F393838

General Info

Members Datasets Scaffolds Average Seq Length
297 206 594 136

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0116069|Ga0466959_0116069_1294_1755
Length 153
Sequence VPGVADERRARVEDVHELALALPHVTVVHGSRGNPVYQVGGRSFIFFRTPRPDAVDPETGERLPDVIVFWVESEADKQALVQDPTTPFFTTPHFDGHDSVLVQAGRLGEITRRELAELVQDAWLARASARRRAAWLAEHGSALARGADAAGEP

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
129 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
133 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
161 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
165 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
166 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
167 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
168 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
202 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
205 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
206 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0
Isolates 0.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.01
Nodule 0
Rhizoplane 10.44
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 7.41

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0116069 3300045049 Bacteria 1907
2 Ga0070658_10626162 3300005327 Bacteria 933
3 Ga0070683_100344145 3300005329 Bacteria 1420
4 Ga0070690_100076108 3300005330 Bacteria 2189
5 Ga0068869_100034033 3300005334 Bacteria 3602
6 Ga0070666_10303658 3300005335 Bacteria 1137
7 Ga0070680_100217071 3300005336 Bacteria 1614
8 Ga0070682_100195775 3300005337 Bacteria 1422
9 Ga0068868_100098953 3300005338 Bacteria 2359
10 Ga0070660_100039857 3300005339 Bacteria 3571
11 Ga0070673_100150749 3300005364 Bacteria 1969
12 Ga0070659_100367395 3300005366 Bacteria 1210
13 Ga0070667_100019746 3300005367 Bacteria 5591
14 Ga0070714_101166929 3300005435 Bacteria 751
15 Ga0070701_10010501 3300005438 Bacteria 4096
16 Ga0070711_100102204 3300005439 Bacteria 2087
17 Ga0070694_100058026 3300005444 Bacteria 2632
18 Ga0070678_100122652 3300005456 Bacteria 2051
19 Ga0070662_100071485 3300005457 Bacteria 2559
20 Ga0070685_10342952 3300005466 Bacteria 1019
21 Ga0070685_10701498 3300005466 Bacteria 738
22 Ga0070679_100195751 3300005530 Bacteria 1989
23 Ga0070697_101230368 3300005536 Bacteria 668
24 Ga0068853_100134443 3300005539 Bacteria 2216
25 Ga0070695_100049110 3300005545 Bacteria 2700
26 Ga0070696_100122580 3300005546 Bacteria 1883
27 Ga0070665_100089192 3300005548 Bacteria 3090
28 Ga0070704_100218718 3300005549 Bacteria 1547
29 Ga0068855_100066443 3300005563 Bacteria 4205
30 Ga0068857_100234778 3300005577 Bacteria 1678
31 Ga0068856_100044701 3300005614 Bacteria 4359
32 Ga0068859_100700779 3300005617 Bacteria 1103
33 Ga0068870_11277451 3300005840 Bacteria 534
34 Ga0068858_100136160 3300005842 Bacteria 2305
35 Ga0068858_100186090 3300005842 Bacteria 1961
36 Ga0068860_100026381 3300005843 Bacteria 5601
37 Ga0068860_100322920 3300005843 Bacteria 1515
38 Ga0068862_100570789 3300005844 Bacteria 1082
39 Ga0081455_10513738 3300005937 Bacteria 801
40 Ga0070717_10432734 3300006028 Bacteria 1184
41 Ga0070717_12015284 3300006028 Bacteria 520
42 Ga0070712_100019739 3300006175 Bacteria 4401
43 Ga0070712_100584200 3300006175 Bacteria 944
44 Ga0097621_100058254 3300006237 Bacteria 3161
45 Ga0068871_100086492 3300006358 Bacteria 2605
46 Ga0075433_10122511 3300006852 Bacteria 2309
47 Ga0075434_100176650 3300006871 Bacteria 2155
48 Ga0075434_101749780 3300006871 Bacteria 629
49 Ga0097620_100700761 3300006931 Bacteria 1103
50 Ga0075435_100048534 3300007076 Bacteria 3411
51 Ga0075435_100623640 3300007076 Unclassified 935
52 Ga0105251_10043096 3300009011 Bacteria 2187
53 Ga0105240_10446621 3300009093 Bacteria 1448
54 Ga0111539_10677013 3300009094 Unclassified 1201
55 Ga0105247_10138852 3300009101 Bacteria 1591
56 Ga0114129_12467184 3300009147 Bacteria 622
57 Ga0105243_10122680 3300009148 Bacteria 2193
58 Ga0105243_10465980 3300009148 Unclassified 1189
59 Ga0105243_11888274 3300009148 Bacteria 630
60 Ga0105241_10138480 3300009174 Bacteria 1979
61 Ga0105241_10422555 3300009174 Bacteria 1173
62 Ga0105241_11391365 3300009174 Bacteria 671
63 Ga0105242_10127360 3300009176 Bacteria 2193
64 Ga0105242_11450055 3300009176 Bacteria 715
65 Ga0105248_10132971 3300009177 Bacteria 2807
66 Ga0105248_11700024 3300009177 Unclassified 715
67 Ga0105248_12177524 3300009177 Bacteria 631
68 Ga0105237_10110283 3300009545 Bacteria 2744
69 Ga0105237_10741679 3300009545 Unclassified 988
70 Ga0105238_10258498 3300009551 Bacteria 1720
71 Ga0105238_10374744 3300009551 Bacteria 1414
72 Ga0105249_10047616 3300009553 Bacteria 3907
73 Ga0105239_10131608 3300010375 Bacteria 2783
74 Ga0105239_10277364 3300010375 Bacteria 1887
75 Ga0105246_10014238 3300011119 Bacteria 4999
76 Ga0105246_11687106 3300011119 Bacteria 602
77 Ga0157373_10092058 3300013100 Bacteria 2135
78 Ga0157370_10064171 3300013104 Bacteria 3478
79 Ga0157369_10214215 3300013105 Bacteria 2018
80 Ga0157369_10409118 3300013105 Bacteria 1407
81 Ga0157369_10604547 3300013105 Bacteria 1132
82 Ga0157369_11108005 3300013105 Unclassified 809
83 Ga0157369_11991377 3300013105 Bacteria 589
84 Ga0157374_10296312 3300013296 Unclassified 1600
85 Ga0157378_10045680 3300013297 Bacteria 3893
86 Ga0157378_11538205 3300013297 Bacteria 710
87 Ga0163162_10472818 3300013306 Bacteria 1385
88 Ga0163162_10638197 3300013306 Bacteria 1189
89 Ga0157372_10147702 3300013307 Bacteria 2711
90 Ga0157375_10088504 3300013308 Bacteria 3151
91 Ga0163163_10184631 3300014325 Bacteria 2133
92 Ga0157380_10199685 3300014326 Bacteria 1773
93 Ga0157380_11045792 3300014326 Bacteria 852
94 Ga0157377_10035333 3300014745 Bacteria 2741
95 Ga0157379_10096472 3300014968 Bacteria 2654
96 Ga0157379_10148687 3300014968 Bacteria 2113
97 Ga0157376_10084463 3300014969 Bacteria 2734
98 Ga0163161_10002474 3300017792 Bacteria 13169
99 Ga0163161_10899985 3300017792 Bacteria 750
100 Ga0207642_10071736 3300025899 Bacteria 1651
101 Ga0207710_10133478 3300025900 Bacteria 1194
102 Ga0207688_10000882 3300025901 Bacteria 15157
103 Ga0207680_10318290 3300025903 Unclassified 1087
104 Ga0207647_10083901 3300025904 Bacteria 1908
105 Ga0207647_10178110 3300025904 Bacteria 1236
106 Ga0207699_10066231 3300025906 Bacteria 2192
107 Ga0207643_10051763 3300025908 Bacteria 2331
108 Ga0207643_10612621 3300025908 Bacteria 701
109 Ga0207684_10468545 3300025910 Bacteria 1081
110 Ga0207671_10569339 3300025914 Bacteria 903
111 Ga0207693_10002495 3300025915 Bacteria 16012
112 Ga0207693_10408199 3300025915 Bacteria 1062
113 Ga0207663_10034149 3300025916 Bacteria 3039
114 Ga0207657_10005064 3300025919 Bacteria 13823
115 Ga0207652_10079273 3300025921 Bacteria 2869
116 Ga0207652_10334601 3300025921 Bacteria 1367
117 Ga0207694_10092119 3300025924 Bacteria 2392
118 Ga0207687_10097072 3300025927 Bacteria 2161
119 Ga0207700_10518678 3300025928 Bacteria 1056
120 Ga0207664_10403943 3300025929 Unclassified 1215
121 Ga0207644_10483751 3300025931 Bacteria 1020
122 Ga0207690_10223422 3300025932 Bacteria 1442
123 Ga0207706_10008663 3300025933 Bacteria 9372
124 Ga0207686_10028283 3300025934 Bacteria 3294
125 Ga0207709_10043516 3300025935 Bacteria 2707
126 Ga0207709_10459494 3300025935 Bacteria 986
127 Ga0207669_10097187 3300025937 Bacteria 1936
128 Ga0207665_10011204 3300025939 Bacteria 5885
129 Ga0207691_10214894 3300025940 Bacteria 1669
130 Ga0207711_10314438 3300025941 Unclassified 1446
131 Ga0207689_10257261 3300025942 Bacteria 1444
132 Ga0207661_10277163 3300025944 Bacteria 1498
133 Ga0207651_10429164 3300025960 Bacteria 1130
134 Ga0207668_10016958 3300025972 Bacteria 4558
135 Ga0207668_10091978 3300025972 Bacteria 2231
136 Ga0207640_10335763 3300025981 Bacteria 1209
137 Ga0207658_10082107 3300025986 Bacteria 2474
138 Ga0207677_10134762 3300026023 Bacteria 1881
139 Ga0207677_10209000 3300026023 Bacteria 1557
140 Ga0207703_10110553 3300026035 Bacteria 2344
141 Ga0207639_10484108 3300026041 Unclassified 1128
142 Ga0207678_10006275 3300026067 Bacteria 10559
143 Ga0207708_10086166 3300026075 Bacteria 2417
144 Ga0207708_11297986 3300026075 Bacteria 638
145 Ga0207702_10251795 3300026078 Bacteria 1659
146 Ga0207702_10359980 3300026078 Bacteria 1394
147 Ga0207702_10832136 3300026078 Unclassified 913
148 Ga0207641_10753561 3300026088 Bacteria 961
149 Ga0207676_10176570 3300026095 Bacteria 1866
150 Ga0207674_10130690 3300026116 Bacteria 2474
151 Ga0207675_100040166 3300026118 Bacteria 4368
152 Ga0207683_10041396 3300026121 Bacteria 4023
153 Ga0268266_10164179 3300028379 Bacteria 2011
154 Ga0268265_10099975 3300028380 Bacteria 2340
155 Ga0268264_10046472 3300028381 Bacteria 3605
156 Ga0268264_10256193 3300028381 Bacteria 1628
157 Ga0307408_101116521 3300031548 Bacteria 732
158 Ga0307518_10198991 3300031838 Bacteria 1333
159 Ga0307518_10435957 3300031838 Bacteria 710
160 Ga0307416_100709923 3300032002 Bacteria 1095
161 Ga0307415_100009398 3300032126 Bacteria 5476
162 Ga0373950_0035913 3300034818 Unclassified 934
163 Ga0373929_0007046 3300035085 Bacteria 2046
164 Ga0373940_0025824 3300035088 Bacteria 1533
165 Ga0373949_0027965 3300035090 Unclassified 1329
166 Ga0373932_0016189 3300035112 Bacteria 1900
167 Ga0373931_0025171 3300035691 Bacteria 3022
168 Ga0436364_0047855 3300037853 Bacteria 2007
169 Ga0436364_0142046 3300037853 Bacteria 782
170 Ga0436364_0150636 3300037853 Bacteria 12283
171 Ga0436365_1811262 3300039437 Bacteria 5047
172 Ga0436362_0191358 3300039453 Bacteria 553
173 Ga0436362_0304917 3300039453 Unclassified 755
174 Ga0451789_0849923 3300041443 Bacteria 829
175 Ga0451833_1197995 3300041491 Bacteria 538
176 Ga0466969_0312630 3300044656 Bacteria 711
177 Ga0466972_0432681 3300044658 Bacteria 617
178 Ga0466965_0532536 3300044683 Bacteria 662
179 Ga0466965_0893329 3300044683 Bacteria 518
180 Ga0466966_0054443 3300044684 Bacteria 2535
181 Ga0466966_0071784 3300044684 Bacteria 2169
182 Ga0466966_0133016 3300044684 Bacteria 1522
183 Ga0466961_0033690 3300044693 Bacteria 3290
184 Ga0466961_0074367 3300044693 Bacteria 2154
185 Ga0466961_0263537 3300044693 Bacteria 1056
186 Ga0466961_0643065 3300044693 Bacteria 637
187 Ga0466963_0064129 3300044694 Bacteria 2460
188 Ga0466963_0070538 3300044694 Bacteria 2350
189 Ga0466963_0075059 3300044694 Bacteria 2281
190 Ga0466963_0237848 3300044694 Bacteria 1277
191 Ga0466963_0652975 3300044694 Bacteria 742
192 Ga0466963_0970790 3300044694 Bacteria 598
193 Ga0466964_0376916 3300044706 Bacteria 735
194 Ga0466971_0016447 3300044719 Bacteria 3266
195 Ga0466971_0106169 3300044719 Bacteria 1294
196 Ga0466968_0369699 3300044735 Bacteria 699
197 Ga0466970_0075916 3300044765 Bacteria 1810
198 Ga0466970_0154453 3300044765 Bacteria 1268
199 Ga0466957_0051978 3300044842 Bacteria 2494
200 Ga0466957_0115872 3300044842 Bacteria 1704
201 Ga0466960_0063788 3300044901 Bacteria 1815
202 Ga0466960_0800821 3300044901 Bacteria 570
203 Ga0466959_0042335 3300045049 Bacteria 3359
204 Ga0466959_0057828 3300045049 Bacteria 2826
205 Ga0466959_0074789 3300045049 Bacteria 2449
206 Ga0466959_0108864 3300045049 Bacteria 1979
207 Ga0466959_0112964 3300045049 Bacteria 1937
208 Ga0466959_0336477 3300045049 Bacteria 1030
209 Ga0466959_0369388 3300045049 Bacteria 977
210 Ga0466958_0012788 3300045836 Bacteria 4762
211 Ga0466958_0121243 3300045836 Bacteria 1637
212 Ga0466958_0637316 3300045836 Bacteria 694
213 Ga0466967_0097785 3300045976 Bacteria 2679
214 Ga0466967_0103419 3300045976 Bacteria 2606
215 Ga0466967_0333905 3300045976 Bacteria 1464
216 Ga0466967_0479130 3300045976 Bacteria 1219
217 Ga0466967_0627935 3300045976 Bacteria 1061
218 Ga0466967_1582110 3300045976 Bacteria 653
219 Ga0495603_0002657 3300046455 Bacteria 10539
220 Ga0495638_0165645 3300046460 Bacteria 1272
221 Ga0495664_0059290 3300046477 Bacteria 2278
222 Ga0495585_0267254 3300046492 Bacteria 849
223 Ga0495594_0250265 3300046499 Bacteria 1009
224 Ga0495618_0887911 3300046514 Bacteria 515
225 Ga0495628_0524938 3300046516 Bacteria 852
226 Ga0495645_0019504 3300046543 Bacteria 4881
227 Ga0495645_0463262 3300046543 Bacteria 798
228 Ga0495661_0536964 3300046665 Bacteria 554
229 Ga0495588_0286808 3300046674 Bacteria 867
230 Ga0495588_0379801 3300046674 Bacteria 742
231 Ga0495658_0302732 3300046683 Bacteria 1011
232 Ga0495670_0054467 3300046691 Bacteria 2004
233 Ga0495589_0022376 3300046794 Bacteria 3225
234 Ga0495636_0303439 3300047318 Bacteria 747
235 Ga0495674_0038940 3300047319 Bacteria 4263
236 Ga0495674_0105984 3300047319 Bacteria 2388
237 Ga0495676_0091393 3300047321 Bacteria 2275
238 Ga0495685_013875 3300047447 Bacteria 2734
239 Ga0495614_0324035 3300048089 Bacteria 715
240 Ga0496100_0207173 3300048903 Bacteria 1432
241 Ga0496100_0665897 3300048903 Bacteria 811
242 Ga0496101_0046743 3300048904 Unclassified 3105
243 Ga0496101_0235923 3300048904 Bacteria 1423
244 Ga0496102_0054599 3300048905 Unclassified 3643
245 Ga0496104_0098400 3300048907 Bacteria 2800
246 Ga0496104_0921692 3300048907 Unclassified 778
247 Ga0496105_0041507 3300048908 Bacteria 3792
248 Ga0496106_0766657 3300048909 Unclassified 766
249 Ga0496106_0887369 3300048909 Unclassified 705
250 Ga0496106_1000730 3300048909 Bacteria 657
251 Ga0496107_0186743 3300048910 Bacteria 1540
252 Ga0496107_0313003 3300048910 Bacteria 1169
253 Ga0496108_0047393 3300048911 Bacteria 3592
254 Ga0496108_0059787 3300048911 Bacteria 3205
255 Ga0496109_0021639 3300048912 Bacteria 5689
256 Ga0496109_0041845 3300048912 Bacteria 4150
257 Ga0496110_0057033 3300048913 Bacteria 3437
258 Ga0496110_0360300 3300048913 Bacteria 1325
259 Ga0496110_0606928 3300048913 Unclassified 992
260 Ga0496110_1627438 3300048913 Bacteria 556
261 Ga0496111_0183077 3300048914 Bacteria 1557
262 Ga0496111_0614715 3300048914 Bacteria 795
263 Ga0496112_0046918 3300048915 Bacteria 4238
264 Ga0496113_0583694 3300048916 Bacteria 895
265 Ga0496113_0822613 3300048916 Bacteria 737
266 Ga0496114_0136207 3300048917 Bacteria 2123
267 Ga0496115_0015030 3300048918 Bacteria 5866
268 Ga0496115_0471038 3300048918 Unclassified 1012
269 Ga0496115_0608383 3300048918 Bacteria 868
270 Ga0496124_0482642 3300048927 Bacteria 836
271 Ga0501031_0351887 3300049568 Bacteria 954
272 Ga0501032_0751290 3300049569 Bacteria 617
273 Ga0501033_0003590 3300049570 Bacteria 12679
274 Ga0501034_0358908 3300049571 Bacteria 1385
275 Ga0501036_0682032 3300049572 Bacteria 850
276 Ga0501038_0022390 3300049574 Bacteria 5664
277 Ga0501046_0033338 3300049580 Bacteria 4162
278 Ga0501047_1380280 3300049581 Bacteria 519
279 Ga0501070_0789364 3300049586 Bacteria 746
280 Ga0501073_0458629 3300049589 Bacteria 881
281 Ga0501074_0255166 3300049590 Bacteria 1247
282 Ga0501080_0817965 3300049742 Bacteria 816
283 Ga0501035_0102940 3300049822 Bacteria 2505
284 Ga0501044_0092248 3300049823 Bacteria 3054
285 Ga0501044_0923062 3300049823 Bacteria 747
286 nmdc:mga0yw44_32322_c1 3300050492 Bacteria 3049
287 nmdc:mga08y16_238400_c1 3300050511 Bacteria 1880
288 nmdc:mga0n895_105667_c1 3300050512 Bacteria 2828
289 nmdc:mga0rr50_230139_c1 3300050513 Bacteria 1533
290 nmdc:mga0a205_502096_c1 3300050515 Bacteria 1070
291 nmdc:mga0sz30_552736_c1 3300050516 Bacteria 519
292 Ga0500561_0152131 3300053137 Bacteria 720
293 Ga0501082_1567378 3300060353 Bacteria 575
294 Ga0466962_0081791 3300061719 Bacteria 1545
295 Ga0466962_0322081 3300061719 Bacteria 767
296 2558910679 2558860112 Bacteria 9931328
297 2917739004 2917736166 Bacteria 9690793
298 Ga0466959_0116069
299 Ga0070658_10626162
300 Ga0070683_100344145
301 Ga0070690_100076108
302 Ga0068869_100034033
303 Ga0070666_10303658
304 Ga0070680_100217071
305 Ga0070682_100195775
306 Ga0068868_100098953
307 Ga0070660_100039857
308 Ga0070673_100150749
309 Ga0070659_100367395
310 Ga0070667_100019746
311 Ga0070714_101166929
312 Ga0070701_10010501
313 Ga0070711_100102204
314 Ga0070694_100058026
315 Ga0070678_100122652
316 Ga0070662_100071485
317 Ga0070685_10342952
318 Ga0070685_10701498
319 Ga0070679_100195751
320 Ga0070697_101230368
321 Ga0068853_100134443
322 Ga0070695_100049110
323 Ga0070696_100122580
324 Ga0070665_100089192
325 Ga0070704_100218718
326 Ga0068855_100066443
327 Ga0068857_100234778
328 Ga0068856_100044701
329 Ga0068859_100700779
330 Ga0068870_11277451
331 Ga0068858_100136160
332 Ga0068858_100186090
333 Ga0068860_100026381
334 Ga0068860_100322920
335 Ga0068862_100570789
336 Ga0081455_10513738
337 Ga0070717_10432734
338 Ga0070717_12015284
339 Ga0070712_100019739
340 Ga0070712_100584200
341 Ga0097621_100058254
342 Ga0068871_100086492
343 Ga0075433_10122511
344 Ga0075434_100176650
345 Ga0075434_101749780
346 Ga0097620_100700761
347 Ga0075435_100048534
348 Ga0075435_100623640
349 Ga0105251_10043096
350 Ga0105240_10446621
351 Ga0111539_10677013
352 Ga0105247_10138852
353 Ga0114129_12467184
354 Ga0105243_10122680
355 Ga0105243_10465980
356 Ga0105243_11888274
357 Ga0105241_10138480
358 Ga0105241_10422555
359 Ga0105241_11391365
360 Ga0105242_10127360
361 Ga0105242_11450055
362 Ga0105248_10132971
363 Ga0105248_11700024
364 Ga0105248_12177524
365 Ga0105237_10110283
366 Ga0105237_10741679
367 Ga0105238_10258498
368 Ga0105238_10374744
369 Ga0105249_10047616
370 Ga0105239_10131608
371 Ga0105239_10277364
372 Ga0105246_10014238
373 Ga0105246_11687106
374 Ga0157373_10092058
375 Ga0157370_10064171
376 Ga0157369_10214215
377 Ga0157369_10409118
378 Ga0157369_10604547
379 Ga0157369_11108005
380 Ga0157369_11991377
381 Ga0157374_10296312
382 Ga0157378_10045680
383 Ga0157378_11538205
384 Ga0163162_10472818
385 Ga0163162_10638197
386 Ga0157372_10147702
387 Ga0157375_10088504
388 Ga0163163_10184631
389 Ga0157380_10199685
390 Ga0157380_11045792
391 Ga0157377_10035333
392 Ga0157379_10096472
393 Ga0157379_10148687
394 Ga0157376_10084463
395 Ga0163161_10002474
396 Ga0163161_10899985
397 Ga0207642_10071736
398 Ga0207710_10133478
399 Ga0207688_10000882
400 Ga0207680_10318290
401 Ga0207647_10083901
402 Ga0207647_10178110
403 Ga0207699_10066231
404 Ga0207643_10051763
405 Ga0207643_10612621
406 Ga0207684_10468545
407 Ga0207671_10569339
408 Ga0207693_10002495
409 Ga0207693_10408199
410 Ga0207663_10034149
411 Ga0207657_10005064
412 Ga0207652_10079273
413 Ga0207652_10334601
414 Ga0207694_10092119
415 Ga0207687_10097072
416 Ga0207700_10518678
417 Ga0207664_10403943
418 Ga0207644_10483751
419 Ga0207690_10223422
420 Ga0207706_10008663
421 Ga0207686_10028283
422 Ga0207709_10043516
423 Ga0207709_10459494
424 Ga0207669_10097187
425 Ga0207665_10011204
426 Ga0207691_10214894
427 Ga0207711_10314438
428 Ga0207689_10257261
429 Ga0207661_10277163
430 Ga0207651_10429164
431 Ga0207668_10016958
432 Ga0207668_10091978
433 Ga0207640_10335763
434 Ga0207658_10082107
435 Ga0207677_10134762
436 Ga0207677_10209000
437 Ga0207703_10110553
438 Ga0207639_10484108
439 Ga0207678_10006275
440 Ga0207708_10086166
441 Ga0207708_11297986
442 Ga0207702_10251795
443 Ga0207702_10359980
444 Ga0207702_10832136
445 Ga0207641_10753561
446 Ga0207676_10176570
447 Ga0207674_10130690
448 Ga0207675_100040166
449 Ga0207683_10041396
450 Ga0268266_10164179
451 Ga0268265_10099975
452 Ga0268264_10046472
453 Ga0268264_10256193
454 Ga0307408_101116521
455 Ga0307518_10198991
456 Ga0307518_10435957
457 Ga0307416_100709923
458 Ga0307415_100009398
459 Ga0373950_0035913
460 Ga0373929_0007046
461 Ga0373940_0025824
462 Ga0373949_0027965
463 Ga0373932_0016189
464 Ga0373931_0025171
465 Ga0436364_0047855
466 Ga0436364_0142046
467 Ga0436364_0150636
468 Ga0436365_1811262
469 Ga0436362_0191358
470 Ga0436362_0304917
471 Ga0451789_0849923
472 Ga0451833_1197995
473 Ga0466969_0312630
474 Ga0466972_0432681
475 Ga0466965_0532536
476 Ga0466965_0893329
477 Ga0466966_0054443
478 Ga0466966_0071784
479 Ga0466966_0133016
480 Ga0466961_0033690
481 Ga0466961_0074367
482 Ga0466961_0263537
483 Ga0466961_0643065
484 Ga0466963_0064129
485 Ga0466963_0070538
486 Ga0466963_0075059
487 Ga0466963_0237848
488 Ga0466963_0652975
489 Ga0466963_0970790
490 Ga0466964_0376916
491 Ga0466971_0016447
492 Ga0466971_0106169
493 Ga0466968_0369699
494 Ga0466970_0075916
495 Ga0466970_0154453
496 Ga0466957_0051978
497 Ga0466957_0115872
498 Ga0466960_0063788
499 Ga0466960_0800821
500 Ga0466959_0042335
501 Ga0466959_0057828
502 Ga0466959_0074789
503 Ga0466959_0108864
504 Ga0466959_0112964
505 Ga0466959_0336477
506 Ga0466959_0369388
507 Ga0466958_0012788
508 Ga0466958_0121243
509 Ga0466958_0637316
510 Ga0466967_0097785
511 Ga0466967_0103419
512 Ga0466967_0333905
513 Ga0466967_0479130
514 Ga0466967_0627935
515 Ga0466967_1582110
516 Ga0495603_0002657
517 Ga0495638_0165645
518 Ga0495664_0059290
519 Ga0495585_0267254
520 Ga0495594_0250265
521 Ga0495618_0887911
522 Ga0495628_0524938
523 Ga0495645_0019504
524 Ga0495645_0463262
525 Ga0495661_0536964
526 Ga0495588_0286808
527 Ga0495588_0379801
528 Ga0495658_0302732
529 Ga0495670_0054467
530 Ga0495589_0022376
531 Ga0495636_0303439
532 Ga0495674_0038940
533 Ga0495674_0105984
534 Ga0495676_0091393
535 Ga0495685_013875
536 Ga0495614_0324035
537 Ga0496100_0207173
538 Ga0496100_0665897
539 Ga0496101_0046743
540 Ga0496101_0235923
541 Ga0496102_0054599
542 Ga0496104_0098400
543 Ga0496104_0921692
544 Ga0496105_0041507
545 Ga0496106_0766657
546 Ga0496106_0887369
547 Ga0496106_1000730
548 Ga0496107_0186743
549 Ga0496107_0313003
550 Ga0496108_0047393
551 Ga0496108_0059787
552 Ga0496109_0021639
553 Ga0496109_0041845
554 Ga0496110_0057033
555 Ga0496110_0360300
556 Ga0496110_0606928
557 Ga0496110_1627438
558 Ga0496111_0183077
559 Ga0496111_0614715
560 Ga0496112_0046918
561 Ga0496113_0583694
562 Ga0496113_0822613
563 Ga0496114_0136207
564 Ga0496115_0015030
565 Ga0496115_0471038
566 Ga0496115_0608383
567 Ga0496124_0482642
568 Ga0501031_0351887
569 Ga0501032_0751290
570 Ga0501033_0003590
571 Ga0501034_0358908
572 Ga0501036_0682032
573 Ga0501038_0022390
574 Ga0501046_0033338
575 Ga0501047_1380280
576 Ga0501070_0789364
577 Ga0501073_0458629
578 Ga0501074_0255166
579 Ga0501080_0817965
580 Ga0501035_0102940
581 Ga0501044_0092248
582 Ga0501044_0923062
583 nmdc:mga0yw44_32322_c1
584 nmdc:mga08y16_238400_c1
585 nmdc:mga0n895_105667_c1
586 nmdc:mga0rr50_230139_c1
587 nmdc:mga0a205_502096_c1
588 nmdc:mga0sz30_552736_c1
589 Ga0500561_0152131
590 Ga0501082_1567378
591 Ga0466962_0081791
592 Ga0466962_0322081
593 2558910679
594 2917739004

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04237

YjbR

YjbR

20

125

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6915 2 131
5vb0-assembly6.cif.gz_H crystal structure of fosfomycin resistance protein fosa3 0.687 2 32
3h9x-assembly1.cif.gz_A crystal structure of the pspto_3016 protein from pseudomonas syringae, northeast structural genomics consortium target psr293 0.6766 6 115
5vb0-assembly1.cif.gz_B crystal structure of fosfomycin resistance protein fosa3 0.6727 1 32
5vb0-assembly2.cif.gz_C crystal structure of fosfomycin resistance protein fosa3 0.6724 1 32
ID Description Score Start End Superfamily
af_D4A1L0_486_711_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8791 101 127 1.25.10.10
af_Q6A070_1241_1469_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8103 101 125 1.25.10.10
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.8085 1 122 3.30.70.1230
af_P9WL91_4_123_3.30.70.1230 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Nucleotide cyclase, GGDEF domain 0.7962 1 122 3.30.70.1230
af_Q9Y4F4_1232_1385_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.7683 101 131 1.25.10.10
ID Description Score Start End GO Terms
AF-A0A4Q7V072-F1-model_v4 YjbR protein 0.9733 1 131
AF-A0A1H3LY49-F1-model_v4 YjbR protein 0.9686 5 129
AF-A0A495QYV3-F1-model_v4 YjbR protein 0.9661 1 128
AF-A0A2X0IAQ3-F1-model_v4 MmcQ/YjbR family DNA-binding protein 0.966 2 131
AF-A0A4Q7V072-F1-model_v4 YjbR protein 0.966 1 131

Map