F393729

General Info

Members Datasets Scaffolds Average Seq Length
297 190 594 346

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10033121|Ga0207695_100331214
Length 408
Sequence VPVLPTTKGSIRMKLLSWRLARLSNRSYFSVLLCALCGQGLWFVRLLDHGRFKGTMSAPNSRFVRACRCEPVDVTPIWLMRQAGRYMAEYRAVRKKHSILEICKTPEIAADVTITAAEKLDVDAAIIFADLLLPLEVMGMPFRFEAGEGPVIERPLRAPKDIDALVTNRASELGYVAESVSRVAKHFGSKLPVIGFCGAPFTLASYMIEGGGSRNYIHTKKMMYTESAAWRMLMHKLVDVLAAYAAEQVTAGADALQIFDSWVGCLSVEDYRQYVLPFATDLVQRLRKTGVPIIYFGTDTATLLPSMKETGADVMGVDWRFPLDNAWSSLNFKGAVQGNLDPVLLFAGEKELRARTDAILRQAGGRPGHIFNLGHGILPETPVENVRALVDFVRELSTAYSAGAAQPK

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
125 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
129 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
133 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
134 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
142 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
143 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
144 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
169 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
174 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
175 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
176 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
190 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.64
Metatranscriptomes 2.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.4
Rhizosphere 93.6
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10033121 3300025913 Bacteria 5644
2 JGI24034J26672_10003703 3300002239 Bacteria 2137
3 Ga0070676_10007003 3300005328 Bacteria 6037
4 Ga0070683_100121051 3300005329 Bacteria 2472
5 Ga0070690_100011882 3300005330 Bacteria 5109
6 Ga0070690_100182540 3300005330 Bacteria 1450
7 Ga0070670_100227934 3300005331 Unclassified 1621
8 Ga0068868_100007884 3300005338 Bacteria 7606
9 Ga0068868_100014615 3300005338 Bacteria 5790
10 Ga0070689_100031021 3300005340 Bacteria 4060
11 Ga0070661_100017106 3300005344 Bacteria 5139
12 Ga0070668_100008696 3300005347 Bacteria 7542
13 Ga0070669_100010172 3300005353 Bacteria 6686
14 Ga0070675_100250358 3300005354 Unclassified 1550
15 Ga0070671_100321564 3300005355 Unclassified 1318
16 Ga0070673_100011629 3300005364 Bacteria 6012
17 Ga0070688_100003089 3300005365 Bacteria 8512
18 Ga0070667_100014467 3300005367 Bacteria 6518
19 Ga0070709_10001802 3300005434 Bacteria 11608
20 Ga0070714_100210358 3300005435 Bacteria 1782
21 Ga0070714_100284652 3300005435 Bacteria 1537
22 Ga0070713_100000461 3300005436 Bacteria 25984
23 Ga0070713_100009964 3300005436 Bacteria 6844
24 Ga0070713_100164589 3300005436 Bacteria 1982
25 Ga0070710_10004794 3300005437 Bacteria 6395
26 Ga0070711_100000076 3300005439 Bacteria 55974
27 Ga0070711_100011765 3300005439 Bacteria 5443
28 Ga0070711_100025528 3300005439 Unclassified 3867
29 Ga0070708_100050337 3300005445 Bacteria 3688
30 Ga0070708_100069477 3300005445 Bacteria 3167
31 Ga0070663_100028785 3300005455 Bacteria 3787
32 Ga0070662_100000466 3300005457 Bacteria 24045
33 Ga0068867_100029102 3300005459 Bacteria 3980
34 Ga0070706_100021298 3300005467 Bacteria 5971
35 Ga0070707_100036573 3300005468 Bacteria 4685
36 Ga0070698_100019470 3300005471 Bacteria 7125
37 Ga0070699_100049168 3300005518 Bacteria 3650
38 Ga0070699_100185031 3300005518 Bacteria 1850
39 Ga0070679_100087190 3300005530 Bacteria 3108
40 Ga0070684_100009205 3300005535 Bacteria 7771
41 Ga0070697_100000031 3300005536 Bacteria 110959
42 Ga0070697_100008687 3300005536 Bacteria 7934
43 Ga0070697_100103534 3300005536 Bacteria 2366
44 Ga0068853_100055241 3300005539 Bacteria 3422
45 Ga0070696_100020477 3300005546 Bacteria 4482
46 Ga0070665_100026896 3300005548 Bacteria 5794
47 Ga0068855_100020409 3300005563 Bacteria 7946
48 Ga0068855_100058749 3300005563 Bacteria 4502
49 Ga0068855_100108808 3300005563 Bacteria 3183
50 Ga0068857_100002800 3300005577 Bacteria 14339
51 Ga0068857_100192777 3300005577 Bacteria 1856
52 Ga0068854_100013960 3300005578 Bacteria 5284
53 Ga0068856_100003942 3300005614 Bacteria 14868
54 Ga0068856_100388391 3300005614 Bacteria 1415
55 Ga0068856_100433871 3300005614 Unclassified 1334
56 Ga0070702_100133449 3300005615 Unclassified 1571
57 Ga0068852_100022534 3300005616 Bacteria 5053
58 Ga0068852_100207634 3300005616 Unclassified 1856
59 Ga0068864_100011787 3300005618 Bacteria 7221
60 Ga0068851_10000381 3300005834 Bacteria 20058
61 Ga0068870_10002129 3300005840 Bacteria 8199
62 Ga0068863_100013297 3300005841 Bacteria 7941
63 Ga0068863_100116006 3300005841 Bacteria 2552
64 Ga0068862_100008755 3300005844 Bacteria 8379
65 Ga0068862_100290521 3300005844 Bacteria 1501
66 Ga0081455_10062947 3300005937 Bacteria 3115
67 Ga0070717_10004883 3300006028 Bacteria 9757
68 Ga0070717_10015319 3300006028 Bacteria 5920
69 Ga0070717_10078245 3300006028 Bacteria 2771
70 Ga0070716_100000064 3300006173 Bacteria 41396
71 Ga0070716_100132496 3300006173 Bacteria 1578
72 Ga0070712_100000859 3300006175 Bacteria 18112
73 Ga0070712_100004901 3300006175 Bacteria 8277
74 Ga0070712_100020581 3300006175 Bacteria 4319
75 Ga0070712_100028269 3300006175 Bacteria 3749
76 Ga0070712_100088173 3300006175 Bacteria 2266
77 Ga0068871_100171133 3300006358 Bacteria 1862
78 Ga0068865_100006031 3300006881 Bacteria 7383
79 Ga0075436_100010466 3300006914 Bacteria 6358
80 Ga0105240_10134209 3300009093 Bacteria 2965
81 Ga0105240_10210804 3300009093 Unclassified 2270
82 Ga0105240_10212315 3300009093 Bacteria 2260
83 Ga0105245_10027666 3300009098 Bacteria 4996
84 Ga0105247_10027995 3300009101 Bacteria 3408
85 Ga0105243_10105732 3300009148 Bacteria 2345
86 Ga0105241_10012222 3300009174 Bacteria 6299
87 Ga0105241_10124697 3300009174 Bacteria 2079
88 Ga0105242_10038303 3300009176 Unclassified 3855
89 Ga0105242_10278308 3300009176 Bacteria 1519
90 Ga0105248_10059811 3300009177 Bacteria 4280
91 Ga0105237_10082124 3300009545 Bacteria 3213
92 Ga0105238_10032031 3300009551 Bacteria 5350
93 Ga0105238_10079754 3300009551 Bacteria 3263
94 Ga0105238_10189814 3300009551 Bacteria 2031
95 Ga0105249_10004702 3300009553 Bacteria 11788
96 Ga0105239_10044220 3300010375 Unclassified 4883
97 Ga0105246_10003130 3300011119 Bacteria 10047
98 Ga0105246_10009539 3300011119 Bacteria 5981
99 Ga0157373_10006403 3300013100 Bacteria 8795
100 Ga0157373_10033859 3300013100 Bacteria 3671
101 Ga0157371_10046397 3300013102 Bacteria 3090
102 Ga0157371_10052829 3300013102 Bacteria 2886
103 Ga0157369_10013464 3300013105 Bacteria 9244
104 Ga0157369_10091164 3300013105 Bacteria 3254
105 Ga0157369_10302048 3300013105 Bacteria 1665
106 Ga0157369_10449561 3300013105 Bacteria 1334
107 Ga0157374_10018946 3300013296 Bacteria 6086
108 Ga0157374_10066777 3300013296 Bacteria 3380
109 Ga0157378_10148495 3300013297 Bacteria 2183
110 Ga0163162_10040343 3300013306 Bacteria 4668
111 Ga0157372_10003914 3300013307 Bacteria 15997
112 Ga0157372_10016049 3300013307 Bacteria 8034
113 Ga0157372_10223668 3300013307 Unclassified 2182
114 Ga0157372_10297069 3300013307 Bacteria 1879
115 Ga0157375_10012215 3300013308 Bacteria 7613
116 Ga0163163_10001728 3300014325 Bacteria 18415
117 Ga0163163_10050927 3300014325 Bacteria 4080
118 Ga0163163_10079992 3300014325 Bacteria 3267
119 Ga0157379_10050093 3300014968 Bacteria 3727
120 Ga0157376_10009816 3300014969 Bacteria 6977
121 Ga0157376_10229891 3300014969 Bacteria 1722
122 Ga0182006_1045227 3300015261 Bacteria 1714
123 Ga0182007_10010130 3300015262 Bacteria 3744
124 Ga0182007_10027924 3300015262 Bacteria 1942
125 Ga0163161_10004477 3300017792 Bacteria 9723
126 Ga0224569_101050 3300022732 Bacteria 2352
127 Ga0228598_1000718 3300024227 Bacteria 7076
128 Ga0207697_10011430 3300025315 Unclassified 3754
129 Ga0207682_10032096 3300025893 Bacteria 2110
130 Ga0207688_10031250 3300025901 Bacteria 2939
131 Ga0207647_10015958 3300025904 Bacteria 5134
132 Ga0207699_10004225 3300025906 Bacteria 6871
133 Ga0207699_10104447 3300025906 Bacteria 1804
134 Ga0207645_10002270 3300025907 Bacteria 15262
135 Ga0207643_10002013 3300025908 Bacteria 11213
136 Ga0207707_10022769 3300025912 Bacteria 5478
137 Ga0207695_10009591 3300025913 Bacteria 11957
138 Ga0207695_10076227 3300025913 Bacteria 3410
139 Ga0207693_10000016 3300025915 Bacteria 145892
140 Ga0207693_10000065 3300025915 Bacteria 91476
141 Ga0207693_10000146 3300025915 Bacteria 65068
142 Ga0207693_10008423 3300025915 Bacteria 8435
143 Ga0207693_10009966 3300025915 Bacteria 7726
144 Ga0207693_10030533 3300025915 Bacteria 4257
145 Ga0207663_10000272 3300025916 Bacteria 22428
146 Ga0207663_10001442 3300025916 Bacteria 11058
147 Ga0207663_10005986 3300025916 Bacteria 6183
148 Ga0207660_10209974 3300025917 Bacteria 1524
149 Ga0207662_10001839 3300025918 Bacteria 10428
150 Ga0207657_10000580 3300025919 Bacteria 38911
151 Ga0207657_10003607 3300025919 Bacteria 16492
152 Ga0207657_10009812 3300025919 Bacteria 9592
153 Ga0207649_10001070 3300025920 Bacteria 16713
154 Ga0207649_10082952 3300025920 Bacteria 2079
155 Ga0207652_10307792 3300025921 Bacteria 1430
156 Ga0207646_10152230 3300025922 Bacteria 2086
157 Ga0207646_10334759 3300025922 Bacteria 1367
158 Ga0207650_10000734 3300025925 Bacteria 25252
159 Ga0207687_10015512 3300025927 Bacteria 4996
160 Ga0207700_10000132 3300025928 Bacteria 44689
161 Ga0207700_10000709 3300025928 Bacteria 19278
162 Ga0207700_10035327 3300025928 Bacteria 3599
163 Ga0207664_10000440 3300025929 Bacteria 29677
164 Ga0207664_10138530 3300025929 Bacteria 2055
165 Ga0207644_10001210 3300025931 Bacteria 16612
166 Ga0207706_10001661 3300025933 Bacteria 21985
167 Ga0207706_10007708 3300025933 Bacteria 9939
168 Ga0207706_10025328 3300025933 Bacteria 5316
169 Ga0207686_10040737 3300025934 Bacteria 2827
170 Ga0207665_10000482 3300025939 Bacteria 27029
171 Ga0207691_10002484 3300025940 Bacteria 18043
172 Ga0207711_10011966 3300025941 Bacteria 7212
173 Ga0207711_10013680 3300025941 Bacteria 6738
174 Ga0207661_10000685 3300025944 Bacteria 21983
175 Ga0207661_10073202 3300025944 Bacteria 2805
176 Ga0207679_10000210 3300025945 Bacteria 46479
177 Ga0207667_10010594 3300025949 Bacteria 10769
178 Ga0207667_10038473 3300025949 Bacteria 5109
179 Ga0207651_10002830 3300025960 Bacteria 8353
180 Ga0207668_10033391 3300025972 Bacteria 3408
181 Ga0207658_10010046 3300025986 Bacteria 6430
182 Ga0207658_10010098 3300025986 Bacteria 6413
183 Ga0207677_10019141 3300026023 Bacteria 4128
184 Ga0207677_10050440 3300026023 Bacteria 2815
185 Ga0207639_10133153 3300026041 Bacteria 2061
186 Ga0207678_10002249 3300026067 Bacteria 17473
187 Ga0207678_10010545 3300026067 Bacteria 8116
188 Ga0207702_10385150 3300026078 Bacteria 1349
189 Ga0207641_10000127 3300026088 Bacteria 111663
190 Ga0207648_10001868 3300026089 Bacteria 23035
191 Ga0207648_10016369 3300026089 Bacteria 6776
192 Ga0207676_10000291 3300026095 Bacteria 43301
193 Ga0207674_10000183 3300026116 Bacteria 77186
194 Ga0207674_10219038 3300026116 Bacteria 1851
195 Ga0207675_100050637 3300026118 Bacteria 3875
196 Ga0207698_10010663 3300026142 Bacteria 5923
197 Ga0265354_1003291 3300028016 Bacteria 1827
198 Ga0265356_1000089 3300028017 Bacteria 15437
199 Ga0268266_10004859 3300028379 Bacteria 12750
200 Ga0268265_10004572 3300028380 Bacteria 9568
201 Ga0265338_10034003 3300028800 Bacteria 4936
202 Ga0265338_10104658 3300028800 Bacteria 2296
203 Ga0265338_10114332 3300028800 Bacteria 2166
204 Ga0265762_1001955 3300030760 Bacteria 3745
205 Ga0265762_1003292 3300030760 Bacteria 2888
206 Ga0265762_1003323 3300030760 Bacteria 2876
207 Ga0265770_1001329 3300030878 Bacteria 3411
208 Ga0265760_10000373 3300031090 Bacteria 12504
209 Ga0265760_10000657 3300031090 Bacteria 9832
210 Ga0265760_10023876 3300031090 Bacteria 1778
211 Ga0265330_10006489 3300031235 Bacteria 5786
212 Ga0265325_10055897 3300031241 Bacteria 2017
213 Ga0265340_10033867 3300031247 Bacteria 2542
214 Ga0265316_10115096 3300031344 Bacteria 2033
215 Ga0307408_100267611 3300031548 Bacteria 1417
216 Ga0265314_10008462 3300031711 Bacteria 8807
217 Ga0265314_10014419 3300031711 Bacteria 6324
218 Ga0307405_10076910 3300031731 Bacteria 2167
219 Ga0307407_10062047 3300031903 Bacteria 2188
220 Ga0307409_100098710 3300031995 Bacteria 2416
221 Ga0373930_0013218 3300034816 Bacteria 1519
222 Ga0373944_0053342 3300035089 Unclassified 1279
223 Ga0373936_0005702 3300035113 Bacteria 4698
224 Ga0373945_0000900 3300035116 Bacteria 8807
225 Ga0373943_0002123 3300035170 Bacteria 9009
226 Ga0373943_0076946 3300035170 Bacteria 1703
227 Ga0373955_0005032 3300035172 Bacteria 5910
228 Ga0373924_0000025 3300035410 Bacteria 38407
229 Ga0373924_0024150 3300035410 Bacteria 2393
230 Ga0373935_0057042 3300035692 Unclassified 2491
231 Ga0373927_0014678 3300035695 Bacteria 5179
232 Ga0373927_0022402 3300035695 Bacteria 4139
233 Ga0373947_0023370 3300035725 Unclassified 3594
234 Ga0373947_0042452 3300035725 Bacteria 2714
235 Ga0373947_0062063 3300035725 Bacteria 2273
236 Ga0373937_0000391 3300036401 Bacteria 40824
237 Ga0373937_0014340 3300036401 Bacteria 6996
238 Ga0373937_0016213 3300036401 Bacteria 6611
239 Ga0373937_0321591 3300036401 Bacteria 1464
240 Ga0373925_0003937 3300037068 Bacteria 11335
241 Ga0373925_0021390 3300037068 Bacteria 4713
242 Ga0373925_0084721 3300037068 Unclassified 2415
243 Ga0395898_0045092 3300037466 Bacteria 4335
244 Ga0395905_0019564 3300037471 Bacteria 6417
245 Ga0395905_0063162 3300037471 Bacteria 3464
246 Ga0395905_0519048 3300037471 Bacteria 1092
247 Ga0436362_1231382 3300039453 Bacteria 4467
248 Ga0451577_0000054 3300042876 Bacteria 278798
249 Ga0466963_0000072 3300044694 Bacteria 35309
250 Ga0466963_0101700 3300044694 Bacteria 1968
251 Ga0453684_0000366 3300044712 Bacteria 186117
252 Ga0451576_0002744 3300045051 Bacteria 25540
253 Ga0466967_0075741 3300045976 Bacteria 3025
254 Ga0466967_0293181 3300045976 Bacteria 1563
255 Ga0495629_0006597 3300046459 Bacteria 8594
256 Ga0495651_0019940 3300046462 Bacteria 5201
257 Ga0495580_0000866 3300046472 Bacteria 26106
258 Ga0495580_0001038 3300046472 Bacteria 24392
259 Ga0495580_0030212 3300046472 Bacteria 3925
260 Ga0495580_0103239 3300046472 Bacteria 1982
261 Ga0495605_0058812 3300046474 Bacteria 1847
262 Ga0495594_0016456 3300046499 Bacteria 3896
263 Ga0495628_0023891 3300046516 Bacteria 5012
264 Ga0495630_0002961 3300046517 Bacteria 11793
265 Ga0495642_0070117 3300046528 Bacteria 1465
266 Ga0495656_0028090 3300046615 Bacteria 2254
267 Ga0495657_0066312 3300046675 Bacteria 2372
268 Ga0495623_0120970 3300046679 Bacteria 1576
269 Ga0495646_0111439 3300046680 Unclassified 1558
270 Ga0495658_0076856 3300046683 Bacteria 1952
271 Ga0495669_0031337 3300046684 Bacteria 2335
272 Ga0495604_0020441 3300047317 Bacteria 5288
273 Ga0495674_0137877 3300047319 Bacteria 2052
274 Ga0495675_0002850 3300047444 Bacteria 10366
275 Ga0496100_0074057 3300048903 Bacteria 2281
276 Ga0496102_0316206 3300048905 Unclassified 1471
277 Ga0496104_0040419 3300048907 Bacteria 4371
278 Ga0496104_0106549 3300048907 Unclassified 2686
279 Ga0496108_0000092 3300048911 Bacteria 95002
280 Ga0496108_0045638 3300048911 Bacteria 3660
281 Ga0496108_0184006 3300048911 Bacteria 1810
282 Ga0496109_0000734 3300048912 Bacteria 27302
283 Ga0496109_0089056 3300048912 Bacteria 2853
284 Ga0496110_0048910 3300048913 Bacteria 3708
285 Ga0496111_0019146 3300048914 Bacteria 4750
286 Ga0496111_0233720 3300048914 Bacteria 1365
287 Ga0496112_0000072 3300048915 Bacteria 66241
288 Ga0496112_0011083 3300048915 Bacteria 8216
289 Ga0496112_0248945 3300048915 Bacteria 1729
290 Ga0496113_0000690 3300048916 Bacteria 17220
291 Ga0496113_0151409 3300048916 Bacteria 1830
292 Ga0496113_0212144 3300048916 Unclassified 1541
293 Ga0496113_0357712 3300048916 Bacteria 1171
294 Ga0501225_0014687 3300049705 Bacteria 2185
295 Ga0495601_0004767 3300053077 Bacteria 7867
296 Ga0495619_0100235 3300053085 Unclassified 1971
297 Ga0501084_0095163 3300054114 Bacteria 2501
298 Ga0207695_10033121
299 JGI24034J26672_10003703
300 Ga0070676_10007003
301 Ga0070683_100121051
302 Ga0070690_100011882
303 Ga0070690_100182540
304 Ga0070670_100227934
305 Ga0068868_100007884
306 Ga0068868_100014615
307 Ga0070689_100031021
308 Ga0070661_100017106
309 Ga0070668_100008696
310 Ga0070669_100010172
311 Ga0070675_100250358
312 Ga0070671_100321564
313 Ga0070673_100011629
314 Ga0070688_100003089
315 Ga0070667_100014467
316 Ga0070709_10001802
317 Ga0070714_100210358
318 Ga0070714_100284652
319 Ga0070713_100000461
320 Ga0070713_100009964
321 Ga0070713_100164589
322 Ga0070710_10004794
323 Ga0070711_100000076
324 Ga0070711_100011765
325 Ga0070711_100025528
326 Ga0070708_100050337
327 Ga0070708_100069477
328 Ga0070663_100028785
329 Ga0070662_100000466
330 Ga0068867_100029102
331 Ga0070706_100021298
332 Ga0070707_100036573
333 Ga0070698_100019470
334 Ga0070699_100049168
335 Ga0070699_100185031
336 Ga0070679_100087190
337 Ga0070684_100009205
338 Ga0070697_100000031
339 Ga0070697_100008687
340 Ga0070697_100103534
341 Ga0068853_100055241
342 Ga0070696_100020477
343 Ga0070665_100026896
344 Ga0068855_100020409
345 Ga0068855_100058749
346 Ga0068855_100108808
347 Ga0068857_100002800
348 Ga0068857_100192777
349 Ga0068854_100013960
350 Ga0068856_100003942
351 Ga0068856_100388391
352 Ga0068856_100433871
353 Ga0070702_100133449
354 Ga0068852_100022534
355 Ga0068852_100207634
356 Ga0068864_100011787
357 Ga0068851_10000381
358 Ga0068870_10002129
359 Ga0068863_100013297
360 Ga0068863_100116006
361 Ga0068862_100008755
362 Ga0068862_100290521
363 Ga0081455_10062947
364 Ga0070717_10004883
365 Ga0070717_10015319
366 Ga0070717_10078245
367 Ga0070716_100000064
368 Ga0070716_100132496
369 Ga0070712_100000859
370 Ga0070712_100004901
371 Ga0070712_100020581
372 Ga0070712_100028269
373 Ga0070712_100088173
374 Ga0068871_100171133
375 Ga0068865_100006031
376 Ga0075436_100010466
377 Ga0105240_10134209
378 Ga0105240_10210804
379 Ga0105240_10212315
380 Ga0105245_10027666
381 Ga0105247_10027995
382 Ga0105243_10105732
383 Ga0105241_10012222
384 Ga0105241_10124697
385 Ga0105242_10038303
386 Ga0105242_10278308
387 Ga0105248_10059811
388 Ga0105237_10082124
389 Ga0105238_10032031
390 Ga0105238_10079754
391 Ga0105238_10189814
392 Ga0105249_10004702
393 Ga0105239_10044220
394 Ga0105246_10003130
395 Ga0105246_10009539
396 Ga0157373_10006403
397 Ga0157373_10033859
398 Ga0157371_10046397
399 Ga0157371_10052829
400 Ga0157369_10013464
401 Ga0157369_10091164
402 Ga0157369_10302048
403 Ga0157369_10449561
404 Ga0157374_10018946
405 Ga0157374_10066777
406 Ga0157378_10148495
407 Ga0163162_10040343
408 Ga0157372_10003914
409 Ga0157372_10016049
410 Ga0157372_10223668
411 Ga0157372_10297069
412 Ga0157375_10012215
413 Ga0163163_10001728
414 Ga0163163_10050927
415 Ga0163163_10079992
416 Ga0157379_10050093
417 Ga0157376_10009816
418 Ga0157376_10229891
419 Ga0182006_1045227
420 Ga0182007_10010130
421 Ga0182007_10027924
422 Ga0163161_10004477
423 Ga0224569_101050
424 Ga0228598_1000718
425 Ga0207697_10011430
426 Ga0207682_10032096
427 Ga0207688_10031250
428 Ga0207647_10015958
429 Ga0207699_10004225
430 Ga0207699_10104447
431 Ga0207645_10002270
432 Ga0207643_10002013
433 Ga0207707_10022769
434 Ga0207695_10009591
435 Ga0207695_10076227
436 Ga0207693_10000016
437 Ga0207693_10000065
438 Ga0207693_10000146
439 Ga0207693_10008423
440 Ga0207693_10009966
441 Ga0207693_10030533
442 Ga0207663_10000272
443 Ga0207663_10001442
444 Ga0207663_10005986
445 Ga0207660_10209974
446 Ga0207662_10001839
447 Ga0207657_10000580
448 Ga0207657_10003607
449 Ga0207657_10009812
450 Ga0207649_10001070
451 Ga0207649_10082952
452 Ga0207652_10307792
453 Ga0207646_10152230
454 Ga0207646_10334759
455 Ga0207650_10000734
456 Ga0207687_10015512
457 Ga0207700_10000132
458 Ga0207700_10000709
459 Ga0207700_10035327
460 Ga0207664_10000440
461 Ga0207664_10138530
462 Ga0207644_10001210
463 Ga0207706_10001661
464 Ga0207706_10007708
465 Ga0207706_10025328
466 Ga0207686_10040737
467 Ga0207665_10000482
468 Ga0207691_10002484
469 Ga0207711_10011966
470 Ga0207711_10013680
471 Ga0207661_10000685
472 Ga0207661_10073202
473 Ga0207679_10000210
474 Ga0207667_10010594
475 Ga0207667_10038473
476 Ga0207651_10002830
477 Ga0207668_10033391
478 Ga0207658_10010046
479 Ga0207658_10010098
480 Ga0207677_10019141
481 Ga0207677_10050440
482 Ga0207639_10133153
483 Ga0207678_10002249
484 Ga0207678_10010545
485 Ga0207702_10385150
486 Ga0207641_10000127
487 Ga0207648_10001868
488 Ga0207648_10016369
489 Ga0207676_10000291
490 Ga0207674_10000183
491 Ga0207674_10219038
492 Ga0207675_100050637
493 Ga0207698_10010663
494 Ga0265354_1003291
495 Ga0265356_1000089
496 Ga0268266_10004859
497 Ga0268265_10004572
498 Ga0265338_10034003
499 Ga0265338_10104658
500 Ga0265338_10114332
501 Ga0265762_1001955
502 Ga0265762_1003292
503 Ga0265762_1003323
504 Ga0265770_1001329
505 Ga0265760_10000373
506 Ga0265760_10000657
507 Ga0265760_10023876
508 Ga0265330_10006489
509 Ga0265325_10055897
510 Ga0265340_10033867
511 Ga0265316_10115096
512 Ga0307408_100267611
513 Ga0265314_10008462
514 Ga0265314_10014419
515 Ga0307405_10076910
516 Ga0307407_10062047
517 Ga0307409_100098710
518 Ga0373930_0013218
519 Ga0373944_0053342
520 Ga0373936_0005702
521 Ga0373945_0000900
522 Ga0373943_0002123
523 Ga0373943_0076946
524 Ga0373955_0005032
525 Ga0373924_0000025
526 Ga0373924_0024150
527 Ga0373935_0057042
528 Ga0373927_0014678
529 Ga0373927_0022402
530 Ga0373947_0023370
531 Ga0373947_0042452
532 Ga0373947_0062063
533 Ga0373937_0000391
534 Ga0373937_0014340
535 Ga0373937_0016213
536 Ga0373937_0321591
537 Ga0373925_0003937
538 Ga0373925_0021390
539 Ga0373925_0084721
540 Ga0395898_0045092
541 Ga0395905_0019564
542 Ga0395905_0063162
543 Ga0395905_0519048
544 Ga0436362_1231382
545 Ga0451577_0000054
546 Ga0466963_0000072
547 Ga0466963_0101700
548 Ga0453684_0000366
549 Ga0451576_0002744
550 Ga0466967_0075741
551 Ga0466967_0293181
552 Ga0495629_0006597
553 Ga0495651_0019940
554 Ga0495580_0000866
555 Ga0495580_0001038
556 Ga0495580_0030212
557 Ga0495580_0103239
558 Ga0495605_0058812
559 Ga0495594_0016456
560 Ga0495628_0023891
561 Ga0495630_0002961
562 Ga0495642_0070117
563 Ga0495656_0028090
564 Ga0495657_0066312
565 Ga0495623_0120970
566 Ga0495646_0111439
567 Ga0495658_0076856
568 Ga0495669_0031337
569 Ga0495604_0020441
570 Ga0495674_0137877
571 Ga0495675_0002850
572 Ga0496100_0074057
573 Ga0496102_0316206
574 Ga0496104_0040419
575 Ga0496104_0106549
576 Ga0496108_0000092
577 Ga0496108_0045638
578 Ga0496108_0184006
579 Ga0496109_0000734
580 Ga0496109_0089056
581 Ga0496110_0048910
582 Ga0496111_0019146
583 Ga0496111_0233720
584 Ga0496112_0000072
585 Ga0496112_0011083
586 Ga0496112_0248945
587 Ga0496113_0000690
588 Ga0496113_0151409
589 Ga0496113_0212144
590 Ga0496113_0357712
591 Ga0501225_0014687
592 Ga0495601_0004767
593 Ga0495619_0100235
594 Ga0501084_0095163

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01208

URO-D

Uroporphyrinogen decarboxylase (URO-D)

58

396

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cyv-assembly1.cif.gz_A-2 crystal structure of uroporphyrinogen decarboxylase from shigella flexineri: new insights into its catalytic mechanism 0.968 7 345
1r3s-assembly1.cif.gz_A uroporphyrinogen decarboxylase single mutant d86g in complex with coproporphyrinogen-i 0.9668 3 345
1r3w-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase y164f mutant in complex with coproporphyrinogen-iii 0.9663 3 345
1r3r-assembly1.cif.gz_A-2 uroporphyrinogen decarboxylase with mutation d86n 0.9655 3 345
1r3q-assembly1.cif.gz_A uroporphyrinogen decarboxylase in complex with coproporphyrinogen-i 0.9654 3 345
ID Description Score Start End Superfamily
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9668 3 345 3.20.20.210
af_C6TEE8_35_387_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9649 1 337 3.20.20.210
1r3sA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9585 3 345 3.20.20.210
af_P9WFE1_2_357_3.20.20.210 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.9572 1 336 3.20.20.210
2infD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel; 0.954 7 345 3.20.20.210
ID Description Score Start End GO Terms
AF-A0A2Z5G1J4-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.9946 7 342 GO:0004853
GO:0005829
GO:0006782
AF-A0A7G8C0U2-F1-model_v4 Uroporphyrinogen decarboxylase (UPD) (URO-D) (EC 4.1.1.37) 0.992 6 338 GO:0004853
GO:0005829
GO:0006782
AF-A0A7V8NPP9-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 0.9884 6 307 GO:0004853
GO:0005829
GO:0006782
AF-A0A539EG55-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 0.9851 7 313 GO:0004853
GO:0005829
GO:0006782
AF-A0A6L3F8G3-F1-model_v4 Uroporphyrinogen decarboxylase (EC 4.1.1.37) 0.9839 49 340 GO:0004853
GO:0005829
GO:0006782

Map