294
349 Ga0070679_100301747
350 Ga0070684_100751596
351 Ga0070697_100003368
352 Ga0070697_100097838
353 Ga0070697_100116481
354 Ga0070697_100375039
355 Ga0070697_101440730
356 Ga0068853_100019358
357 Ga0070686_100467876
358 Ga0070704_100979443
359 Ga0068855_100000731
360 Ga0068855_100132571
361 Ga0068857_100009713
362 Ga0068857_100030734
363 Ga0068854_100125038
364 Ga0068854_100151391
365 Ga0068856_100001181
366 Ga0068856_100001763
367 Ga0068856_100015399
368 Ga0068856_100145285
369 Ga0068856_100363798
370 Ga0068852_100006472
371 Ga0068864_100479136
372 Ga0068863_100410739
373 Ga0068858_100048956
374 Ga0070717_10006993
375 Ga0070717_10010010
376 Ga0070717_10022866
377 Ga0070717_10051985
378 Ga0070717_10113366
379 Ga0070717_10336509
380 Ga0070717_10414256
381 Ga0070717_10483906
382 Ga0070717_10652725
383 Ga0070716_100047871
384 Ga0070716_100353951
385 Ga0070716_100561408
386 Ga0070716_100847983
387 Ga0070712_100004512
388 Ga0070712_100340151
389 Ga0070712_100431689
390 Ga0070712_101064599
391 Ga0097621_100001904
392 Ga0097621_100002942
393 Ga0097621_100009843
394 Ga0097621_100020454
395 Ga0068871_100001280
396 Ga0068871_100005057
397 Ga0068871_100540801
398 Ga0075433_10020953
399 Ga0075433_10189143
400 Ga0075434_100000976
401 Ga0075434_100020259
402 Ga0075434_100191788
403 Ga0075434_102558469
404 Ga0075436_100005684
405 Ga0075436_100429508
406 Ga0075435_100001744
407 Ga0105240_10022887
408 Ga0105240_10063897
409 Ga0105240_10129715
410 Ga0105245_10003875
411 Ga0114129_10128046
412 Ga0114129_10308620
413 Ga0105243_10321414
414 Ga0105241_10137862
415 Ga0105241_10271277
416 Ga0105242_10339956
417 Ga0105248_10053100
418 Ga0105237_10042181
419 Ga0105237_10084747
420 Ga0105237_10127460
421 Ga0105237_10537624
422 Ga0105238_10001772
423 Ga0105238_10070770
424 Ga0105238_10567976
425 Ga0105239_10042257
426 Ga0105239_10552822
427 Ga0157373_10091205
428 Ga0157371_10073879
429 Ga0157370_10023874
430 Ga0157370_10141338
431 Ga0157370_10372704
432 Ga0157370_10495195
433 Ga0157369_10011369
434 Ga0157369_10013526
435 Ga0157369_10114127
436 Ga0157369_10534450
437 Ga0157374_10001767
438 Ga0157378_10001446
439 Ga0157378_10042731
440 Ga0157372_10003447
441 Ga0157372_10009957
442 Ga0157372_10025392
443 Ga0157372_10028307
444 Ga0157372_10037689
445 Ga0157372_10274520
446 Ga0157372_10477461
447 Ga0157372_10582277
448 Ga0163163_10344082
449 Ga0163163_11381143
450 Ga0157376_10042952
451 Ga0157376_10710344
452 Ga0206352_10597861
453 Ga0206350_11046989
454 Ga0213875_10000016
455 Ga0224712_10113818
456 Ga0224712_10309388
457 Ga0207692_10454457
458 Ga0207699_10172276
459 Ga0207699_10181710
460 Ga0207705_10763823
461 Ga0207684_10001086
462 Ga0207684_10105275
463 Ga0207684_10279791
464 Ga0207654_10048256
465 Ga0207654_10094274
466 Ga0207654_11376646
467 Ga0207707_10004722
468 Ga0207707_10263827
469 Ga0207695_10004832
470 Ga0207695_10014233
471 Ga0207695_10248599
472 Ga0207671_10001449
473 Ga0207671_10127753
474 Ga0207671_10335007
475 Ga0207693_10001742
476 Ga0207693_10012158
477 Ga0207660_10033843
478 Ga0207657_10011772
479 Ga0207652_10008012
480 Ga0207652_10470293
481 Ga0207646_10003703
482 Ga0207646_10137595
483 Ga0207681_10000016
484 Ga0207694_10003915
485 Ga0207694_10011772
486 Ga0207694_10074473
487 Ga0207694_10502294
488 Ga0207659_10479503
489 Ga0207687_10859699
490 Ga0207700_10003670
491 Ga0207700_10186076
492 Ga0207700_10279103
493 Ga0207700_11060099
494 Ga0207664_10012535
495 Ga0207664_10026697
496 Ga0207664_10093025
497 Ga0207664_10768056
498 Ga0207664_10834101
499 Ga0207664_10867047
500 Ga0207664_10921959
501 Ga0207664_10937585
502 Ga0207644_10425691
503 Ga0207665_10287928
504 Ga0207665_10451414
505 Ga0207689_10936355
506 Ga0207661_10017178
507 Ga0207667_10013824
508 Ga0207651_10091422
509 Ga0207658_11017597
510 Ga0207703_10065073
511 Ga0207639_10027686
512 Ga0207702_10000120
513 Ga0207702_10472227
514 Ga0207702_10494848
515 Ga0207641_10758144
516 Ga0207648_10636559
517 Ga0207674_10001768
518 Ga0207674_10018616
519 Ga0207698_10008046
520 Ga0207698_11185501
521 Ga0268264_10752851
522 Ga0265762_1001165
523 Ga0265760_10133108
524 Ga0373926_0168930
525 Ga0373923_0694029
526 Ga0373936_0483006
527 Ga0373945_0207842
528 Ga0373943_0017798
529 Ga0373942_0259913
530 Ga0373935_0001104
531 Ga0373927_0001859
532 Ga0373927_0052671
533 Ga0373933_0413464
534 Ga0373947_0092301
535 Ga0373937_0121256
536 Ga0373937_0409046
537 Ga0373937_0946646
538 Ga0373925_0003516
539 Ga0373925_0026669
540 Ga0436364_0063026
541 Ga0436365_0590482
542 Ga0436365_1155589
543 Ga0436365_1597617
544 Ga0436363_1474234
545 Ga0436362_0808793
546 Ga0451839_1225591
547 Ga0453683_0175202
548 Ga0466963_0022396
549 Ga0466957_0013118
550 Ga0466957_0265315
551 Ga0466967_0236506
552 Ga0495580_0002295
553 Ga0495580_0032099
554 Ga0495580_0033062
555 Ga0495580_0065654
556 Ga0495580_0086623
557 Ga0495580_0217638
558 Ga0495582_0000304
559 Ga0495630_1380869
560 Ga0495665_0005547
561 Ga0495635_0367023
562 Ga0495657_0758750
563 Ga0495658_0554828
564 Ga0495581_0182439
565 Ga0495636_0446197
566 Ga0495674_0059511
567 Ga0495675_0528451
568 Ga0495593_0374476
569 Ga0495602_0063451
570 Ga0495602_0306309
571 Ga0496101_0487219
572 Ga0496102_0066454
573 Ga0496104_0594605
574 Ga0496104_1678433
575 Ga0496111_1284032
576 Ga0496112_0001485
577 Ga0496112_0119701
578 Ga0496112_0335324
579 Ga0496112_0384609
580 Ga0496112_0522617
581 Ga0496113_0534072
582 Ga0496125_0238758
583 nmdc:mga05p37_231555_c1
584 nmdc:mga05p37_253732_c1
585 nmdc:mga06r32_1061951_c1
586 nmdc:mga0n895_1218_c1
587 nmdc:mga0n895_17402_c1
588 nmdc:mga0n895_274494_c1
589 nmdc:mga0rr50_10697_c1
590 nmdc:mga08x19_12762_c1
591 nmdc:mga08x19_402725_c1
592 nmdc:mga08x19_421821_c1
593 nmdc:mga08x19_924859_c1
594 nmdc:mga0a205_145370_c1
595 nmdc:mga0a205_25965_c1
596 Ga0466962_0096141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

3

146

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.952 2 148
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9394 1 150
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9356 2 150
4lwl-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55a from clostridium oremlandii 0.9266 1 145
3bqg-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) 0.9242 2 150
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9489 1 148 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9364 1 148 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9346 2 150 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9346 2 150 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9323 1 150 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A2K3J3A0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9585 1 151 GO:0008113
GO:0033744
GO:0036211
AF-A0A2E7F9P8-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9585 1 150 GO:0008113
GO:0033744
GO:0036211
AF-A0A2T2RT28-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9575 1 151 GO:0008113
GO:0033744
GO:0036211
AF-A0A524MSV0-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.956 2 150 GO:0008113
GO:0033743
GO:0033744
GO:0036211
AF-A0A2W7AZP3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9556 1 150 GO:0008113
GO:0033744
GO:0036211

Map