F393679

General Info

Members Datasets Scaffolds Average Seq Length
297 182 297 147

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10896083|Ga0114129_108960832
Length 160
Sequence MSSNSGRPTSPRLTLRADHAAGFFFIALGVLVFALSGDLPFGTISSPGAGMMPKLMAGLMIAFAVAIFAVGHASQRLAEIDWSDRWHALLVVLITAAGVYAYQPLGFLITMTMLVFTLLVVVERRNVLIAAAYSIGLTLFAYWLFGKALKAPLETGILGF

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
116 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
117 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
118 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
127 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
128 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
136 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
137 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
156 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
162 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
163 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
165 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
177 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
178 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
179 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.37
Nodule 0
Rhizoplane 1.68
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10020108 3300003203 Bacteria 2707
2 Ga0065712_10017096 3300005290 Bacteria 3275
3 Ga0065715_10006681 3300005293 Bacteria 2834
4 Ga0070676_10216892 3300005328 Bacteria 1262
5 Ga0070690_100057582 3300005330 Bacteria 2495
6 Ga0070670_100896337 3300005331 Bacteria 804
7 Ga0070677_10010758 3300005333 Bacteria 3138
8 Ga0068868_100524102 3300005338 Bacteria 1041
9 Ga0070689_100015650 3300005340 Bacteria 5536
10 Ga0070689_100026664 3300005340 Bacteria 4352
11 Ga0070687_100005120 3300005343 Bacteria 5284
12 Ga0070687_100442921 3300005343 Bacteria 862
13 Ga0070668_100129678 3300005347 Bacteria 2023
14 Ga0070668_100416320 3300005347 Bacteria 1150
15 Ga0070669_100523802 3300005353 Bacteria 986
16 Ga0070669_101537944 3300005353 Bacteria 579
17 Ga0070675_100095985 3300005354 Bacteria 2490
18 Ga0070675_100279502 3300005354 Bacteria 1467
19 Ga0070675_100500764 3300005354 Bacteria 1095
20 Ga0070675_100991755 3300005354 Bacteria 771
21 Ga0070671_100076376 3300005355 Bacteria 2799
22 Ga0070671_100707932 3300005355 Bacteria 874
23 Ga0070674_100004009 3300005356 Bacteria 8344
24 Ga0070673_101532990 3300005364 Archaea 629
25 Ga0070673_101985457 3300005364 Bacteria 552
26 Ga0070688_100055263 3300005365 Bacteria 2489
27 Ga0070688_100119987 3300005365 Bacteria 1760
28 Ga0070688_100423713 3300005365 Bacteria 990
29 Ga0070659_100523207 3300005366 Bacteria 1013
30 Ga0070659_102114226 3300005366 Unclassified 506
31 Ga0070667_100093565 3300005367 Bacteria 2588
32 Ga0070703_10188751 3300005406 Bacteria 801
33 Ga0070701_10426726 3300005438 Bacteria 846
34 Ga0070705_100311888 3300005440 Bacteria 1132
35 Ga0070700_100123821 3300005441 Bacteria 1736
36 Ga0070700_100470459 3300005441 Bacteria 961
37 Ga0070694_100094781 3300005444 Bacteria 2101
38 Ga0070694_100166547 3300005444 Bacteria 1621
39 Ga0070694_100513542 3300005444 Bacteria 955
40 Ga0070694_101487734 3300005444 Bacteria 573
41 Ga0070678_100006186 3300005456 Bacteria 6997
42 Ga0070662_100808229 3300005457 Unclassified 797
43 Ga0068867_100036253 3300005459 Bacteria 3579
44 Ga0070685_10333041 3300005466 Bacteria 1033
45 Ga0070707_100846116 3300005468 Bacteria 879
46 Ga0070699_100537239 3300005518 Bacteria 1064
47 Ga0070697_100357623 3300005536 Bacteria 1262
48 Ga0070672_100041766 3300005543 Bacteria 3528
49 Ga0070672_100456030 3300005543 Bacteria 1102
50 Ga0070686_100025562 3300005544 Bacteria 3554
51 Ga0070686_100444889 3300005544 Bacteria 995
52 Ga0070695_100112207 3300005545 Bacteria 1852
53 Ga0070696_100005660 3300005546 Bacteria 8352
54 Ga0070696_100685289 3300005546 Unclassified 834
55 Ga0070696_100910770 3300005546 Bacteria 730
56 Ga0070665_100132646 3300005548 Bacteria 2493
57 Ga0070665_100594019 3300005548 Bacteria 1120
58 Ga0070665_101900501 3300005548 Bacteria 601
59 Ga0070704_100168149 3300005549 Bacteria 1741
60 Ga0070664_100411830 3300005564 Bacteria 1237
61 Ga0068857_100074295 3300005577 Bacteria 3029
62 Ga0068859_100037800 3300005617 Bacteria 4844
63 Ga0068864_100067263 3300005618 Bacteria 3111
64 Ga0068861_100424130 3300005719 Bacteria 1186
65 Ga0068861_101025705 3300005719 Bacteria 789
66 Ga0068861_101288799 3300005719 Bacteria 710
67 Ga0068870_10185683 3300005840 Bacteria 1251
68 Ga0068870_10548978 3300005840 Bacteria 778
69 Ga0068858_100303727 3300005842 Bacteria 1523
70 Ga0068858_102202393 3300005842 Unclassified 545
71 Ga0068860_100458780 3300005843 Bacteria 1268
72 Ga0081455_10159616 3300005937 Bacteria 1730
73 Ga0081538_10001357 3300005981 Bacteria 25199
74 Ga0081538_10055145 3300005981 Bacteria 2343
75 Ga0081540_1114241 3300005983 Bacteria 1134
76 Ga0081539_10005746 3300005985 Bacteria 12400
77 Ga0075365_10487433 3300006038 Bacteria 871
78 Ga0075364_10025214 3300006051 Bacteria 3783
79 Ga0075367_10067335 3300006178 Bacteria 2147
80 Ga0075366_10024095 3300006195 Bacteria 3549
81 Ga0097621_100974736 3300006237 Unclassified 792
82 Ga0068871_100180723 3300006358 Bacteria 1813
83 Ga0075428_100003301 3300006844 Bacteria 17653
84 Ga0075428_100075729 3300006844 Bacteria 3674
85 Ga0075428_100163364 3300006844 Bacteria 2416
86 Ga0075428_101064990 3300006844 Bacteria 855
87 Ga0075428_101142167 3300006844 Bacteria 822
88 Ga0075430_100001032 3300006846 Bacteria 22005
89 Ga0075430_100039271 3300006846 Bacteria 4008
90 Ga0075430_100186892 3300006846 Bacteria 1723
91 Ga0075430_100397893 3300006846 Bacteria 1137
92 Ga0075431_100000047 3300006847 Bacteria 64846
93 Ga0075431_100231654 3300006847 Bacteria 1882
94 Ga0075431_100309654 3300006847 Bacteria 1594
95 Ga0075434_100490460 3300006871 Bacteria 1249
96 Ga0075434_100719560 3300006871 Bacteria 1015
97 Ga0075429_100032507 3300006880 Bacteria 4535
98 Ga0075429_100095396 3300006880 Bacteria 2594
99 Ga0075429_100331037 3300006880 Bacteria 1333
100 Ga0075436_100555622 3300006914 Bacteria 843
101 Ga0097620_100037803 3300006931 Bacteria 4844
102 Ga0075435_100297303 3300007076 Bacteria 1380
103 Ga0111539_10000271 3300009094 Bacteria 61942
104 Ga0111539_10489314 3300009094 Bacteria 1433
105 Ga0111539_13449585 3300009094 Unclassified 508
106 Ga0105245_10113090 3300009098 Bacteria 2528
107 Ga0105245_10627221 3300009098 Bacteria 1104
108 Ga0105245_10680680 3300009098 Bacteria 1061
109 Ga0105247_10031563 3300009101 Bacteria 3215
110 Ga0105247_10202393 3300009101 Bacteria 1335
111 Ga0105247_10374048 3300009101 Bacteria 1008
112 Ga0114129_10001108 3300009147 Bacteria 35473
113 Ga0114129_10189548 3300009147 Bacteria 2793
114 Ga0114129_10707170 3300009147 Bacteria 1294
115 Ga0114129_10896083 3300009147 Bacteria 1124
116 Ga0114129_11012725 3300009147 Bacteria 1045
117 Ga0105243_10082626 3300009148 Bacteria 2626
118 Ga0105243_10084038 3300009148 Bacteria 2606
119 Ga0105243_10383613 3300009148 Bacteria 1300
120 Ga0105243_10674463 3300009148 Bacteria 1004
121 Ga0105243_11057078 3300009148 Bacteria 818
122 Ga0105242_12656062 3300009176 Unclassified 550
123 Ga0105248_10477172 3300009177 Bacteria 1406
124 Ga0105248_11444934 3300009177 Bacteria 778
125 Ga0105238_10148932 3300009551 Bacteria 2316
126 Ga0105249_11600857 3300009553 Unclassified 724
127 Ga0157378_10555996 3300013297 Bacteria 1153
128 Ga0157378_10946593 3300013297 Bacteria 894
129 Ga0157378_10989904 3300013297 Bacteria 875
130 Ga0157378_11039720 3300013297 Bacteria 854
131 Ga0157378_11199612 3300013297 Bacteria 798
132 Ga0163162_11042785 3300013306 Bacteria 925
133 Ga0157375_10579549 3300013308 Bacteria 1282
134 Ga0163163_10298307 3300014325 Bacteria 1664
135 Ga0163163_10930014 3300014325 Bacteria 933
136 Ga0163163_12799472 3300014325 Unclassified 544
137 Ga0157380_10164230 3300014326 Bacteria 1933
138 Ga0157380_10224418 3300014326 Bacteria 1683
139 Ga0157380_10636402 3300014326 Bacteria 1061
140 Ga0157379_10873237 3300014968 Bacteria 852
141 Ga0157376_10035414 3300014969 Bacteria 4038
142 Ga0163161_10828829 3300017792 Unclassified 779
143 Ga0207682_10001862 3300025893 Bacteria 9601
144 Ga0207680_10126646 3300025903 Bacteria 1677
145 Ga0207645_10762957 3300025907 Bacteria 658
146 Ga0207662_10047357 3300025918 Bacteria 2546
147 Ga0207662_10323906 3300025918 Bacteria 1029
148 Ga0207681_10124465 3300025923 Bacteria 1896
149 Ga0207650_10184514 3300025925 Unclassified 1664
150 Ga0207650_10298974 3300025925 Bacteria 1314
151 Ga0207650_10830602 3300025925 Bacteria 783
152 Ga0207687_10275643 3300025927 Bacteria 1346
153 Ga0207644_10091013 3300025931 Bacteria 2274
154 Ga0207644_10194960 3300025931 Bacteria 1595
155 Ga0207690_10584626 3300025932 Bacteria 910
156 Ga0207706_10281841 3300025933 Bacteria 1449
157 Ga0207706_10511113 3300025933 Bacteria 1036
158 Ga0207709_10043281 3300025935 Bacteria 2713
159 Ga0207709_10185022 3300025935 Bacteria 1474
160 Ga0207709_10520857 3300025935 Bacteria 931
161 Ga0207709_10535925 3300025935 Bacteria 919
162 Ga0207670_10073954 3300025936 Bacteria 2364
163 Ga0207670_10140887 3300025936 Bacteria 1778
164 Ga0207670_10213912 3300025936 Bacteria 1472
165 Ga0207669_10006880 3300025937 Bacteria 5229
166 Ga0207704_10895603 3300025938 Bacteria 746
167 Ga0207691_10026435 3300025940 Bacteria 5445
168 Ga0207689_10047667 3300025942 Bacteria 3536
169 Ga0207689_10583415 3300025942 Bacteria 940
170 Ga0207651_10017144 3300025960 Bacteria 4269
171 Ga0207668_11205705 3300025972 Bacteria 680
172 Ga0207658_11414286 3300025986 Bacteria 636
173 Ga0207677_12196516 3300026023 Bacteria 513
174 Ga0207703_10172274 3300026035 Bacteria 1905
175 Ga0207703_11620255 3300026035 Bacteria 623
176 Ga0207708_10238098 3300026075 Bacteria 1463
177 Ga0207708_10502169 3300026075 Bacteria 1017
178 Ga0207641_10903095 3300026088 Bacteria 877
179 Ga0207648_10033372 3300026089 Bacteria 4540
180 Ga0207674_10046171 3300026116 Bacteria 4474
181 Ga0207674_11865884 3300026116 Bacteria 567
182 Ga0207675_101301313 3300026118 Bacteria 747
183 Ga0207675_101350121 3300026118 Unclassified 733
184 Ga0207683_10006914 3300026121 Bacteria 9712
185 Ga0207428_10020184 3300027907 Bacteria 5665
186 Ga0207428_10731683 3300027907 Bacteria 706
187 Ga0268266_10194526 3300028379 Bacteria 1853
188 Ga0268266_10998815 3300028379 Bacteria 810
189 Ga0268265_10973519 3300028380 Unclassified 837
190 Ga0268264_11557706 3300028381 Bacteria 671
191 Ga0307408_100119306 3300031548 Bacteria 2041
192 Ga0373934_0001856 3300035086 Bacteria 7752
193 Ga0373936_0248290 3300035113 Unclassified 794
194 Ga0373953_0068121 3300035117 Bacteria 1464
195 Ga0373954_0068908 3300035118 Bacteria 1679
196 Ga0373956_0000024 3300035119 Bacteria 47805
197 Ga0373957_0005740 3300035120 Bacteria 3867
198 Ga0373955_0027107 3300035172 Bacteria 2958
199 Ga0373931_0544616 3300035691 Bacteria 753
200 Ga0373935_0221678 3300035692 Bacteria 1314
201 Ga0373933_0000994 3300035724 Bacteria 17321
202 Ga0373937_0001950 3300036401 Bacteria 17278
203 Ga0439453_0007323 3300041408 Bacteria 1747
204 Ga0451807_2444360 3300041486 Unclassified 741
205 Ga0439446_0095272 3300042156 Bacteria 936
206 Ga0439434_0038058 3300042435 Bacteria 1474
207 Ga0439435_0036503 3300042436 Bacteria 1358
208 Ga0439464_0196887 3300042439 Bacteria 642
209 Ga0439460_0015640 3300042461 Bacteria 2011
210 Ga0439440_0183265 3300042993 Bacteria 614
211 Ga0495651_0002702 3300046462 Bacteria 13766
212 Ga0495584_0039594 3300046491 Bacteria 2381
213 Ga0495607_0135804 3300046501 Bacteria 1274
214 Ga0495598_0011831 3300046537 Bacteria 2125
215 Ga0495621_0006357 3300046539 Bacteria 3444
216 Ga0495633_0093927 3300046558 Bacteria 1394
217 Ga0495656_0020190 3300046615 Bacteria 2582
218 Ga0495659_0500925 3300046664 Bacteria 532
219 Ga0495623_0267266 3300046679 Bacteria 956
220 Ga0495670_0109492 3300046691 Bacteria 1428
221 Ga0495680_0096686 3300047322 Bacteria 2205
222 Ga0495685_022189 3300047447 Bacteria 2185
223 Ga0495602_0418365 3300048088 Bacteria 952
224 Ga0495615_0000954 3300048090 Bacteria 4104
225 Ga0496100_1366324 3300048903 Unclassified 559
226 Ga0496102_0359984 3300048905 Bacteria 1370
227 Ga0496110_1059214 3300048913 Bacteria 719
228 Ga0496112_1224156 3300048915 Bacteria 667
229 Ga0501033_0853098 3300049570 Bacteria 614
230 Ga0501036_1154750 3300049572 Bacteria 632
231 Ga0501039_0640647 3300049575 Bacteria 832
232 Ga0501041_0663393 3300049577 Bacteria 667
233 Ga0501041_0782647 3300049577 Unclassified 611
234 Ga0501042_0135464 3300049578 Bacteria 1776
235 Ga0501072_0275992 3300049588 Bacteria 1337
236 Ga0501072_0303997 3300049588 Bacteria 1268
237 Ga0501072_0335795 3300049588 Bacteria 1200
238 Ga0501072_0806558 3300049588 Unclassified 735
239 Ga0501073_0324206 3300049589 Bacteria 1063
240 Ga0501075_1235973 3300049591 Bacteria 566
241 Ga0501076_0106152 3300049592 Bacteria 2267
242 Ga0501076_0161032 3300049592 Bacteria 1828
243 Ga0501076_0301256 3300049592 Bacteria 1314
244 Ga0501076_0378356 3300049592 Bacteria 1164
245 Ga0501079_0065276 3300049741 Bacteria 2808
246 Ga0501079_0299035 3300049741 Unclassified 1259
247 Ga0501079_0565103 3300049741 Bacteria 895
248 Ga0501079_0716589 3300049741 Bacteria 787
249 Ga0501079_0934682 3300049741 Bacteria 683
250 Ga0501080_0477513 3300049742 Bacteria 1116
251 Ga0501081_0475614 3300049743 Bacteria 930
252 Ga0501083_0075753 3300049744 Bacteria 2234
253 Ga0501083_0244635 3300049744 Bacteria 1168
254 Ga0501083_0792201 3300049744 Unclassified 617
255 Ga0501035_0489986 3300049822 Bacteria 1013
256 Ga0501045_0216545 3300049824 Bacteria 1426
257 Ga0501045_0502819 3300049824 Unclassified 900
258 nmdc:mga03n38_927514_c1 3300050490 Unclassified 513
259 nmdc:mga00v17_61076_c1 3300050491 Bacteria 2316
260 nmdc:mga0yw44_300443_c1 3300050492 Bacteria 1075
261 nmdc:mga0k408_74541_c1 3300050493 Bacteria 1983
262 nmdc:mga06z11_76475_c1 3300050494 Bacteria 1785
263 nmdc:mga05p37_224001_c1 3300050507 Bacteria 2268
264 nmdc:mga05p37_230035_c1 3300050507 Bacteria 2234
265 nmdc:mga05p37_275628_c1 3300050507 Bacteria 1518
266 nmdc:mga05p37_57_c1 3300050507 Bacteria 96042
267 nmdc:mga05p37_6815_c1 3300050507 Bacteria 13466
268 nmdc:mga05p37_96012_c1 3300050507 Bacteria 3652
269 nmdc:mga09592_187021_c1 3300050508 Bacteria 1792
270 nmdc:mga09592_21034_c1 3300050508 Bacteria 5373
271 nmdc:mga09592_226_c1 3300050508 Bacteria 40643
272 nmdc:mga09592_893896_c1 3300050508 Unclassified 747
273 nmdc:mga0qj67_2068_c1 3300050509 Bacteria 14329
274 nmdc:mga0qj67_207151_c1 3300050509 Bacteria 1593
275 nmdc:mga0qj67_26041_c1 3300050509 Bacteria 4220
276 nmdc:mga0qj67_37560_c1 3300050509 Bacteria 3795
277 nmdc:mga06r32_1829_c1 3300050510 Bacteria 18995
278 nmdc:mga06r32_78328_c1 3300050510 Bacteria 3213
279 nmdc:mga06r32_806404_c1 3300050510 Bacteria 899
280 nmdc:mga08y16_102905_c1 3300050511 Bacteria 2973
281 nmdc:mga08y16_1612816_c1 3300050511 Bacteria 606
282 nmdc:mga08y16_767_c1 3300050511 Bacteria 30554
283 nmdc:mga0n895_22269_c1 3300050512 Bacteria 5941
284 nmdc:mga0n895_442630_c1 3300050512 Bacteria 1313
285 nmdc:mga0rr50_602383_c1 3300050513 Bacteria 937
286 nmdc:mga0rr50_67231_c1 3300050513 Bacteria 2722
287 nmdc:mga08x19_105755_c1 3300050514 Bacteria 1872
288 nmdc:mga08x19_456405_c1 3300050514 Bacteria 900
289 nmdc:mga0a205_10022_c1 3300050515 Bacteria 8693
290 Ga0500616_0118662 3300053153 Bacteria 1267
291 Ga0501084_0962005 3300054114 Bacteria 718
292 Ga0501082_0000013 3300060353 Bacteria 119623
293 Ga0501082_0497181 3300060353 Bacteria 1066
294 Ga0530510_0016082 3300061734 Bacteria 5289
295 Ga0530510_0297850 3300061734 Bacteria 1207
296 Ga0530510_0399064 3300061734 Bacteria 1036
297 Ga0530510_0718546 3300061734 Bacteria 761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013297 Ga0157378_10946593 Ga0157378_109465931 129
2 3300049572 Ga0501036_1154750 Ga0501036_1154750_114_503 129
3 3300005444 Ga0070694_100166547 Ga0070694_1001665472 130
4 3300005444 Ga0070694_101487734 Ga0070694_1014877341 130
5 3300005468 Ga0070707_100846116 Ga0070707_1008461162 130
6 3300005536 Ga0070697_100357623 Ga0070697_1003576231 130
7 3300005545 Ga0070695_100112207 Ga0070695_1001122073 130
8 3300005546 Ga0070696_100005660 Ga0070696_1000056608 130
9 3300005546 Ga0070696_100910770 Ga0070696_1009107702 130
10 3300006871 Ga0075434_100490460 Ga0075434_1004904602 130
11 3300007076 Ga0075435_100297303 Ga0075435_1002973032 130
12 3300049741 Ga0501079_0934682 Ga0501079_0934682_203_595 130
13 3300050512 nmdc:mga0n895_442630_c1 nmdc:mga0n895_442630_c1_584_976 130
14 3300050513 nmdc:mga0rr50_67231_c1 nmdc:mga0rr50_67231_c1_1026_1418 130
15 3300050514 nmdc:mga08x19_105755_c1 nmdc:mga08x19_105755_c1_571_963 130
16 3300006844 Ga0075428_101064990 Ga0075428_1010649902 132
17 3300009147 Ga0114129_10707170 Ga0114129_107071702 132
18 3300009148 Ga0105243_10674463 Ga0105243_106744632 135
19 3300025933 Ga0207706_10281841 Ga0207706_102818412 136
20 3300041408 Ga0439453_0007323 Ga0439453_0007323_777_1223 137
21 3300042436 Ga0439435_0036503 Ga0439435_0036503_797_1243 137
22 3300042461 Ga0439460_0015640 Ga0439460_0015640_336_782 137
23 3300005548 Ga0070665_100132646 Ga0070665_1001326463 138
24 3300005548 Ga0070665_100594019 Ga0070665_1005940192 138
25 3300006051 Ga0075364_10025214 Ga0075364_100252142 138
26 3300006178 Ga0075367_10067335 Ga0075367_100673352 138
27 3300006195 Ga0075366_10024095 Ga0075366_100240953 138
28 3300006846 Ga0075430_100397893 Ga0075430_1003978932 138
29 3300028379 Ga0268266_10194526 Ga0268266_101945263 138
30 3300050490 nmdc:mga03n38_927514_c1 nmdc:mga03n38_927514_c1_52_498 138
31 3300050491 nmdc:mga00v17_61076_c1 nmdc:mga00v17_61076_c1_1213_1659 138
32 3300050493 nmdc:mga0k408_74541_c1 nmdc:mga0k408_74541_c1_1083_1529 138
33 3300050494 nmdc:mga06z11_76475_c1 nmdc:mga06z11_76475_c1_1322_1768 138
34 3300006358 Ga0068871_100180723 Ga0068871_1001807232 140
35 3300014969 Ga0157376_10035414 Ga0157376_100354143 140
36 3300042439 Ga0439464_0196887 Ga0439464_0196887_158_604 141
37 3300006844 Ga0075428_100075729 Ga0075428_1000757292 142
38 3300009094 Ga0111539_10489314 Ga0111539_104893142 142
39 3300017792 Ga0163161_10828829 Ga0163161_108288291 142
40 3300026118 Ga0207675_101350121 Ga0207675_1013501212 142
41 3300027907 Ga0207428_10731683 Ga0207428_107316832 142
42 3300050511 nmdc:mga08y16_102905_c1 nmdc:mga08y16_102905_c1_909_1355 142
43 3300006871 Ga0075434_100719560 Ga0075434_1007195602 146
44 3300031548 Ga0307408_100119306 Ga0307408_1001193063 146
45 3300050512 nmdc:mga0n895_22269_c1 nmdc:mga0n895_22269_c1_742_1182 146
46 3300050513 nmdc:mga0rr50_602383_c1 nmdc:mga0rr50_602383_c1_362_802 146
47 3300050515 nmdc:mga0a205_10022_c1 nmdc:mga0a205_10022_c1_5902_6342 146
48 3300006914 Ga0075436_100555622 Ga0075436_1005556222 147
49 3300035086 Ga0373934_0001856 Ga0373934_0001856_5538_5981 147
50 3300035113 Ga0373936_0248290 Ga0373936_0248290_273_728 147
51 3300035117 Ga0373953_0068121 Ga0373953_0068121_281_724 147
52 3300035118 Ga0373954_0068908 Ga0373954_0068908_221_664 147
53 3300035119 Ga0373956_0000024 Ga0373956_0000024_45600_46043 147
54 3300035120 Ga0373957_0005740 Ga0373957_0005740_2542_2985 147
55 3300035172 Ga0373955_0027107 Ga0373955_0027107_985_1428 147
56 3300035691 Ga0373931_0544616 Ga0373931_0544616_97_540 147
57 3300035724 Ga0373933_0000994 Ga0373933_0000994_15084_15527 147
58 3300036401 Ga0373937_0001950 Ga0373937_0001950_1667_2110 147
59 3300046462 Ga0495651_0002702 Ga0495651_0002702_5223_5666 147
60 3300046679 Ga0495623_0267266 Ga0495623_0267266_414_857 147
61 3300047322 Ga0495680_0096686 Ga0495680_0096686_1039_1482 147
62 3300048088 Ga0495602_0418365 Ga0495602_0418365_442_885 147
63 3300049588 Ga0501072_0303997 Ga0501072_0303997_227_670 147
64 3300050514 nmdc:mga08x19_456405_c1 nmdc:mga08x19_456405_c1_254_709 147
65 3300061734 Ga0530510_0297850 Ga0530510_0297850_132_575 147
66 3300003203 JGI25406J46586_10020108 JGI25406J46586_100201082 148
67 3300005290 Ga0065712_10017096 Ga0065712_100170963 148
68 3300005293 Ga0065715_10006681 Ga0065715_100066812 148
69 3300005328 Ga0070676_10216892 Ga0070676_102168922 148
70 3300005330 Ga0070690_100057582 Ga0070690_1000575822 148
71 3300005331 Ga0070670_100896337 Ga0070670_1008963372 148
72 3300005333 Ga0070677_10010758 Ga0070677_100107582 148
73 3300005338 Ga0068868_100524102 Ga0068868_1005241022 148
74 3300005340 Ga0070689_100015650 Ga0070689_1000156508 148
75 3300005340 Ga0070689_100026664 Ga0070689_1000266643 148
76 3300005343 Ga0070687_100005120 Ga0070687_1000051202 148
77 3300005343 Ga0070687_100442921 Ga0070687_1004429212 148
78 3300005347 Ga0070668_100129678 Ga0070668_1001296783 148
79 3300005347 Ga0070668_100416320 Ga0070668_1004163202 148
80 3300005353 Ga0070669_100523802 Ga0070669_1005238022 148
81 3300005353 Ga0070669_101537944 Ga0070669_1015379441 148
82 3300005354 Ga0070675_100095985 Ga0070675_1000959853 148
83 3300005354 Ga0070675_100279502 Ga0070675_1002795022 148
84 3300005354 Ga0070675_100500764 Ga0070675_1005007641 148
85 3300005354 Ga0070675_100991755 Ga0070675_1009917551 148
86 3300005355 Ga0070671_100076376 Ga0070671_1000763762 148
87 3300005355 Ga0070671_100707932 Ga0070671_1007079321 148
88 3300005356 Ga0070674_100004009 Ga0070674_1000040092 148
89 3300005364 Ga0070673_101532990 Ga0070673_1015329901 148
90 3300005364 Ga0070673_101985457 Ga0070673_1019854571 148
91 3300005365 Ga0070688_100055263 Ga0070688_1000552633 148
92 3300005365 Ga0070688_100119987 Ga0070688_1001199872 148
93 3300005365 Ga0070688_100423713 Ga0070688_1004237132 148
94 3300005366 Ga0070659_100523207 Ga0070659_1005232072 148
95 3300005366 Ga0070659_102114226 Ga0070659_1021142261 148
96 3300005367 Ga0070667_100093565 Ga0070667_1000935653 148
97 3300005406 Ga0070703_10188751 Ga0070703_101887511 148
98 3300005438 Ga0070701_10426726 Ga0070701_104267262 148
99 3300005440 Ga0070705_100311888 Ga0070705_1003118882 148
100 3300005441 Ga0070700_100123821 Ga0070700_1001238212 148
101 3300005441 Ga0070700_100470459 Ga0070700_1004704592 148
102 3300005444 Ga0070694_100094781 Ga0070694_1000947812 148
103 3300005444 Ga0070694_100513542 Ga0070694_1005135422 148
104 3300005456 Ga0070678_100006186 Ga0070678_1000061862 148
105 3300005457 Ga0070662_100808229 Ga0070662_1008082291 148
106 3300005459 Ga0068867_100036253 Ga0068867_1000362532 148
107 3300005466 Ga0070685_10333041 Ga0070685_103330412 148
108 3300005518 Ga0070699_100537239 Ga0070699_1005372392 148
109 3300005543 Ga0070672_100041766 Ga0070672_1000417662 148
110 3300005543 Ga0070672_100456030 Ga0070672_1004560302 148
111 3300005544 Ga0070686_100025562 Ga0070686_1000255623 148
112 3300005544 Ga0070686_100444889 Ga0070686_1004448892 148
113 3300005546 Ga0070696_100685289 Ga0070696_1006852892 148
114 3300005548 Ga0070665_101900501 Ga0070665_1019005011 148
115 3300005549 Ga0070704_100168149 Ga0070704_1001681492 148
116 3300005564 Ga0070664_100411830 Ga0070664_1004118302 148
117 3300005577 Ga0068857_100074295 Ga0068857_1000742953 148
118 3300005617 Ga0068859_100037800 Ga0068859_1000378004 148
119 3300005618 Ga0068864_100067263 Ga0068864_1000672632 148
120 3300005719 Ga0068861_100424130 Ga0068861_1004241302 148
121 3300005719 Ga0068861_101025705 Ga0068861_1010257052 148
122 3300005719 Ga0068861_101288799 Ga0068861_1012887992 148
123 3300005840 Ga0068870_10185683 Ga0068870_101856831 148
124 3300005840 Ga0068870_10548978 Ga0068870_105489782 148
125 3300005842 Ga0068858_100303727 Ga0068858_1003037271 148
126 3300005842 Ga0068858_102202393 Ga0068858_1022023931 148
127 3300005843 Ga0068860_100458780 Ga0068860_1004587802 148
128 3300005937 Ga0081455_10159616 Ga0081455_101596162 148
129 3300005981 Ga0081538_10001357 Ga0081538_1000135721 148
130 3300005981 Ga0081538_10055145 Ga0081538_100551453 148
131 3300005983 Ga0081540_1114241 Ga0081540_11142412 148
132 3300005985 Ga0081539_10005746 Ga0081539_100057469 148
133 3300006038 Ga0075365_10487433 Ga0075365_104874332 148
134 3300006237 Ga0097621_100974736 Ga0097621_1009747361 148
135 3300006844 Ga0075428_100003301 Ga0075428_10000330117 148
136 3300006844 Ga0075428_100163364 Ga0075428_1001633643 148
137 3300006844 Ga0075428_101142167 Ga0075428_1011421672 148
138 3300006846 Ga0075430_100001032 Ga0075430_1000010322 148
139 3300006846 Ga0075430_100039271 Ga0075430_1000392712 148
140 3300006846 Ga0075430_100186892 Ga0075430_1001868922 148
141 3300006847 Ga0075431_100000047 Ga0075431_10000004739 148
142 3300006847 Ga0075431_100231654 Ga0075431_1002316542 148
143 3300006847 Ga0075431_100309654 Ga0075431_1003096542 148
144 3300006880 Ga0075429_100032507 Ga0075429_1000325074 148
145 3300006880 Ga0075429_100095396 Ga0075429_1000953963 148
146 3300006880 Ga0075429_100331037 Ga0075429_1003310371 148
147 3300006931 Ga0097620_100037803 Ga0097620_1000378034 148
148 3300009094 Ga0111539_10000271 Ga0111539_1000027117 148
149 3300009094 Ga0111539_13449585 Ga0111539_134495851 148
150 3300009098 Ga0105245_10113090 Ga0105245_101130902 148
151 3300009098 Ga0105245_10627221 Ga0105245_106272211 148
152 3300009098 Ga0105245_10680680 Ga0105245_106806802 148
153 3300009101 Ga0105247_10031563 Ga0105247_100315633 148
154 3300009101 Ga0105247_10202393 Ga0105247_102023932 148
155 3300009101 Ga0105247_10374048 Ga0105247_103740482 148
156 3300009147 Ga0114129_10001108 Ga0114129_1000110825 148
157 3300009147 Ga0114129_10189548 Ga0114129_101895482 148
158 3300009147 Ga0114129_10896083 Ga0114129_108960832 148
159 3300009147 Ga0114129_11012725 Ga0114129_110127252 148
160 3300009148 Ga0105243_10082626 Ga0105243_100826262 148
161 3300009148 Ga0105243_10084038 Ga0105243_100840382 148
162 3300009148 Ga0105243_10383613 Ga0105243_103836132 148
163 3300009148 Ga0105243_11057078 Ga0105243_110570781 148
164 3300009176 Ga0105242_12656062 Ga0105242_126560621 148
165 3300009177 Ga0105248_10477172 Ga0105248_104771722 148
166 3300009177 Ga0105248_11444934 Ga0105248_114449342 148
167 3300009551 Ga0105238_10148932 Ga0105238_101489322 148
168 3300009553 Ga0105249_11600857 Ga0105249_116008572 148
169 3300013297 Ga0157378_10555996 Ga0157378_105559962 148
170 3300013297 Ga0157378_10989904 Ga0157378_109899042 148
171 3300013297 Ga0157378_11039720 Ga0157378_110397202 148
172 3300013297 Ga0157378_11199612 Ga0157378_111996122 148
173 3300013306 Ga0163162_11042785 Ga0163162_110427852 148
174 3300013308 Ga0157375_10579549 Ga0157375_105795491 148
175 3300014325 Ga0163163_10298307 Ga0163163_102983072 148
176 3300014325 Ga0163163_10930014 Ga0163163_109300141 148
177 3300014325 Ga0163163_12799472 Ga0163163_127994721 148
178 3300014326 Ga0157380_10164230 Ga0157380_101642302 148
179 3300014326 Ga0157380_10224418 Ga0157380_102244183 148
180 3300014326 Ga0157380_10636402 Ga0157380_106364022 148
181 3300014968 Ga0157379_10873237 Ga0157379_108732372 148
182 3300025893 Ga0207682_10001862 Ga0207682_100018623 148
183 3300025903 Ga0207680_10126646 Ga0207680_101266462 148
184 3300025907 Ga0207645_10762957 Ga0207645_107629571 148
185 3300025918 Ga0207662_10047357 Ga0207662_100473572 148
186 3300025918 Ga0207662_10323906 Ga0207662_103239062 148
187 3300025923 Ga0207681_10124465 Ga0207681_101244652 148
188 3300025925 Ga0207650_10184514 Ga0207650_101845143 148
189 3300025925 Ga0207650_10298974 Ga0207650_102989742 148
190 3300025925 Ga0207650_10830602 Ga0207650_108306022 148
191 3300025927 Ga0207687_10275643 Ga0207687_102756432 148
192 3300025931 Ga0207644_10091013 Ga0207644_100910132 148
193 3300025931 Ga0207644_10194960 Ga0207644_101949603 148
194 3300025932 Ga0207690_10584626 Ga0207690_105846262 148
195 3300025933 Ga0207706_10511113 Ga0207706_105111132 148
196 3300025935 Ga0207709_10043281 Ga0207709_100432812 148
197 3300025935 Ga0207709_10185022 Ga0207709_101850222 148
198 3300025935 Ga0207709_10520857 Ga0207709_105208572 148
199 3300025935 Ga0207709_10535925 Ga0207709_105359252 148
200 3300025936 Ga0207670_10073954 Ga0207670_100739542 148
201 3300025936 Ga0207670_10140887 Ga0207670_101408872 148
202 3300025936 Ga0207670_10213912 Ga0207670_102139122 148
203 3300025937 Ga0207669_10006880 Ga0207669_100068803 148
204 3300025938 Ga0207704_10895603 Ga0207704_108956032 148
205 3300025940 Ga0207691_10026435 Ga0207691_100264353 148
206 3300025942 Ga0207689_10047667 Ga0207689_100476673 148
207 3300025942 Ga0207689_10583415 Ga0207689_105834152 148
208 3300025960 Ga0207651_10017144 Ga0207651_100171442 148
209 3300025972 Ga0207668_11205705 Ga0207668_112057052 148
210 3300025986 Ga0207658_11414286 Ga0207658_114142861 148
211 3300026023 Ga0207677_12196516 Ga0207677_121965161 148
212 3300026035 Ga0207703_10172274 Ga0207703_101722742 148
213 3300026035 Ga0207703_11620255 Ga0207703_116202552 148
214 3300026075 Ga0207708_10238098 Ga0207708_102380982 148
215 3300026075 Ga0207708_10502169 Ga0207708_105021691 148
216 3300026088 Ga0207641_10903095 Ga0207641_109030952 148
217 3300026089 Ga0207648_10033372 Ga0207648_100333723 148
218 3300026116 Ga0207674_10046171 Ga0207674_100461714 148
219 3300026116 Ga0207674_11865884 Ga0207674_118658842 148
220 3300026118 Ga0207675_101301313 Ga0207675_1013013132 148
221 3300026121 Ga0207683_10006914 Ga0207683_100069143 148
222 3300027907 Ga0207428_10020184 Ga0207428_100201843 148
223 3300028379 Ga0268266_10998815 Ga0268266_109988152 148
224 3300028380 Ga0268265_10973519 Ga0268265_109735192 148
225 3300028381 Ga0268264_11557706 Ga0268264_115577062 148
226 3300035692 Ga0373935_0221678 Ga0373935_0221678_158_604 148
227 3300041486 Ga0451807_2444360 Ga0451807_2444360_118_564 148
228 3300042156 Ga0439446_0095272 Ga0439446_0095272_400_846 148
229 3300042435 Ga0439434_0038058 Ga0439434_0038058_994_1440 148
230 3300042993 Ga0439440_0183265 Ga0439440_0183265_115_561 148
231 3300046491 Ga0495584_0039594 Ga0495584_0039594_1098_1544 148
232 3300046501 Ga0495607_0135804 Ga0495607_0135804_102_548 148
233 3300046537 Ga0495598_0011831 Ga0495598_0011831_1483_1929 148
234 3300046539 Ga0495621_0006357 Ga0495621_0006357_1678_2124 148
235 3300046558 Ga0495633_0093927 Ga0495633_0093927_620_1066 148
236 3300046615 Ga0495656_0020190 Ga0495656_0020190_1991_2437 148
237 3300046664 Ga0495659_0500925 Ga0495659_0500925_52_498 148
238 3300046691 Ga0495670_0109492 Ga0495670_0109492_79_525 148
239 3300047447 Ga0495685_022189 Ga0495685_022189_489_935 148
240 3300048090 Ga0495615_0000954 Ga0495615_0000954_1274_1720 148
241 3300048903 Ga0496100_1366324 Ga0496100_1366324_96_542 148
242 3300048905 Ga0496102_0359984 Ga0496102_0359984_548_994 148
243 3300048913 Ga0496110_1059214 Ga0496110_1059214_52_498 148
244 3300048915 Ga0496112_1224156 Ga0496112_1224156_72_539 148
245 3300049570 Ga0501033_0853098 Ga0501033_0853098_151_597 148
246 3300049575 Ga0501039_0640647 Ga0501039_0640647_37_483 148
247 3300049577 Ga0501041_0663393 Ga0501041_0663393_36_482 148
248 3300049577 Ga0501041_0782647 Ga0501041_0782647_42_488 148
249 3300049578 Ga0501042_0135464 Ga0501042_0135464_1282_1728 148
250 3300049588 Ga0501072_0275992 Ga0501072_0275992_611_1057 148
251 3300049588 Ga0501072_0335795 Ga0501072_0335795_623_1069 148
252 3300049588 Ga0501072_0806558 Ga0501072_0806558_152_601 148
253 3300049589 Ga0501073_0324206 Ga0501073_0324206_78_524 148
254 3300049591 Ga0501075_1235973 Ga0501075_1235973_106_552 148
255 3300049592 Ga0501076_0106152 Ga0501076_0106152_1088_1534 148
256 3300049592 Ga0501076_0161032 Ga0501076_0161032_16_462 148
257 3300049592 Ga0501076_0301256 Ga0501076_0301256_139_585 148
258 3300049592 Ga0501076_0378356 Ga0501076_0378356_446_892 148
259 3300049741 Ga0501079_0065276 Ga0501079_0065276_912_1358 148
260 3300049741 Ga0501079_0299035 Ga0501079_0299035_214_660 148
261 3300049741 Ga0501079_0565103 Ga0501079_0565103_108_554 148
262 3300049741 Ga0501079_0716589 Ga0501079_0716589_172_618 148
263 3300049742 Ga0501080_0477513 Ga0501080_0477513_225_671 148
264 3300049743 Ga0501081_0475614 Ga0501081_0475614_267_713 148
265 3300049744 Ga0501083_0075753 Ga0501083_0075753_517_963 148
266 3300049744 Ga0501083_0244635 Ga0501083_0244635_264_710 148
267 3300049744 Ga0501083_0792201 Ga0501083_0792201_99_548 148
268 3300049822 Ga0501035_0489986 Ga0501035_0489986_35_481 148
269 3300049824 Ga0501045_0216545 Ga0501045_0216545_661_1107 148
270 3300049824 Ga0501045_0502819 Ga0501045_0502819_216_662 148
271 3300050492 nmdc:mga0yw44_300443_c1 nmdc:mga0yw44_300443_c1_571_1017 148
272 3300050507 nmdc:mga05p37_224001_c1 nmdc:mga05p37_224001_c1_1500_1946 148
273 3300050507 nmdc:mga05p37_230035_c1 nmdc:mga05p37_230035_c1_1573_2019 148
274 3300050507 nmdc:mga05p37_275628_c1 nmdc:mga05p37_275628_c1_427_909 148
275 3300050507 nmdc:mga05p37_57_c1 nmdc:mga05p37_57_c1_77299_77745 148
276 3300050507 nmdc:mga05p37_6815_c1 nmdc:mga05p37_6815_c1_4198_4671 148
277 3300050507 nmdc:mga05p37_96012_c1 nmdc:mga05p37_96012_c1_2894_3340 148
278 3300050508 nmdc:mga09592_187021_c1 nmdc:mga09592_187021_c1_740_1186 148
279 3300050508 nmdc:mga09592_21034_c1 nmdc:mga09592_21034_c1_654_1100 148
280 3300050508 nmdc:mga09592_226_c1 nmdc:mga09592_226_c1_6207_6653 148
281 3300050508 nmdc:mga09592_893896_c1 nmdc:mga09592_893896_c1_163_609 148
282 3300050509 nmdc:mga0qj67_2068_c1 nmdc:mga0qj67_2068_c1_152_598 148
283 3300050509 nmdc:mga0qj67_207151_c1 nmdc:mga0qj67_207151_c1_196_642 148
284 3300050509 nmdc:mga0qj67_26041_c1 nmdc:mga0qj67_26041_c1_3280_3726 148
285 3300050509 nmdc:mga0qj67_37560_c1 nmdc:mga0qj67_37560_c1_701_1147 148
286 3300050510 nmdc:mga06r32_1829_c1 nmdc:mga06r32_1829_c1_17519_17965 148
287 3300050510 nmdc:mga06r32_78328_c1 nmdc:mga06r32_78328_c1_34_480 148
288 3300050510 nmdc:mga06r32_806404_c1 nmdc:mga06r32_806404_c1_356_802 148
289 3300050511 nmdc:mga08y16_1612816_c1 nmdc:mga08y16_1612816_c1_84_530 148
290 3300050511 nmdc:mga08y16_767_c1 nmdc:mga08y16_767_c1_13402_13848 148
291 3300053153 Ga0500616_0118662 Ga0500616_0118662_64_528 148
292 3300054114 Ga0501084_0962005 Ga0501084_0962005_172_618 148
293 3300060353 Ga0501082_0000013 Ga0501082_0000013_72234_72680 148
294 3300060353 Ga0501082_0497181 Ga0501082_0497181_471_917 148
295 3300061734 Ga0530510_0016082 Ga0530510_0016082_2403_2849 148
296 3300061734 Ga0530510_0399064 Ga0530510_0399064_532_978 148
297 3300061734 Ga0530510_0718546 Ga0530510_0718546_46_492 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07331

TctB

Tripartite tricarboxylate transporter TctB family

18

153

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pso-assembly1.cif.gz_A crystal structure of apethermo-dbp-rp2 bound to ssdna dt10 0.6905 98 142
6h8k-assembly1.cif.gz_1 crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i 0.362 6 137
7p5x-assembly1.cif.gz_AF mycobacterial rnap with transcriptional activator pafbc 0.3239 3 132
5gou-assembly1.cif.gz_K structure of a 16-mer protein nanocage fabricated from its 24-mer analogue by subunit interface redesign 0.319 2 122
6y90-assembly1.cif.gz_B structure of full-length cd20 in complex with rituximab fab 0.3187 3 138
ID Description Score Start End Superfamily
af_Q54D80_1_349_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.8519 98 128 3.40.1190.20
af_Q7Y201_105_259_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.4032 6 128 1.20.140.40
af_A0A0B4LG35_1_153_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3717 6 137 1.20.140.150
af_Q9VZ71_43_166_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3684 1 133 1.20.140.150
af_E7F5U7_8_131_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3683 1 138 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A1V5DWV9-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.9314 69 146 GO:0016020
AF-A0A3N5VKU0-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.9201 67 145 GO:0016020
AF-A0A2P9HKR9-F1-model_v4 DUF1468 domain-containing protein 0.8934 63 148 GO:0016020
AF-A0A3N5VKU0-F1-model_v4 Tripartite tricarboxylate transporter TctB family protein 0.8862 67 145 GO:0016020
AF-A0A0Q5JMC5-F1-model_v4 DUF1468 domain-containing protein 0.8822 71 148 GO:0016020

Feature Viewer

pLDDT pTM Quality
81.99 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map