F393861

General Info

Members Datasets Scaffolds Average Seq Length
297 279 91 295

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0083047|Ga0495610_0083047_310_1287
Length 325
Sequence VRLVVTGRDGQVATSLLEAGKARDGIEVVAVGRPALDLTQPDTVFDAIAAARPDVVVSAAAYTAVDRAEDQPELAFAVNAVGAGKVAEAAARLGVPVIHLSTDYVFDGSKDDAYVETDATAPLGVYGASKLAGEQAVAALNPRHLILRTAWVYSPFGKNFVKTMLRLARDRDEIAVVADQWGNPTSALDIADAILHAAAMLRDDDSFDGYGIYHLAGTGETNWSGFARHLLETSRTRGGAYARIRNIATNDYPTKAKRPANSRLSSVKFAAAFGWEAPEWQVSAQIVILRLVEGNLGLRLRDGATDLCPEPTPGDLTPVKDSLQQ

Samples

Sample ID Description Type Environment
1 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
2 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
5 2512875024 Mesorhizobium loti R88b Isolate Nodule
6 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
7 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
8 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
9 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
10 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
11 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
12 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
13 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
14 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
15 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
16 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
17 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
18 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
19 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
20 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
21 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
22 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
23 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
24 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
25 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
26 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
27 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
28 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
29 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
30 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
31 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
32 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
33 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
34 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
35 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
36 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
37 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
38 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
39 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
40 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
41 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
42 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
43 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
44 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
45 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
46 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
47 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
48 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
49 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
50 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
51 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
52 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
53 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
54 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
55 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
56 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
57 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
58 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
59 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
60 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
61 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
62 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
63 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
64 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
65 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
66 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
67 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
68 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
69 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
70 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
71 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
72 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
73 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
74 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
75 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
76 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
77 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
78 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
79 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
80 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
81 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
82 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
83 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
84 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
85 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
86 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
87 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
88 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
89 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
90 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
91 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
92 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
93 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
94 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
95 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
96 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
97 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
98 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
99 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
100 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
101 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
102 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
103 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
104 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
105 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
106 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
107 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
108 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
109 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
110 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
111 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
112 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
113 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
114 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
115 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
116 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
117 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
118 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
119 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
120 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
121 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
122 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
123 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
124 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
125 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
126 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
127 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
128 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
129 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
130 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
131 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
132 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
133 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
134 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
135 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
136 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
137 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
138 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
139 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
140 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
141 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
142 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
143 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
144 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
145 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
146 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
147 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
148 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
149 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
150 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
151 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
152 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
153 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
154 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
155 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
156 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
157 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
158 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
159 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
160 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
161 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
162 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
163 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
164 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
165 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
166 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
167 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
168 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
169 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
170 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
171 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
172 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
173 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
174 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
175 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
176 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
177 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
178 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
179 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
180 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
181 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
182 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
183 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
184 3004167301 Mesorhizobium loti 582 Isolate Unclassified
185 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
186 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
187 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
188 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
189 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
190 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
191 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
192 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
193 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
194 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
195 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
196 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
197 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
198 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
199 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
200 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
201 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
202 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
203 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
204 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
205 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
206 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
207 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
208 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
209 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
210 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
211 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
212 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
213 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
214 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
215 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
216 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
227 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
228 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
229 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
230 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
231 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
232 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
233 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
234 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
237 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
238 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
242 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
248 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
263 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
264 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
265 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
266 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
267 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
268 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
269 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
270 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
271 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
272 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
273 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
274 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
275 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
276 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
277 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
278 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
279 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 30.64
Metatranscriptomes 0
Isolates 69.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.4
Nodule 61.95
Rhizoplane 0.67
Rhizosphere 22.22
Stem 0
Stem Tuber 0
Unclassified 8.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1001893 3300002741 Bacteria 6404
2 JGI25165J46597_1000016 3300003214 Bacteria 377866
3 Ga0070670_100080169 3300005331 Bacteria 2805
4 Ga0070660_100364276 3300005339 Bacteria 1192
5 Ga0070714_100169164 3300005435 Bacteria 1982
6 Ga0070714_100313406 3300005435 Bacteria 1465
7 Ga0070705_100098461 3300005440 Bacteria 1840
8 Ga0070679_100138754 3300005530 Bacteria 2412
9 Ga0070684_100201665 3300005535 Bacteria 1812
10 Ga0068860_100007787 3300005843 Bacteria 10700
11 Ga0068862_100021514 3300005844 Bacteria 5389
12 Ga0075363_100093820 3300006048 Bacteria 1654
13 Ga0075363_100206133 3300006048 Bacteria 1124
14 Ga0075362_10039782 3300006177 Bacteria 2068
15 Ga0075370_10025555 3300006353 Bacteria 3268
16 Ga0105240_10005566 3300009093 Bacteria 18739
17 Ga0105240_10163122 3300009093 Bacteria 2645
18 Ga0105237_10050975 3300009545 Bacteria 4159
19 Ga0105238_10001439 3300009551 Bacteria 23916
20 Ga0105239_10012177 3300010375 Bacteria 9590
21 Ga0105239_10013030 3300010375 Bacteria 9245
22 Ga0105239_10029463 3300010375 Bacteria 6035
23 Ga0157370_10040108 3300013104 Bacteria 4521
24 Ga0157370_10181799 3300013104 Bacteria 1954
25 Ga0157374_10058510 3300013296 Bacteria 3602
26 Ga0209026_1000005 3300025250 Bacteria 731387
27 Ga0209148_1000057 3300025254 Bacteria 360463
28 Ga0209759_1000106 3300025256 Bacteria 149959
29 Ga0209233_1000068 3300025261 Bacteria 377969
30 Ga0209455_1000939 3300025272 Bacteria 14926
31 Ga0207695_10013042 3300025913 Bacteria 9926
32 Ga0207657_10157460 3300025919 Bacteria 1846
33 Ga0207652_10135618 3300025921 Bacteria 2198
34 Ga0207694_10023524 3300025924 Bacteria 4677
35 Ga0207668_10115713 3300025972 Bacteria 2021
36 Ga0207683_10409314 3300026121 Bacteria 1248
37 Ga0207698_10280467 3300026142 Bacteria 1541
38 Ga0268266_10210905 3300028379 Bacteria 1781
39 Ga0268265_10007984 3300028380 Bacteria 7144
40 Ga0265319_1000402 3300028563 Bacteria 31382
41 Ga0265320_10034863 3300031240 Bacteria 2555
42 Ga0265327_10027576 3300031251 Bacteria 3266
43 Ga0395899_0026236 3300037312 Bacteria 4396
44 Ga0395900_0326908 3300037418 Bacteria 1512
45 Ga0395900_0374668 3300037418 Bacteria 1392
46 Ga0395898_0071611 3300037466 Bacteria 3349
47 Ga0395905_0044327 3300037471 Bacteria 4174
48 Ga0395905_0117362 3300037471 Bacteria 2501
49 Ga0395905_0139817 3300037471 Bacteria 2278
50 Ga0395901_0154236 3300038443 Bacteria 2412
51 Ga0395901_0186893 3300038443 Bacteria 2173
52 Ga0451797_0516417 3300041453 Bacteria 1271
53 Ga0466972_0000312 3300044658 Bacteria 28150
54 Ga0466966_0001338 3300044684 Bacteria 15828
55 Ga0466961_0015647 3300044693 Bacteria 4867
56 Ga0466963_0228365 3300044694 Bacteria 1304
57 Ga0466971_0033969 3300044719 Bacteria 2285
58 Ga0466957_0035505 3300044842 Bacteria 2991
59 Ga0466959_0021156 3300045049 Bacteria 4795
60 Ga0495610_0083047 3300046512 Bacteria 1467
61 Ga0495643_0032991 3300046522 Bacteria 2869
62 Ga0495625_0077119 3300046660 Bacteria 2329
63 Ga0495686_0000065 3300047472 Bacteria 225907
64 Ga0496117_0139336 3300048920 Bacteria 1456
65 Ga0496120_0024786 3300048923 Bacteria 3734
66 Ga0496123_0086608 3300048926 Bacteria 1878
67 Ga0496126_0020377 3300048929 Bacteria 6503
68 Ga0501033_0127302 3300049570 Bacteria 1846
69 Ga0501034_0266372 3300049571 Bacteria 1655
70 Ga0501036_0039993 3300049572 Bacteria 3966
71 Ga0501036_0078762 3300049572 Bacteria 2787
72 Ga0501043_0109654 3300049579 Bacteria 2167
73 Ga0501046_0070073 3300049580 Bacteria 2727
74 Ga0501047_0102975 3300049581 Bacteria 2734
75 Ga0501047_0323334 3300049581 Bacteria 1382
76 Ga0501070_0099596 3300049586 Bacteria 2405
77 Ga0501035_0009219 3300049822 Bacteria 9176
78 Ga0501035_0041040 3300049822 Bacteria 4179
79 Ga0501035_0127311 3300049822 Bacteria 2223
80 Ga0501044_0012206 3300049823 Bacteria 9299
81 nmdc:mga03n38_47526_c1 3300050490 Bacteria 1900
82 nmdc:mga0yw44_17437_c1 3300050492 Bacteria 3907
83 nmdc:mga07m45_130448_c1 3300050496 Bacteria 1454
84 nmdc:mga0sz30_12287_c1 3300050516 Bacteria 3329
85 Ga0500610_0016204 3300053079 Bacteria 3546
86 Ga0500610_0175131 3300053079 Bacteria 1056
87 Ga0500559_0023499 3300053136 Bacteria 2617
88 Ga0500568_0093219 3300053139 Bacteria 1135
89 Ga0500620_000185 3300053155 Bacteria 12781
90 Ga0500620_021565 3300053155 Bacteria 1927
91 Ga0500622_0007285 3300053156 Bacteria 6298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053079 Ga0500610_0175131 Ga0500610_0175131_11_820 240
2 iso_pu_bacteria 2958144490 2958148646 252
3 iso_pu_bacteria 2878788777 2878792791 259
4 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016142 262
5 3300025261 Ga0209233_1000068 Ga0209233_1000068143 262
6 3300053139 Ga0500568_0093219 Ga0500568_0093219_232_1119 263
7 3300031251 Ga0265327_10027576 Ga0265327_100275764 266
8 3300053136 Ga0500559_0023499 Ga0500559_0023499_1340_2227 266
9 3300041453 Ga0451797_0516417 Ga0451797_0516417_269_1129 268
10 3300025972 Ga0207668_10115713 Ga0207668_101157132 269
11 3300009093 Ga0105240_10163122 Ga0105240_101631222 272
12 3300010375 Ga0105239_10029463 Ga0105239_100294632 272
13 iso_pu_bacteria 2937980651 2937987176 272
14 3300053155 Ga0500620_000185 Ga0500620_000185_8505_9386 273
15 3300053156 Ga0500622_0007285 Ga0500622_0007285_1152_2090 274
16 iso_pu_bacteria 2588253730 2588515138 275
17 3300025254 Ga0209148_1000057 Ga0209148_1000057346 276
18 3300025272 Ga0209455_1000939 Ga0209455_100093913 276
19 3300005339 Ga0070660_100364276 Ga0070660_1003642761 278
20 3300025919 Ga0207657_10157460 Ga0207657_101574601 278
21 3300049570 Ga0501033_0127302 Ga0501033_0127302_966_1823 278
22 3300009545 Ga0105237_10050975 Ga0105237_100509752 279
23 3300010375 Ga0105239_10012177 Ga0105239_100121775 279
24 3300013104 Ga0157370_10040108 Ga0157370_100401084 279
25 3300028379 Ga0268266_10210905 Ga0268266_102109053 279
26 3300037471 Ga0395905_0117362 Ga0395905_0117362_289_1197 280
27 3300050492 nmdc:mga0yw44_17437_c1 nmdc:mga0yw44_17437_c1_1248_2165 280
28 3300006048 Ga0075363_100093820 Ga0075363_1000938202 281
29 3300009551 Ga0105238_10001439 Ga0105238_100014393 281
30 3300010375 Ga0105239_10013030 Ga0105239_100130302 281
31 3300025924 Ga0207694_10023524 Ga0207694_100235242 281
32 3300028563 Ga0265319_1000402 Ga0265319_100040210 281
33 3300031240 Ga0265320_10034863 Ga0265320_100348632 281
34 3300037418 Ga0395900_0326908 Ga0395900_0326908_199_1116 281
35 3300047472 Ga0495686_0000065 Ga0495686_0000065_184016_184912 281
36 3300050490 nmdc:mga03n38_47526_c1 nmdc:mga03n38_47526_c1_374_1282 281
37 3300006048 Ga0075363_100206133 Ga0075363_1002061332 282
38 3300006353 Ga0075370_10025555 Ga0075370_100255555 282
39 3300013296 Ga0157374_10058510 Ga0157374_100585105 282
40 3300038443 Ga0395901_0186893 Ga0395901_0186893_688_1593 282
41 3300048923 Ga0496120_0024786 Ga0496120_0024786_233_1138 282
42 3300050496 nmdc:mga07m45_130448_c1 nmdc:mga07m45_130448_c1_283_1161 282
43 3300026121 Ga0207683_10409314 Ga0207683_104093142 283
44 iso_pu_bacteria 2687453392 2688600367 286
45 iso_pu_bacteria 2871444079 2871448038 286
46 iso_pu_bacteria 2885305155 2885311993 286
47 iso_pu_bacteria 2885326080 2885326213 286
48 iso_pu_bacteria 2885334103 2885341719 286
49 iso_pu_bacteria 2889010040 2889013235 286
50 iso_pu_bacteria 2922158528 2922165346 286
51 iso_pu_bacteria 2924710171 2924711928 286
52 iso_pu_bacteria 2924726620 2924729785 286
53 iso_pu_bacteria 2924733363 2924736064 286
54 iso_pu_bacteria 2968091066 2968095679 286
55 iso_pu_bacteria 2987652177 2987653001 286
56 iso_pu_bacteria 2996341866 2996348468 286
57 iso_pu_bacteria 2508501123 2509118140 287
58 iso_pu_bacteria 2512875016 2512929567 287
59 iso_pu_bacteria 2876363079 2876366873 287
60 iso_pu_bacteria 2903448605 2903453662 287
61 iso_pu_bacteria 2903521522 2903524740 287
62 iso_pu_bacteria 2903528002 2903531017 287
63 iso_pu_bacteria 2937822353 2937828438 287
64 iso_pu_bacteria 2963644680 2963649666 287
65 iso_pu_bacteria 2968083720 2968087026 287
66 iso_pu_bacteria 2977986579 2977989349 287
67 iso_pu_bacteria 2996310559 2996311645 287
68 iso_pu_bacteria 637000159 637079315 287
69 iso_pu_bacteria 2510065059 2510316532 288
70 iso_pu_bacteria 2693429784 2694639731 288
71 iso_pu_bacteria 2756170246 2756673069 288
72 iso_pu_bacteria 2791355123 2792753165 288
73 iso_pu_bacteria 2856334872 2856337461 288
74 iso_pu_bacteria 2857367948 2857368454 288
75 iso_pu_bacteria 2869169390 2869173538 288
76 iso_pu_bacteria 2869234852 2869241232 288
77 iso_pu_bacteria 2869242130 2869246482 288
78 iso_pu_bacteria 2869249662 2869249784 288
79 iso_pu_bacteria 2869256925 2869259391 288
80 iso_pu_bacteria 2869264136 2869270514 288
81 iso_pu_bacteria 2869285874 2869289659 288
82 iso_pu_bacteria 2871429161 2871431725 288
83 iso_pu_bacteria 2871451962 2871456868 288
84 iso_pu_bacteria 2871459585 2871466024 288
85 iso_pu_bacteria 2871481445 2871487514 288
86 iso_pu_bacteria 2874109183 2874113161 288
87 iso_pu_bacteria 2874116593 2874123150 288
88 iso_pu_bacteria 2874131515 2874135859 288
89 iso_pu_bacteria 2874146452 2874155403 288
90 iso_pu_bacteria 2874155637 2874162260 288
91 iso_pu_bacteria 2874168670 2874174226 288
92 iso_pu_bacteria 2876386047 2876387400 288
93 iso_pu_bacteria 2876413966 2876420748 288
94 iso_pu_bacteria 2876420981 2876422788 288
95 iso_pu_bacteria 2878730984 2878737688 288
96 iso_pu_bacteria 2878745973 2878748331 288
97 iso_pu_bacteria 2903492973 2903506008 288
98 iso_pu_bacteria 2903513507 2903519313 288
99 iso_pu_bacteria 2906308376 2906311948 288
100 iso_pu_bacteria 2906321335 2906323686 288
101 iso_pu_bacteria 2906354277 2906360120 288
102 iso_pu_bacteria 2906370794 2906376667 288
103 iso_pu_bacteria 2906393657 2906397200 288
104 iso_pu_bacteria 2906401398 2906401844 288
105 iso_pu_bacteria 2906427513 2906434717 288
106 iso_pu_bacteria 2922130491 2922136173 288
107 iso_pu_bacteria 2922151315 2922153512 288
108 iso_pu_bacteria 2922185730 2922192997 288
109 iso_pu_bacteria 2924741084 2924742131 288
110 iso_pu_bacteria 2937813078 2937818229 288
111 iso_pu_bacteria 2937861824 2937867097 288
112 iso_pu_bacteria 2937868953 2937874434 288
113 iso_pu_bacteria 2958041894 2958046211 288
114 iso_pu_bacteria 2958108152 2958114938 288
115 iso_pu_bacteria 2958122699 2958125945 288
116 iso_pu_bacteria 2958130278 2958134032 288
117 iso_pu_bacteria 2958179912 2958183678 288
118 iso_pu_bacteria 2961077736 2961081644 288
119 iso_pu_bacteria 2961183825 2961190489 288
120 iso_pu_bacteria 2965032056 2965036926 288
121 iso_pu_bacteria 2965040258 2965040452 288
122 iso_pu_bacteria 2965089291 2965089491 288
123 iso_pu_bacteria 2965110997 2965118226 288
124 iso_pu_bacteria 2968117919 2968118564 288
125 iso_pu_bacteria 2968138860 2968140203 288
126 iso_pu_bacteria 2970489779 2970494691 288
127 iso_pu_bacteria 2970510686 2970514549 288
128 iso_pu_bacteria 2970532167 2970535780 288
129 iso_pu_bacteria 2970619444 2970621263 288
130 iso_pu_bacteria 2970627176 2970628183 288
131 iso_pu_bacteria 2977843712 2977851325 288
132 iso_pu_bacteria 2977851361 2977852667 288
133 iso_pu_bacteria 2977872689 2977874954 288
134 iso_pu_bacteria 2977907340 2977913655 288
135 iso_pu_bacteria 2977915119 2977918053 288
136 iso_pu_bacteria 2977942078 2977946635 288
137 iso_pu_bacteria 2977950692 2977955960 288
138 iso_pu_bacteria 2977957713 2977959070 288
139 iso_pu_bacteria 2977971508 2977977793 288
140 iso_pu_bacteria 2979764755 2979768904 288
141 iso_pu_bacteria 2979772303 2979776369 288
142 iso_pu_bacteria 2979793036 2979799239 288
143 iso_pu_bacteria 2987636660 2987643454 288
144 iso_pu_bacteria 2987673487 2987680182 288
145 iso_pu_bacteria 2996386984 2996391929 288
146 iso_pu_bacteria 3000135777 3000142101 288
147 iso_pu_bacteria 3004203850 3004206999 288
148 iso_pu_bacteria 3004232784 3004233179 288
149 iso_pu_bacteria 3004239961 3004245906 288
150 iso_pu_bacteria 3004248173 3004250725 288
151 iso_pu_bacteria 3004268573 3004273247 288
152 iso_pu_bacteria 8004312739 8004314070 288
153 iso_pu_bacteria 8004361976 8004362679 288
154 iso_pu_bacteria 8004387939 8004391537 288
155 iso_pu_bacteria 8004695233 8004700802 288
156 iso_pu_bacteria 8004714634 8004716906 288
157 iso_pu_bacteria 8004727605 8004734555 288
158 3300005844 Ga0068862_100021514 Ga0068862_1000215145 289
159 3300028380 Ga0268265_10007984 Ga0268265_100079843 289
160 iso_pu_bacteria 2513237090 2513608184 289
161 iso_pu_bacteria 2847670302 2847672052 289
162 iso_pu_bacteria 2876392853 2876398840 289
163 iso_pu_bacteria 2881161766 2881163053 289
164 iso_pu_bacteria 2904659560 2904665372 289
165 iso_pu_bacteria 2937848649 2937850612 289
166 iso_pu_bacteria 2961114664 2961120372 289
167 iso_pu_bacteria 2968110612 2968116839 289
168 iso_pu_bacteria 2977922695 2977927699 289
169 iso_pu_bacteria 3004218560 3004223509 289
170 3300009093 Ga0105240_10005566 Ga0105240_1000556611 290
171 3300025913 Ga0207695_10013042 Ga0207695_100130426 290
172 3300044658 Ga0466972_0000312 Ga0466972_0000312_26642_27541 290
173 iso_pu_bacteria 2509276022 2509397962 290
174 iso_pu_bacteria 2512875024 2512964355 290
175 iso_pu_bacteria 2513237144 2513909700 290
176 iso_pu_bacteria 2513237164 2514036889 290
177 iso_pu_bacteria 2643221627 2644152269 290
178 iso_pu_bacteria 2856320880 2856326679 290
179 iso_pu_bacteria 2856328259 2856328662 290
180 iso_pu_bacteria 2869271264 2869278562 290
181 iso_pu_bacteria 2874162495 2874166629 290
182 iso_pu_bacteria 2876377896 2876384537 290
183 iso_pu_bacteria 2876399893 2876403987 290
184 iso_pu_bacteria 2876406927 2876413913 290
185 iso_pu_bacteria 2878738818 2878744310 290
186 iso_pu_bacteria 2878774303 2878780610 290
187 iso_pu_bacteria 2888337043 2888341748 290
188 iso_pu_bacteria 2889016732 2889021917 290
189 iso_pu_bacteria 2906386501 2906393058 290
190 iso_pu_bacteria 2906408224 2906409952 290
191 iso_pu_bacteria 2922172374 2922178114 290
192 iso_pu_bacteria 2922178524 2922184346 290
193 iso_pu_bacteria 2924748358 2924753070 290
194 iso_pu_bacteria 2924776078 2924782228 290
195 iso_pu_bacteria 2937877337 2937877645 290
196 iso_pu_bacteria 2938014810 2938019058 290
197 iso_pu_bacteria 2958034702 2958036074 290
198 iso_pu_bacteria 2958041894 2958047498 290
199 iso_pu_bacteria 2958084443 2958084752 290
200 iso_pu_bacteria 2958100919 2958103998 290
201 iso_pu_bacteria 2958137437 2958139517 290
202 iso_pu_bacteria 2958158011 2958158831 290
203 iso_pu_bacteria 2961136820 2961144597 290
204 iso_pu_bacteria 2965025482 2965026283 290
205 iso_pu_bacteria 2965047637 2965048276 290
206 iso_pu_bacteria 2965102966 2965106435 290
207 iso_pu_bacteria 2965119406 2965123508 290
208 iso_pu_bacteria 2968016561 2968022290 290
209 iso_pu_bacteria 2970469710 2970474879 290
210 iso_pu_bacteria 2970547951 2970550691 290
211 iso_pu_bacteria 2970593180 2970594803 290
212 iso_pu_bacteria 2977935797 2977940451 290
213 iso_pu_bacteria 2979710463 2979717361 290
214 iso_pu_bacteria 3004167301 3004171169 290
215 iso_pu_bacteria 3004334049 3004339134 290
216 iso_pu_bacteria 649633066 649874828 290
217 iso_pu_bacteria 8004300914 8004305030 290
218 3300046660 Ga0495625_0077119 Ga0495625_0077119_723_1601 291
219 3300048926 Ga0496123_0086608 Ga0496123_0086608_21_899 291
220 3300050516 nmdc:mga0sz30_12287_c1 nmdc:mga0sz30_12287_c1_934_1851 291
221 3300053155 Ga0500620_021565 Ga0500620_021565_438_1316 291
222 iso_pu_bacteria 2599185301 2599938727 291
223 iso_pu_bacteria 2841734538 2841734988 291
224 iso_pu_bacteria 2869162929 2869168736 291
225 iso_pu_bacteria 2871474448 2871478145 291
226 iso_pu_bacteria 2876369609 2876377163 291
227 iso_pu_bacteria 2878035449 2878037523 291
228 iso_pu_bacteria 2878753008 2878756761 291
229 iso_pu_bacteria 2881147464 2881154933 291
230 iso_pu_bacteria 2881155292 2881157677 291
231 iso_pu_bacteria 2881845957 2881851585 291
232 iso_pu_bacteria 2881853255 2881855868 291
233 iso_pu_bacteria 2882912400 2882919275 291
234 iso_pu_bacteria 2885318864 2885320699 291
235 iso_pu_bacteria 2903492973 2903496435 291
236 iso_pu_bacteria 2906414383 2906418248 291
237 iso_pu_bacteria 2924762789 2924764378 291
238 iso_pu_bacteria 2924784321 2924788351 291
239 iso_pu_bacteria 2937836603 2937838591 291
240 iso_pu_bacteria 2958071322 2958074577 291
241 iso_pu_bacteria 2961127735 2961134155 291
242 iso_pu_bacteria 2961170736 2961173051 291
243 iso_pu_bacteria 2967996073 2967998262 291
244 iso_pu_bacteria 2968003550 2968006312 291
245 iso_pu_bacteria 2970503327 2970505645 291
246 iso_pu_bacteria 2977821940 2977825941 291
247 iso_pu_bacteria 2977828996 2977837140 291
248 iso_pu_bacteria 2979808191 2979810366 291
249 iso_pu_bacteria 2987666974 2987672776 291
250 iso_pu_bacteria 2996348954 2996354290 291
251 iso_pu_bacteria 3004275668 3004280958 291
252 iso_pu_bacteria 8004374579 8004378349 291
253 iso_pu_bacteria 8004633249 8004635864 291
254 iso_pu_bacteria 8004640170 8004646132 291
255 3300046522 Ga0495643_0032991 Ga0495643_0032991_362_1282 292
256 3300049571 Ga0501034_0266372 Ga0501034_0266372_587_1468 292
257 3300049572 Ga0501036_0078762 Ga0501036_0078762_904_1785 292
258 3300049822 Ga0501035_0009219 Ga0501035_0009219_1247_2128 292
259 3300049823 Ga0501044_0012206 Ga0501044_0012206_1243_2124 292
260 3300005331 Ga0070670_100080169 Ga0070670_1000801693 293
261 3300005435 Ga0070714_100169164 Ga0070714_1001691642 293
262 3300005435 Ga0070714_100313406 Ga0070714_1003134062 293
263 3300005535 Ga0070684_100201665 Ga0070684_1002016652 293
264 3300013104 Ga0157370_10181799 Ga0157370_101817992 293
265 3300037312 Ga0395899_0026236 Ga0395899_0026236_1432_2334 293
266 3300037418 Ga0395900_0374668 Ga0395900_0374668_170_1072 293
267 3300037466 Ga0395898_0071611 Ga0395898_0071611_770_1672 293
268 3300037471 Ga0395905_0044327 Ga0395905_0044327_2770_3672 293
269 3300038443 Ga0395901_0154236 Ga0395901_0154236_896_1798 293
270 3300044684 Ga0466966_0001338 Ga0466966_0001338_14477_15364 293
271 3300044693 Ga0466961_0015647 Ga0466961_0015647_1877_2764 293
272 3300044694 Ga0466963_0228365 Ga0466963_0228365_128_1012 293
273 3300044719 Ga0466971_0033969 Ga0466971_0033969_410_1297 293
274 3300044842 Ga0466957_0035505 Ga0466957_0035505_522_1445 293
275 3300045049 Ga0466959_0021156 Ga0466959_0021156_3245_4132 293
276 3300049581 Ga0501047_0323334 Ga0501047_0323334_40_927 293
277 3300049822 Ga0501035_0041040 Ga0501035_0041040_656_1543 293
278 3300049822 Ga0501035_0127311 Ga0501035_0127311_599_1486 293
279 3300005440 Ga0070705_100098461 Ga0070705_1000984611 294
280 3300005530 Ga0070679_100138754 Ga0070679_1001387543 294
281 3300005843 Ga0068860_100007787 Ga0068860_1000077876 294
282 3300025921 Ga0207652_10135618 Ga0207652_101356182 294
283 3300026142 Ga0207698_10280467 Ga0207698_102804672 294
284 3300002741 JGI25157J39369_1001893 JGI25157J39369_10018931 295
285 3300006177 Ga0075362_10039782 Ga0075362_100397822 295
286 3300025250 Ga0209026_1000005 Ga0209026_1000005250 295
287 3300025256 Ga0209759_1000106 Ga0209759_1000106133 295
288 3300037471 Ga0395905_0139817 Ga0395905_0139817_1141_2082 295
289 3300046512 Ga0495610_0083047 Ga0495610_0083047_310_1287 295
290 3300048920 Ga0496117_0139336 Ga0496117_0139336_290_1192 295
291 3300048929 Ga0496126_0020377 Ga0496126_0020377_405_1304 295
292 3300049572 Ga0501036_0039993 Ga0501036_0039993_1397_2305 295
293 3300049579 Ga0501043_0109654 Ga0501043_0109654_1109_2017 295
294 3300049580 Ga0501046_0070073 Ga0501046_0070073_356_1264 295
295 3300049581 Ga0501047_0102975 Ga0501047_0102975_1121_2029 295
296 3300049586 Ga0501070_0099596 Ga0501070_0099596_1351_2259 295
297 3300053079 Ga0500610_0016204 Ga0500610_0016204_2466_3374 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

1

292

0.97

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

13

165

0.94

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

3

222

0.93

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

16

163

0.86

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

17

241

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9523 1 290
3sc6-assembly6.cif.gz_F 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9506 2 286
3sc6-assembly2.cif.gz_B 2.65 angstrom resolution crystal structure of dtdp-4-dehydrorhamnose reductase (rfbd) from bacillus anthracis str. ames in complex with nadp 0.9483 2 286
1vl0-assembly1.cif.gz_B crystal structure of a dtdp-4-dehydrorhamnose reductase, rfbd ortholog (ca_c2315) from clostridium acetobutylicum atcc 824 at 2.05 a resolution 0.9424 1 290
8ctr-assembly4.cif.gz_D crystal structure of dtdp-4-dehydrorhamnose reductase from klebsiella pneumoniae with bound nadp 0.9407 2 293
ID Description Score Start End Superfamily
4wpgA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9278 2 217 3.40.50.720
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9258 1 295 3.40.50.720
1vl0B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9235 3 216 3.40.50.720
1kc0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9228 1 295 3.40.50.720
1n2sA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9083 1 277 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A440ME15-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9962 1 291 GO:0008831
GO:0019305
AF-A0A436FP44-F1-model_v4 deleted 0.9927 43 293
AF-A0A531NB46-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9906 153 292 GO:0005829
GO:0008831
GO:0019305
GO:0045226
AF-A0A1I1BMY0-F1-model_v4 dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133) 0.9904 2 290 GO:0008831
GO:0019305
AF-A0A529UJJ4-F1-model_v4 deleted 0.9865 61 225

Feature Viewer

pLDDT pTM Quality
95.81 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map