F394075

General Info

Members Datasets Scaffolds Average Seq Length
298 141 596 237

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100206596|Ga0070660_1002065962
Length 244
Sequence VTDVSRAMIMAAGLGTRMRPLTDDRPKPMVTVMGKPLIDHALDRLVAAGVTLVVVNAHYRADVLRAHLAGRRDVEIRISDETGELLGTGGGVVKAMPHFAGEPFFILNSDSVWVEGYVPALTQMQRLWDPVNMDGLLLLASMTSAMGYEGTGDFVMDTEGHIARPERNASPYAYPGVQIVHPRLFDGAPAGEFSTNLMWDRAIARKRLYGTRLEGMWIHVGTPQARQEAERHLSELKPSALKQA

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
27 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
46 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
76 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
77 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
78 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
79 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
80 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
81 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
82 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
83 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
84 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
87 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
88 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
90 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
91 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
92 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
93 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
96 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
101 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
102 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
103 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
104 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
105 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
106 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
123 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
124 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
125 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
126 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
133 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
134 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
135 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
136 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
137 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
138 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
139 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.69
Nodule 0
Rhizoplane 1.01
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 4.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100206596 3300005339 Bacteria 1594
2 JGI25165J46597_1000013 3300003214 Bacteria 402100
3 JGI25153J46596_10000468 3300003215 Bacteria 25868
4 Ga0070666_10001380 3300005335 Bacteria 14699
5 Ga0070680_100032635 3300005336 Bacteria 4192
6 Ga0070691_10021148 3300005341 Bacteria 3008
7 Ga0070691_10286491 3300005341 Bacteria 895
8 Ga0070659_100030562 3300005366 Bacteria 4168
9 Ga0070667_100162946 3300005367 Bacteria 1965
10 Ga0070709_10000580 3300005434 Bacteria 21404
11 Ga0070709_10003976 3300005434 Bacteria 7975
12 Ga0070714_100055782 3300005435 Unclassified 3378
13 Ga0070713_100000003 3300005436 Bacteria 245840
14 Ga0070713_100509047 3300005436 Unclassified 1137
15 Ga0070711_100769203 3300005439 Unclassified 815
16 Ga0070681_10000001 3300005458 Bacteria 946857
17 Ga0070681_10249104 3300005458 Bacteria 1689
18 Ga0070679_100000248 3300005530 Bacteria 45274
19 Ga0070684_100066413 3300005535 Bacteria 3167
20 Ga0068853_100005987 3300005539 Bacteria 9614
21 Ga0070693_100076212 3300005547 Bacteria 1988
22 Ga0070665_100076447 3300005548 Bacteria 3355
23 Ga0070665_100722550 3300005548 Bacteria 1009
24 Ga0070665_100803717 3300005548 Bacteria 953
25 Ga0068855_100000034 3300005563 Bacteria 166436
26 Ga0068855_100093583 3300005563 Bacteria 3465
27 Ga0068855_100100670 3300005563 Bacteria 3327
28 Ga0068855_100174312 3300005563 Bacteria 2434
29 Ga0068857_100005317 3300005577 Bacteria 10965
30 Ga0068854_100089364 3300005578 Bacteria 2289
31 Ga0068856_100000719 3300005614 Bacteria 36011
32 Ga0068856_100003532 3300005614 Bacteria 15768
33 Ga0068856_100672171 3300005614 Bacteria 1056
34 Ga0068852_100004633 3300005616 Bacteria 9747
35 Ga0068852_100005460 3300005616 Bacteria 9095
36 Ga0068858_100029117 3300005842 Bacteria 5128
37 Ga0068858_100319720 3300005842 Bacteria 1483
38 Ga0070712_100000169 3300006175 Bacteria 35660
39 Ga0070712_100000598 3300006175 Bacteria 21115
40 Ga0070712_100255999 3300006175 Bacteria 1401
41 Ga0075436_100000539 3300006914 Bacteria 24689
42 Ga0075436_100018916 3300006914 Bacteria 4717
43 Ga0075436_100067893 3300006914 Bacteria 2463
44 Ga0075435_100028454 3300007076 Bacteria 4384
45 Ga0075435_100032894 3300007076 Bacteria 4098
46 Ga0105240_10002316 3300009093 Bacteria 30823
47 Ga0105240_10006253 3300009093 Bacteria 17516
48 Ga0105245_10123797 3300009098 Bacteria 2418
49 Ga0105241_10032284 3300009174 Bacteria 3924
50 Ga0105241_10051323 3300009174 Bacteria 3145
51 Ga0105248_10041834 3300009177 Bacteria 5138
52 Ga0105237_10003577 3300009545 Bacteria 18403
53 Ga0105238_10001806 3300009551 Bacteria 21432
54 Ga0105238_10003504 3300009551 Bacteria 15625
55 Ga0105238_10492583 3300009551 Bacteria 1226
56 Ga0105239_10001912 3300010375 Bacteria 27137
57 Ga0105239_10004790 3300010375 Bacteria 16057
58 Ga0105239_10078248 3300010375 Bacteria 3639
59 Ga0157373_10006724 3300013100 Bacteria 8562
60 Ga0157370_10002219 3300013104 Bacteria 23683
61 Ga0157370_10115193 3300013104 Bacteria 2511
62 Ga0157369_10012989 3300013105 Bacteria 9434
63 Ga0157369_10031557 3300013105 Bacteria 5833
64 Ga0157369_10131455 3300013105 Bacteria 2652
65 Ga0157374_10196446 3300013296 Unclassified 1974
66 Ga0157378_10532623 3300013297 Bacteria 1178
67 Ga0163162_10651926 3300013306 Bacteria 1176
68 Ga0157372_10040176 3300013307 Bacteria 5165
69 Ga0157379_10001069 3300014968 Bacteria 22325
70 Ga0157379_10003162 3300014968 Bacteria 13929
71 Ga0213876_10004171 3300021384 Bacteria 8110
72 Ga0209233_1000013 3300025261 Bacteria 1013785
73 Ga0209758_1000185 3300025297 Bacteria 139330
74 Ga0207680_10000720 3300025903 Bacteria 15529
75 Ga0207699_10000104 3300025906 Bacteria 60711
76 Ga0207654_10015790 3300025911 Bacteria 3924
77 Ga0207654_10078115 3300025911 Bacteria 1985
78 Ga0207707_10000001 3300025912 Bacteria 1212482
79 Ga0207695_10000004 3300025913 Bacteria 1288665
80 Ga0207695_10021166 3300025913 Bacteria 7427
81 Ga0207671_10044907 3300025914 Bacteria 3267
82 Ga0207671_10376280 3300025914 Bacteria 1128
83 Ga0207693_10000079 3300025915 Bacteria 86388
84 Ga0207693_10000408 3300025915 Bacteria 39093
85 Ga0207693_10095093 3300025915 Bacteria 2335
86 Ga0207663_10156487 3300025916 Bacteria 1604
87 Ga0207660_10023022 3300025917 Bacteria 4204
88 Ga0207649_10009156 3300025920 Bacteria 5415
89 Ga0207652_10000599 3300025921 Bacteria 35992
90 Ga0207694_10000010 3300025924 Bacteria 439722
91 Ga0207694_10065174 3300025924 Bacteria 2840
92 Ga0207694_10178432 3300025924 Bacteria 1721
93 Ga0207687_10026887 3300025927 Bacteria 3855
94 Ga0207700_10000083 3300025928 Bacteria 58710
95 Ga0207700_10285359 3300025928 Unclassified 1421
96 Ga0207664_10052888 3300025929 Unclassified 3213
97 Ga0207690_10019659 3300025932 Bacteria 4162
98 Ga0207665_10188339 3300025939 Unclassified 1498
99 Ga0207711_10215274 3300025941 Bacteria 1755
100 Ga0207679_10142242 3300025945 Bacteria 1941
101 Ga0207667_10000065 3300025949 Bacteria 186655
102 Ga0207667_10019326 3300025949 Bacteria 7609
103 Ga0207667_10114672 3300025949 Bacteria 2777
104 Ga0207667_10191213 3300025949 Bacteria 2100
105 Ga0207658_10357367 3300025986 Bacteria 1273
106 Ga0207703_10066931 3300026035 Bacteria 2956
107 Ga0207639_10004827 3300026041 Bacteria 9092
108 Ga0207702_10000045 3300026078 Bacteria 144714
109 Ga0207702_10004415 3300026078 Bacteria 12517
110 Ga0207674_10000026 3300026116 Bacteria 151359
111 Ga0207683_10430785 3300026121 Bacteria 1215
112 Ga0207698_10001670 3300026142 Bacteria 12951
113 Ga0207698_10016741 3300026142 Bacteria 4954
114 Ga0268266_10357181 3300028379 Bacteria 1374
115 Ga0268266_10413580 3300028379 Bacteria 1277
116 Ga0268264_10209277 3300028381 Bacteria 1789
117 Ga0265318_10000071 3300028577 Bacteria 96845
118 Ga0265318_10000864 3300028577 Bacteria 19915
119 Ga0265338_10009057 3300028800 Bacteria 11974
120 Ga0265338_10042827 3300028800 Bacteria 4209
121 Ga0265328_10069018 3300031239 Bacteria 1299
122 Ga0265320_10001687 3300031240 Bacteria 15702
123 Ga0265320_10038345 3300031240 Bacteria 2405
124 Ga0265325_10000008 3300031241 Bacteria 186174
125 Ga0265325_10000092 3300031241 Bacteria 63555
126 Ga0265325_10002987 3300031241 Bacteria 11224
127 Ga0265325_10003261 3300031241 Bacteria 10670
128 Ga0265325_10098971 3300031241 Bacteria 1430
129 Ga0265329_10039375 3300031242 Bacteria 1519
130 Ga0265340_10000262 3300031247 Bacteria 27248
131 Ga0265340_10012861 3300031247 Bacteria 4412
132 Ga0265340_10016986 3300031247 Bacteria 3765
133 Ga0265340_10050748 3300031247 Bacteria 2011
134 Ga0265340_10063469 3300031247 Bacteria 1763
135 Ga0265339_10000353 3300031249 Bacteria 36556
136 Ga0265339_10005112 3300031249 Bacteria 8808
137 Ga0265339_10008479 3300031249 Bacteria 6540
138 Ga0265339_10078098 3300031249 Bacteria 1753
139 Ga0265339_10128033 3300031249 Bacteria 1300
140 Ga0265331_10006716 3300031250 Bacteria 6750
141 Ga0265331_10018337 3300031250 Bacteria 3633
142 Ga0265331_10028181 3300031250 Bacteria 2810
143 Ga0265316_10035815 3300031344 Bacteria 4018
144 Ga0265316_10040388 3300031344 Bacteria 3740
145 Ga0265316_10081014 3300031344 Bacteria 2489
146 Ga0265313_10000503 3300031595 Bacteria 41098
147 Ga0265313_10002906 3300031595 Bacteria 14320
148 Ga0265313_10005238 3300031595 Bacteria 9604
149 Ga0265313_10009700 3300031595 Bacteria 6211
150 Ga0265313_10050390 3300031595 Bacteria 1998
151 Ga0265314_10000507 3300031711 Bacteria 50324
152 Ga0265314_10006242 3300031711 Bacteria 10584
153 Ga0265314_10025068 3300031711 Bacteria 4507
154 Ga0265314_10026819 3300031711 Bacteria 4323
155 Ga0265314_10038597 3300031711 Bacteria 3448
156 Ga0265314_10051357 3300031711 Bacteria 2872
157 Ga0265314_10056596 3300031711 Bacteria 2698
158 Ga0265314_10079000 3300031711 Bacteria 2176
159 Ga0265342_10005880 3300031712 Bacteria 9257
160 Ga0265342_10024634 3300031712 Bacteria 3797
161 Ga0265342_10058540 3300031712 Bacteria 2277
162 Ga0265342_10072846 3300031712 Bacteria 1999
163 Ga0265342_10086465 3300031712 Bacteria 1802
164 Ga0373923_0103331 3300035111 Bacteria 1259
165 Ga0373954_0102272 3300035118 Bacteria 1383
166 Ga0373955_0126198 3300035172 Bacteria 1491
167 Ga0373955_0165217 3300035172 Bacteria 1308
168 Ga0373931_0083279 3300035691 Unclassified 1769
169 Ga0373933_0046172 3300035724 Bacteria 2585
170 Ga0373933_0121839 3300035724 Bacteria 1634
171 Ga0373937_0011337 3300036401 Bacteria 7821
172 Ga0373937_0027515 3300036401 Bacteria 5141
173 Ga0373937_0078846 3300036401 Bacteria 3044
174 Ga0373937_0434771 3300036401 Bacteria 1246
175 Ga0373937_0438385 3300036401 Bacteria 1240
176 Ga0373925_0023027 3300037068 Bacteria 4546
177 Ga0436365_1054994 3300039437 Bacteria 11379
178 Ga0436362_0617578 3300039453 Bacteria 2821
179 Ga0495592_0172612 3300046454 Bacteria 1479
180 Ga0495664_0217154 3300046477 Bacteria 1158
181 Ga0495628_0175411 3300046516 Bacteria 1624
182 Ga0495667_0127656 3300046559 Bacteria 1641
183 Ga0496104_0203061 3300048907 Unclassified 1894
184 Ga0496107_0140889 3300048910 Unclassified 1782
185 Ga0496108_0626496 3300048911 Bacteria 936
186 Ga0496126_0002015 3300048929 Bacteria 28714
187 Ga0495682_0015116 3300049460 Bacteria 2925
188 Ga0501031_0009533 3300049568 Bacteria 6319
189 Ga0501032_0020322 3300049569 Bacteria 4626
190 Ga0501032_0179995 3300049569 Bacteria 1384
191 Ga0501033_0008334 3300049570 Bacteria 8026
192 Ga0501033_0018754 3300049570 Bacteria 5229
193 Ga0501033_0029063 3300049570 Bacteria 4153
194 Ga0501033_0032854 3300049570 Bacteria 3896
195 Ga0501033_0110453 3300049570 Bacteria 2001
196 Ga0501033_0169368 3300049570 Bacteria 1569
197 Ga0501033_0263860 3300049570 Unclassified 1218
198 Ga0501034_0020336 3300049571 Bacteria 6776
199 Ga0501034_0035863 3300049571 Bacteria 5028
200 Ga0501034_0056076 3300049571 Bacteria 3966
201 Ga0501034_0066894 3300049571 Bacteria 3607
202 Ga0501034_0117989 3300049571 Bacteria 2641
203 Ga0501034_0148551 3300049571 Bacteria 2320
204 Ga0501034_0400303 3300049571 Bacteria 1296
205 Ga0501036_0003636 3300049572 Bacteria 12329
206 Ga0501036_0172182 3300049572 Bacteria 1824
207 Ga0501036_0842634 3300049572 Bacteria 754
208 Ga0501037_0001331 3300049573 Bacteria 18140
209 Ga0501037_0127781 3300049573 Bacteria 1824
210 Ga0501038_0030347 3300049574 Bacteria 4785
211 Ga0501038_0049236 3300049574 Bacteria 3644
212 Ga0501038_0067905 3300049574 Bacteria 3032
213 Ga0501038_0132805 3300049574 Bacteria 2042
214 Ga0501038_0161986 3300049574 Bacteria 1817
215 Ga0501038_0243455 3300049574 Bacteria 1427
216 Ga0501039_0001281 3300049575 Bacteria 18381
217 Ga0501042_0004397 3300049578 Bacteria 8990
218 Ga0501043_0003737 3300049579 Bacteria 12508
219 Ga0501043_0081808 3300049579 Bacteria 2538
220 Ga0501043_0096142 3300049579 Bacteria 2328
221 Ga0501043_0141391 3300049579 Bacteria 1885
222 Ga0501043_0184449 3300049579 Bacteria 1625
223 Ga0501043_0187582 3300049579 Unclassified 1609
224 Ga0501046_0002802 3300049580 Bacteria 16235
225 Ga0501046_0006393 3300049580 Bacteria 10445
226 Ga0501046_0027621 3300049580 Bacteria 4629
227 Ga0501047_0002989 3300049581 Bacteria 16039
228 Ga0501047_0003695 3300049581 Bacteria 14408
229 Ga0501047_0004621 3300049581 Bacteria 12953
230 Ga0501047_0005450 3300049581 Bacteria 11973
231 Ga0501047_0005720 3300049581 Bacteria 11704
232 Ga0501047_0031878 3300049581 Bacteria 5086
233 Ga0501047_0049203 3300049581 Bacteria 4070
234 Ga0501047_0143964 3300049581 Bacteria 2261
235 Ga0501047_0160271 3300049581 Bacteria 2121
236 Ga0501047_0257788 3300049581 Bacteria 1592
237 Ga0501047_0317333 3300049581 Bacteria 1399
238 Ga0501047_0343996 3300049581 Bacteria 1329
239 Ga0501048_0005279 3300049582 Bacteria 9839
240 Ga0501048_0205681 3300049582 Bacteria 1396
241 Ga0501048_0347898 3300049582 Bacteria 1057
242 Ga0501067_0074462 3300049583 Bacteria 1881
243 Ga0501067_0077531 3300049583 Bacteria 1841
244 Ga0501067_0116276 3300049583 Bacteria 1487
245 Ga0501068_0044491 3300049584 Bacteria 2673
246 Ga0501069_0043428 3300049585 Bacteria 2488
247 Ga0501070_0007221 3300049586 Bacteria 9432
248 Ga0501070_0018514 3300049586 Bacteria 5843
249 Ga0501070_0048788 3300049586 Bacteria 3516
250 Ga0501071_0058759 3300049587 Bacteria 2781
251 Ga0501072_0004446 3300049588 Bacteria 10649
252 Ga0501072_0017036 3300049588 Bacteria 5583
253 Ga0501073_0004172 3300049589 Bacteria 10835
254 Ga0501073_0017503 3300049589 Bacteria 5191
255 Ga0501073_0283392 3300049589 Bacteria 1143
256 Ga0501074_0001046 3300049590 Bacteria 18028
257 Ga0501074_0013789 3300049590 Bacteria 5878
258 Ga0501074_0199474 3300049590 Bacteria 1426
259 Ga0501079_0007626 3300049741 Bacteria 8195
260 Ga0501079_0065162 3300049741 Bacteria 2811
261 Ga0501080_0134756 3300049742 Bacteria 2286
262 Ga0501080_0352015 3300049742 Bacteria 1330
263 Ga0501080_0448578 3300049742 Bacteria 1157
264 Ga0501080_0492947 3300049742 Bacteria 1095
265 Ga0501083_0002797 3300049744 Bacteria 12051
266 Ga0501083_0058922 3300049744 Bacteria 2569
267 Ga0501035_0001298 3300049822 Bacteria 25812
268 Ga0501035_0029864 3300049822 Bacteria 4971
269 Ga0501035_0030375 3300049822 Bacteria 4926
270 Ga0501035_0037899 3300049822 Bacteria 4364
271 Ga0501035_0053944 3300049822 Bacteria 3593
272 Ga0501035_0133150 3300049822 Bacteria 2166
273 Ga0501035_0222985 3300049822 Bacteria 1609
274 Ga0501035_0374906 3300049822 Bacteria 1187
275 Ga0501044_0000530 3300049823 Bacteria 46371
276 Ga0501044_0014439 3300049823 Bacteria 8527
277 Ga0501044_0036613 3300049823 Bacteria 5133
278 Ga0501044_0082035 3300049823 Bacteria 3263
279 Ga0501044_0100469 3300049823 Bacteria 2911
280 Ga0501044_0647015 3300049823 Bacteria 946
281 nmdc:mga0rr50_15216_c1 3300050513 Bacteria 5073
282 nmdc:mga0rr50_20813_c1 3300050513 Bacteria 4464
283 nmdc:mga08x19_100_c1 3300050514 Bacteria 76036
284 nmdc:mga08x19_151975_c1 3300050514 Bacteria 1568
285 nmdc:mga08x19_5723_c1 3300050514 Bacteria 7347
286 Ga0500643_000021 3300053087 Bacteria 284326
287 Ga0500643_023600 3300053087 Bacteria 1963
288 Ga0500655_001773 3300053133 Bacteria 4042
289 Ga0500559_0178854 3300053136 Bacteria 999
290 Ga0500568_0059093 3300053139 Unclassified 1488
291 Ga0500639_171153 3300053163 Bacteria 974
292 Ga0500611_007822 3300053727 Bacteria 1626
293 Ga0501084_0000106 3300054114 Bacteria 62239
294 Ga0501084_0001821 3300054114 Bacteria 17016
295 Ga0501084_0056422 3300054114 Bacteria 3286
296 Ga0501082_0007496 3300060353 Bacteria 9416
297 Ga0501082_0064664 3300060353 Bacteria 3150
298 Ga0501082_0217124 3300060353 Bacteria 1664
299 Ga0070660_100206596
300 JGI25165J46597_1000013
301 JGI25153J46596_10000468
302 Ga0070666_10001380
303 Ga0070680_100032635
304 Ga0070691_10021148
305 Ga0070691_10286491
306 Ga0070659_100030562
307 Ga0070667_100162946
308 Ga0070709_10000580
309 Ga0070709_10003976
310 Ga0070714_100055782
311 Ga0070713_100000003
312 Ga0070713_100509047
313 Ga0070711_100769203
314 Ga0070681_10000001
315 Ga0070681_10249104
316 Ga0070679_100000248
317 Ga0070684_100066413
318 Ga0068853_100005987
319 Ga0070693_100076212
320 Ga0070665_100076447
321 Ga0070665_100722550
322 Ga0070665_100803717
323 Ga0068855_100000034
324 Ga0068855_100093583
325 Ga0068855_100100670
326 Ga0068855_100174312
327 Ga0068857_100005317
328 Ga0068854_100089364
329 Ga0068856_100000719
330 Ga0068856_100003532
331 Ga0068856_100672171
332 Ga0068852_100004633
333 Ga0068852_100005460
334 Ga0068858_100029117
335 Ga0068858_100319720
336 Ga0070712_100000169
337 Ga0070712_100000598
338 Ga0070712_100255999
339 Ga0075436_100000539
340 Ga0075436_100018916
341 Ga0075436_100067893
342 Ga0075435_100028454
343 Ga0075435_100032894
344 Ga0105240_10002316
345 Ga0105240_10006253
346 Ga0105245_10123797
347 Ga0105241_10032284
348 Ga0105241_10051323
349 Ga0105248_10041834
350 Ga0105237_10003577
351 Ga0105238_10001806
352 Ga0105238_10003504
353 Ga0105238_10492583
354 Ga0105239_10001912
355 Ga0105239_10004790
356 Ga0105239_10078248
357 Ga0157373_10006724
358 Ga0157370_10002219
359 Ga0157370_10115193
360 Ga0157369_10012989
361 Ga0157369_10031557
362 Ga0157369_10131455
363 Ga0157374_10196446
364 Ga0157378_10532623
365 Ga0163162_10651926
366 Ga0157372_10040176
367 Ga0157379_10001069
368 Ga0157379_10003162
369 Ga0213876_10004171
370 Ga0209233_1000013
371 Ga0209758_1000185
372 Ga0207680_10000720
373 Ga0207699_10000104
374 Ga0207654_10015790
375 Ga0207654_10078115
376 Ga0207707_10000001
377 Ga0207695_10000004
378 Ga0207695_10021166
379 Ga0207671_10044907
380 Ga0207671_10376280
381 Ga0207693_10000079
382 Ga0207693_10000408
383 Ga0207693_10095093
384 Ga0207663_10156487
385 Ga0207660_10023022
386 Ga0207649_10009156
387 Ga0207652_10000599
388 Ga0207694_10000010
389 Ga0207694_10065174
390 Ga0207694_10178432
391 Ga0207687_10026887
392 Ga0207700_10000083
393 Ga0207700_10285359
394 Ga0207664_10052888
395 Ga0207690_10019659
396 Ga0207665_10188339
397 Ga0207711_10215274
398 Ga0207679_10142242
399 Ga0207667_10000065
400 Ga0207667_10019326
401 Ga0207667_10114672
402 Ga0207667_10191213
403 Ga0207658_10357367
404 Ga0207703_10066931
405 Ga0207639_10004827
406 Ga0207702_10000045
407 Ga0207702_10004415
408 Ga0207674_10000026
409 Ga0207683_10430785
410 Ga0207698_10001670
411 Ga0207698_10016741
412 Ga0268266_10357181
413 Ga0268266_10413580
414 Ga0268264_10209277
415 Ga0265318_10000071
416 Ga0265318_10000864
417 Ga0265338_10009057
418 Ga0265338_10042827
419 Ga0265328_10069018
420 Ga0265320_10001687
421 Ga0265320_10038345
422 Ga0265325_10000008
423 Ga0265325_10000092
424 Ga0265325_10002987
425 Ga0265325_10003261
426 Ga0265325_10098971
427 Ga0265329_10039375
428 Ga0265340_10000262
429 Ga0265340_10012861
430 Ga0265340_10016986
431 Ga0265340_10050748
432 Ga0265340_10063469
433 Ga0265339_10000353
434 Ga0265339_10005112
435 Ga0265339_10008479
436 Ga0265339_10078098
437 Ga0265339_10128033
438 Ga0265331_10006716
439 Ga0265331_10018337
440 Ga0265331_10028181
441 Ga0265316_10035815
442 Ga0265316_10040388
443 Ga0265316_10081014
444 Ga0265313_10000503
445 Ga0265313_10002906
446 Ga0265313_10005238
447 Ga0265313_10009700
448 Ga0265313_10050390
449 Ga0265314_10000507
450 Ga0265314_10006242
451 Ga0265314_10025068
452 Ga0265314_10026819
453 Ga0265314_10038597
454 Ga0265314_10051357
455 Ga0265314_10056596
456 Ga0265314_10079000
457 Ga0265342_10005880
458 Ga0265342_10024634
459 Ga0265342_10058540
460 Ga0265342_10072846
461 Ga0265342_10086465
462 Ga0373923_0103331
463 Ga0373954_0102272
464 Ga0373955_0126198
465 Ga0373955_0165217
466 Ga0373931_0083279
467 Ga0373933_0046172
468 Ga0373933_0121839
469 Ga0373937_0011337
470 Ga0373937_0027515
471 Ga0373937_0078846
472 Ga0373937_0434771
473 Ga0373937_0438385
474 Ga0373925_0023027
475 Ga0436365_1054994
476 Ga0436362_0617578
477 Ga0495592_0172612
478 Ga0495664_0217154
479 Ga0495628_0175411
480 Ga0495667_0127656
481 Ga0496104_0203061
482 Ga0496107_0140889
483 Ga0496108_0626496
484 Ga0496126_0002015
485 Ga0495682_0015116
486 Ga0501031_0009533
487 Ga0501032_0020322
488 Ga0501032_0179995
489 Ga0501033_0008334
490 Ga0501033_0018754
491 Ga0501033_0029063
492 Ga0501033_0032854
493 Ga0501033_0110453
494 Ga0501033_0169368
495 Ga0501033_0263860
496 Ga0501034_0020336
497 Ga0501034_0035863
498 Ga0501034_0056076
499 Ga0501034_0066894
500 Ga0501034_0117989
501 Ga0501034_0148551
502 Ga0501034_0400303
503 Ga0501036_0003636
504 Ga0501036_0172182
505 Ga0501036_0842634
506 Ga0501037_0001331
507 Ga0501037_0127781
508 Ga0501038_0030347
509 Ga0501038_0049236
510 Ga0501038_0067905
511 Ga0501038_0132805
512 Ga0501038_0161986
513 Ga0501038_0243455
514 Ga0501039_0001281
515 Ga0501042_0004397
516 Ga0501043_0003737
517 Ga0501043_0081808
518 Ga0501043_0096142
519 Ga0501043_0141391
520 Ga0501043_0184449
521 Ga0501043_0187582
522 Ga0501046_0002802
523 Ga0501046_0006393
524 Ga0501046_0027621
525 Ga0501047_0002989
526 Ga0501047_0003695
527 Ga0501047_0004621
528 Ga0501047_0005450
529 Ga0501047_0005720
530 Ga0501047_0031878
531 Ga0501047_0049203
532 Ga0501047_0143964
533 Ga0501047_0160271
534 Ga0501047_0257788
535 Ga0501047_0317333
536 Ga0501047_0343996
537 Ga0501048_0005279
538 Ga0501048_0205681
539 Ga0501048_0347898
540 Ga0501067_0074462
541 Ga0501067_0077531
542 Ga0501067_0116276
543 Ga0501068_0044491
544 Ga0501069_0043428
545 Ga0501070_0007221
546 Ga0501070_0018514
547 Ga0501070_0048788
548 Ga0501071_0058759
549 Ga0501072_0004446
550 Ga0501072_0017036
551 Ga0501073_0004172
552 Ga0501073_0017503
553 Ga0501073_0283392
554 Ga0501074_0001046
555 Ga0501074_0013789
556 Ga0501074_0199474
557 Ga0501079_0007626
558 Ga0501079_0065162
559 Ga0501080_0134756
560 Ga0501080_0352015
561 Ga0501080_0448578
562 Ga0501080_0492947
563 Ga0501083_0002797
564 Ga0501083_0058922
565 Ga0501035_0001298
566 Ga0501035_0029864
567 Ga0501035_0030375
568 Ga0501035_0037899
569 Ga0501035_0053944
570 Ga0501035_0133150
571 Ga0501035_0222985
572 Ga0501035_0374906
573 Ga0501044_0000530
574 Ga0501044_0014439
575 Ga0501044_0036613
576 Ga0501044_0082035
577 Ga0501044_0100469
578 Ga0501044_0647015
579 nmdc:mga0rr50_15216_c1
580 nmdc:mga0rr50_20813_c1
581 nmdc:mga08x19_100_c1
582 nmdc:mga08x19_151975_c1
583 nmdc:mga08x19_5723_c1
584 Ga0500643_000021
585 Ga0500643_023600
586 Ga0500655_001773
587 Ga0500559_0178854
588 Ga0500568_0059093
589 Ga0500639_171153
590 Ga0500611_007822
591 Ga0501084_0000106
592 Ga0501084_0001821
593 Ga0501084_0056422
594 Ga0501082_0007496
595 Ga0501082_0064664
596 Ga0501082_0217124

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00483

NTP_transferase

Nucleotidyl transferase

6

235

0.87

PF12804

NTP_transf_3

MobA-like NTP transferase domain

7

129

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4y7v-assembly1.cif.gz_A structural analysis of muru 0.905 5 232
4y7v-assembly1.cif.gz_A structural analysis of muru 0.901 5 232
4y7t-assembly1.cif.gz_A structural analysis of muru 0.889 5 230
4y7u-assembly1.cif.gz_A structural analysis of muru 0.8869 5 230
8hhd-assembly1.cif.gz_B crystal structure of pamuru 0.8666 3 230
ID Description Score Start End Superfamily
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.905 5 232 3.90.550.10
4y7vA00 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.9011 5 232 3.90.550.10
af_Q8ILP1_1_241_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8401 5 230 3.90.550.10
af_L7N6A5_2_240_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8318 1 230 3.90.550.10
af_Q9M2S0_1_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8291 5 228 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A529ST98-F1-model_v4 Nucleotidyltransferase family protein 0.9742 25 210 GO:0016779
AF-A0A3C1BM20-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9681 43 230 GO:0016779
AF-A0A529LVG8-F1-model_v4 Nucleotidyltransferase family protein 0.9678 58 230 GO:0016779
AF-A0A434CMZ4-F1-model_v4 Nucleotidyltransferase family protein 0.9657 43 230 GO:0016779
AF-A0A355T4G0-F1-model_v4 Mannose-1-phosphate guanylyltransferase 0.9645 39 231 GO:0016779

Map