F393591

General Info

Members Datasets Scaffolds Average Seq Length
297 211 594 153

Family's Representative Sequence

Representative Sequence 3300005444|Ga0070694_100101029|Ga0070694_1001010292
Length 178
Sequence MGESVETSRPTSKKSKTPTDGGCDSVMIWSEFLEAAPELAIYGDHRLKQRIAYLATIRADGSPRVHPVSPFIAEGHLLLYMEPTSPKRHDLHRDSRYAMHATVEDNSGGEGEFLIRGRAVEIDDAEAMAMAFEQARALGHNPRDRYVLFELSVSEAVATVYPDGEPKRTRWKASQDCE

Samples

Sample ID Description Type Environment
1 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
4 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
9 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
103 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
123 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
128 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
131 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
140 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.05
Nodule 0
Rhizoplane 4.71
Rhizosphere 90.24
Stem 0
Stem Tuber 0
Unclassified 16.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070694_100101029 3300005444 Bacteria 2040
2 Ga0070676_10432541 3300005328 Bacteria 922
3 Ga0070687_100097405 3300005343 Bacteria 1640
4 Ga0070659_100175600 3300005366 Bacteria 1756
5 Ga0070667_100365624 3300005367 Bacteria 1308
6 Ga0070709_10075918 3300005434 Bacteria 2181
7 Ga0070713_100505692 3300005436 Bacteria 1140
8 Ga0070710_10373178 3300005437 Bacteria 950
9 Ga0070701_10169475 3300005438 Unclassified 1270
10 Ga0070711_100051735 3300005439 Bacteria 2823
11 Ga0070705_100174965 3300005440 Unclassified 1448
12 Ga0070700_100803826 3300005441 Bacteria 757
13 Ga0070694_100127398 3300005444 Bacteria 1834
14 Ga0070694_100323947 3300005444 Bacteria 1187
15 Ga0070708_100047966 3300005445 Bacteria 3775
16 Ga0070708_100075130 3300005445 Bacteria 3049
17 Ga0070708_100208670 3300005445 Bacteria 1830
18 Ga0070708_100610726 3300005445 Bacteria 1028
19 Ga0070678_100222369 3300005456 Bacteria 1570
20 Ga0070681_10388901 3300005458 Bacteria 1306
21 Ga0070706_100000042 3300005467 Bacteria 147128
22 Ga0070706_100310329 3300005467 Bacteria 1471
23 Ga0070707_100026036 3300005468 Bacteria 5552
24 Ga0070698_101389549 3300005471 Bacteria 653
25 Ga0070699_100155009 3300005518 Bacteria 2027
26 Ga0070697_100396738 3300005536 Unclassified 1197
27 Ga0070695_100315904 3300005545 Bacteria 1159
28 Ga0070696_100049764 3300005546 Unclassified 2912
29 Ga0070693_100003622 3300005547 Bacteria 7215
30 Ga0070665_100471535 3300005548 Bacteria 1266
31 Ga0070665_100521472 3300005548 Unclassified 1200
32 Ga0068855_100795831 3300005563 Bacteria 1005
33 Ga0070664_100306927 3300005564 Bacteria 1435
34 Ga0068857_102123019 3300005577 Unclassified 551
35 Ga0068854_101486208 3300005578 Bacteria 615
36 Ga0070702_100030939 3300005615 Bacteria 2923
37 Ga0068852_100214191 3300005616 Bacteria 1829
38 Ga0068859_100741447 3300005617 Unclassified 1071
39 Ga0068864_100063310 3300005618 Bacteria 3205
40 Ga0068870_10023259 3300005840 Bacteria 3055
41 Ga0068870_11091488 3300005840 Unclassified 573
42 Ga0068858_100288247 3300005842 Bacteria 1564
43 Ga0068858_100923157 3300005842 Bacteria 854
44 Ga0068858_101379165 3300005842 Bacteria 694
45 Ga0068862_101033881 3300005844 Bacteria 814
46 Ga0081540_1040659 3300005983 Bacteria 2421
47 Ga0081539_10001452 3300005985 Bacteria 40486
48 Ga0081539_10169580 3300005985 Bacteria 1033
49 Ga0075365_10105168 3300006038 Bacteria 1936
50 Ga0075365_10249297 3300006038 Bacteria 1248
51 Ga0075368_10138155 3300006042 Unclassified 1015
52 Ga0075363_100804601 3300006048 Unclassified 572
53 Ga0075364_10391687 3300006051 Unclassified 948
54 Ga0070716_100084500 3300006173 Bacteria 1904
55 Ga0070712_100014894 3300006175 Bacteria 4998
56 Ga0075367_10463974 3300006178 Bacteria 803
57 Ga0075369_10006051 3300006186 Bacteria 4560
58 Ga0075370_10047281 3300006353 Bacteria 2437
59 Ga0075428_100103011 3300006844 Unclassified 3113
60 Ga0075434_100016489 3300006871 Bacteria 7102
61 Ga0075434_100143978 3300006871 Bacteria 2404
62 Ga0075436_100011070 3300006914 Bacteria 6187
63 Ga0075436_100100227 3300006914 Bacteria 2017
64 Ga0097620_100741402 3300006931 Unclassified 1071
65 Ga0075435_100007163 3300007076 Bacteria 7930
66 Ga0075435_100340909 3300007076 Unclassified 1284
67 Ga0105251_10179609 3300009011 Bacteria 953
68 Ga0105240_10109457 3300009093 Bacteria 3346
69 Ga0105245_10050796 3300009098 Bacteria 3717
70 Ga0105245_10285388 3300009098 Bacteria 1615
71 Ga0105245_10456063 3300009098 Bacteria 1288
72 Ga0105245_11808368 3300009098 Unclassified 664
73 Ga0105247_10191292 3300009101 Bacteria 1370
74 Ga0105247_10248414 3300009101 Bacteria 1215
75 Ga0114129_10163612 3300009147 Bacteria 3038
76 Ga0114129_10738601 3300009147 Bacteria 1261
77 Ga0114129_10968357 3300009147 Bacteria 1074
78 Ga0105243_10053524 3300009148 Bacteria 3202
79 Ga0105243_10855161 3300009148 Unclassified 901
80 Ga0105243_12330918 3300009148 Bacteria 573
81 Ga0105242_10113096 3300009176 Bacteria 2318
82 Ga0105248_10074659 3300009177 Bacteria 3811
83 Ga0105248_11213413 3300009177 Unclassified 853
84 Ga0105238_10076786 3300009551 Bacteria 3332
85 Ga0105249_10234058 3300009553 Bacteria 1813
86 Ga0105246_10012315 3300011119 Bacteria 5334
87 Ga0157374_10023751 3300013296 Bacteria 5489
88 Ga0157378_10051287 3300013297 Bacteria 3671
89 Ga0157378_10333207 3300013297 Bacteria 1477
90 Ga0163162_10322343 3300013306 Bacteria 1678
91 Ga0157375_10028488 3300013308 Bacteria 5235
92 Ga0163163_10062435 3300014325 Bacteria 3692
93 Ga0157380_10687948 3300014326 Bacteria 1026
94 Ga0157377_10301128 3300014745 Bacteria 1058
95 Ga0157377_10706562 3300014745 Bacteria 733
96 Ga0157376_10564834 3300014969 Bacteria 1128
97 Ga0207653_10000028 3300025885 Bacteria 113033
98 Ga0207692_10534392 3300025898 Bacteria 747
99 Ga0207710_10250061 3300025900 Bacteria 886
100 Ga0207645_10122487 3300025907 Bacteria 1689
101 Ga0207645_10344320 3300025907 Bacteria 997
102 Ga0207684_10000061 3300025910 Bacteria 203286
103 Ga0207693_10002095 3300025915 Bacteria 17409
104 Ga0207646_10033419 3300025922 Bacteria 4654
105 Ga0207681_11658078 3300025923 Bacteria 535
106 Ga0207694_10055477 3300025924 Bacteria 3076
107 Ga0207659_10630642 3300025926 Bacteria 915
108 Ga0207687_10066124 3300025927 Bacteria 2569
109 Ga0207687_10173974 3300025927 Bacteria 1663
110 Ga0207706_10666968 3300025933 Bacteria 890
111 Ga0207686_10016934 3300025934 Bacteria 4096
112 Ga0207709_10145296 3300025935 Bacteria 1636
113 Ga0207665_10028909 3300025939 Bacteria 3665
114 Ga0207665_10108950 3300025939 Bacteria 1944
115 Ga0207689_10040594 3300025942 Bacteria 3852
116 Ga0207689_10044134 3300025942 Bacteria 3685
117 Ga0207667_10733512 3300025949 Bacteria 988
118 Ga0207712_11869653 3300025961 Unclassified 538
119 Ga0207658_10282696 3300025986 Bacteria 1423
120 Ga0207703_11283438 3300026035 Unclassified 704
121 Ga0207708_10012363 3300026075 Bacteria 6361
122 Ga0207708_10635513 3300026075 Bacteria 907
123 Ga0207641_11233828 3300026088 Bacteria 748
124 Ga0207648_10069943 3300026089 Bacteria 3059
125 Ga0207675_100197663 3300026118 Bacteria 1930
126 Ga0207683_10203719 3300026121 Bacteria 1799
127 Ga0207698_10227703 3300026142 Bacteria 1690
128 Ga0207428_10149153 3300027907 Bacteria 1781
129 Ga0268266_10344852 3300028379 Bacteria 1399
130 Ga0268264_12414700 3300028381 Unclassified 532
131 Ga0265325_10062894 3300031241 Bacteria 1879
132 Ga0265340_10247784 3300031247 Unclassified 794
133 Ga0265331_10091807 3300031250 Bacteria 1403
134 Ga0265316_10077148 3300031344 Bacteria 2559
135 Ga0265313_10080844 3300031595 Bacteria 1476
136 Ga0265314_10123974 3300031711 Bacteria 1622
137 Ga0307409_100747194 3300031995 Archaea 982
138 Ga0307415_100136953 3300032126 Bacteria 1864
139 Ga0307415_100210847 3300032126 Bacteria 1550
140 Ga0373926_0000130 3300035083 Bacteria 15658
141 Ga0373944_0003171 3300035089 Bacteria 4230
142 Ga0373923_0003598 3300035111 Bacteria 4996
143 Ga0373936_0003072 3300035113 Bacteria 6246
144 Ga0373945_0012751 3300035116 Bacteria 2796
145 Ga0373946_0001387 3300035171 Bacteria 8384
146 Ga0373955_0081123 3300035172 Bacteria 1833
147 Ga0373927_0027055 3300035695 Bacteria 3747
148 Ga0373937_0101907 3300036401 Bacteria 2665
149 Ga0373925_0135108 3300037068 Bacteria 1926
150 Ga0373925_0460745 3300037068 Bacteria 1042
151 Ga0439465_0144036 3300041413 Unclassified 848
152 Ga0450913_020877 3300042117 Bacteria 600
153 Ga0453683_0612356 3300044673 Unclassified 711
154 Ga0451576_0112009 3300045051 Unclassified 2840
155 Ga0495629_0101619 3300046459 Bacteria 2006
156 Ga0495641_0010328 3300046461 Bacteria 5420
157 Ga0495651_0185822 3300046462 Bacteria 1467
158 Ga0495653_0113757 3300046463 Bacteria 1940
159 Ga0495653_0431430 3300046463 Bacteria 832
160 Ga0495580_0009482 3300046472 Bacteria 7654
161 Ga0495582_0018896 3300046473 Bacteria 3769
162 Ga0495639_0004767 3300046475 Bacteria 5830
163 Ga0495594_0095260 3300046499 Bacteria 1671
164 Ga0495608_0025852 3300046511 Bacteria 4007
165 Ga0495618_0055819 3300046514 Bacteria 2501
166 Ga0495630_0005925 3300046517 Bacteria 8642
167 Ga0495630_0256925 3300046517 Bacteria 1335
168 Ga0495666_0011148 3300046526 Bacteria 4485
169 Ga0495665_0003710 3300046531 Bacteria 8277
170 Ga0495640_0003627 3300046533 Bacteria 12391
171 Ga0495586_0004717 3300046535 Bacteria 7286
172 Ga0495587_0147691 3300046536 Bacteria 1340
173 Ga0495597_0215972 3300046542 Archaea 763
174 Ga0495667_0048839 3300046559 Bacteria 2794
175 Ga0495656_0484638 3300046615 Unclassified 654
176 Ga0495634_0012336 3300046642 Bacteria 6192
177 Ga0495635_0006509 3300046663 Bacteria 8146
178 Ga0495635_0337731 3300046663 Bacteria 1006
179 Ga0495588_0002176 3300046674 Bacteria 8387
180 Ga0495647_0035990 3300046681 Bacteria 1861
181 Ga0495647_0267468 3300046681 Bacteria 764
182 Ga0495658_0030965 3300046683 Bacteria 2909
183 Ga0495658_0381730 3300046683 Bacteria 897
184 Ga0495613_0004995 3300046689 Bacteria 9962
185 Ga0495613_0172221 3300046689 Bacteria 1536
186 Ga0495600_0544883 3300046809 Bacteria 709
187 Ga0495581_0002947 3300047315 Bacteria 9740
188 Ga0495604_0435437 3300047317 Bacteria 859
189 Ga0495674_0005372 3300047319 Bacteria 12299
190 Ga0495676_0011903 3300047321 Bacteria 7850
191 Ga0495680_0001169 3300047322 Bacteria 28908
192 Ga0495680_0172538 3300047322 Bacteria 1565
193 Ga0495593_0014328 3300047673 Bacteria 4508
194 Ga0495614_0008035 3300048089 Bacteria 4689
195 Ga0496101_0004836 3300048904 Bacteria 8543
196 Ga0496102_0107037 3300048905 Bacteria 2603
197 Ga0496102_1444622 3300048905 Unclassified 607
198 Ga0496103_0010439 3300048906 Bacteria 5496
199 Ga0496106_0006680 3300048909 Bacteria 8538
200 Ga0496107_0019704 3300048910 Bacteria 4760
201 Ga0496109_0922103 3300048912 Bacteria 811
202 Ga0496110_0083325 3300048913 Bacteria 2852
203 Ga0496111_0079397 3300048914 Bacteria 2394
204 Ga0496112_0068561 3300048915 Bacteria 3503
205 Ga0496113_0104902 3300048916 Bacteria 2194
206 Ga0496114_0042100 3300048917 Bacteria 3784
207 Ga0496114_1055565 3300048917 Unclassified 696
208 Ga0496115_0386770 3300048918 Bacteria 1137
209 Ga0501031_0398942 3300049568 Bacteria 890
210 Ga0501031_0485176 3300049568 Unclassified 797
211 Ga0501032_0036729 3300049569 Bacteria 3343
212 Ga0501032_0396315 3300049569 Bacteria 887
213 Ga0501033_0840919 3300049570 Unclassified 619
214 Ga0501034_0207658 3300049571 Bacteria 1914
215 Ga0501036_0099689 3300049572 Bacteria 2457
216 Ga0501036_0465690 3300049572 Bacteria 1052
217 Ga0501036_0600065 3300049572 Unclassified 913
218 Ga0501037_0094826 3300049573 Bacteria 2157
219 Ga0501037_0121518 3300049573 Bacteria 1878
220 Ga0501038_0040579 3300049574 Bacteria 4063
221 Ga0501038_0248449 3300049574 Bacteria 1410
222 Ga0501038_0499825 3300049574 Bacteria 930
223 Ga0501039_0131377 3300049575 Bacteria 1965
224 Ga0501039_0141587 3300049575 Bacteria 1889
225 Ga0501039_0170723 3300049575 Bacteria 1710
226 Ga0501040_0013164 3300049576 Bacteria 5440
227 Ga0501040_0119731 3300049576 Bacteria 1847
228 Ga0501040_0406953 3300049576 Bacteria 977
229 Ga0501041_0083074 3300049577 Bacteria 1974
230 Ga0501041_0320555 3300049577 Bacteria 978
231 Ga0501042_0076366 3300049578 Bacteria 2398
232 Ga0501042_0611596 3300049578 Bacteria 792
233 Ga0501043_0045800 3300049579 Bacteria 3439
234 Ga0501043_1004729 3300049579 Unclassified 593
235 Ga0501048_0029163 3300049582 Bacteria 4003
236 Ga0501048_0187472 3300049582 Archaea 1466
237 Ga0501068_0273357 3300049584 Unclassified 1079
238 Ga0501070_0057713 3300049586 Bacteria 3218
239 Ga0501071_0056560 3300049587 Bacteria 2834
240 Ga0501071_0136383 3300049587 Bacteria 1826
241 Ga0501071_0353072 3300049587 Bacteria 1119
242 Ga0501071_0714325 3300049587 Unclassified 772
243 Ga0501072_0230984 3300049588 Bacteria 1474
244 Ga0501072_0242563 3300049588 Archaea 1435
245 Ga0501072_0326528 3300049588 Bacteria 1219
246 Ga0501072_0723425 3300049588 Unclassified 782
247 Ga0501073_0031561 3300049589 Bacteria 3780
248 Ga0501074_0219118 3300049590 Bacteria 1355
249 Ga0501075_0434865 3300049591 Bacteria 1001
250 Ga0501075_0626939 3300049591 Bacteria 820
251 Ga0501076_0003003 3300049592 Bacteria 11721
252 Ga0501076_0035761 3300049592 Bacteria 3887
253 Ga0501076_0057207 3300049592 Bacteria 3096
254 Ga0501076_0370786 3300049592 Unclassified 1176
255 Ga0501077_0058921 3300049593 Bacteria 2438
256 Ga0501077_0485447 3300049593 Unclassified 792
257 Ga0501079_0140984 3300049741 Bacteria 1878
258 Ga0501079_0144004 3300049741 Bacteria 1857
259 Ga0501079_0182612 3300049741 Bacteria 1637
260 Ga0501080_0161360 3300049742 Bacteria 2070
261 Ga0501080_0199753 3300049742 Bacteria 1836
262 Ga0501080_0484153 3300049742 Unclassified 1107
263 Ga0501080_0590689 3300049742 Bacteria 986
264 Ga0501080_0953651 3300049742 Unclassified 746
265 Ga0501081_0408674 3300049743 Bacteria 1005
266 Ga0501081_0880978 3300049743 Unclassified 675
267 Ga0501035_0261928 3300049822 Bacteria 1465
268 Ga0501035_0559953 3300049822 Unclassified 935
269 Ga0501044_0473335 3300049823 Bacteria 1156
270 Ga0501044_0575848 3300049823 Unclassified 1021
271 Ga0501045_0022976 3300049824 Bacteria 4469
272 Ga0501045_0134451 3300049824 Bacteria 1839
273 Ga0501045_0186872 3300049824 Bacteria 1544
274 nmdc:mga03683_21424_c1 3300050489 Bacteria 2492
275 nmdc:mga03n38_297973_c1 3300050490 Unclassified 865
276 nmdc:mga0k408_263074_c1 3300050493 Unclassified 1030
277 nmdc:mga04h51_118556_c1 3300050495 Unclassified 983
278 nmdc:mga07m45_20142_c1 3300050496 Bacteria 3621
279 nmdc:mga05p37_423257_c1 3300050507 Unclassified 1549
280 nmdc:mga05p37_814872_c1 3300050507 Bacteria 1019
281 nmdc:mga05p37_878973_c1 3300050507 Bacteria 969
282 nmdc:mga09592_1397864_c1 3300050508 Unclassified 572
283 nmdc:mga08y16_1689310_c1 3300050511 Bacteria 589
284 nmdc:mga0n895_244890_c1 3300050512 Bacteria 1820
285 nmdc:mga0n895_284438_c1 3300050512 Unclassified 1677
286 nmdc:mga0rr50_142233_c1 3300050513 Unclassified 1931
287 nmdc:mga0rr50_4584_c1 3300050513 Bacteria 8137
288 nmdc:mga08x19_27753_c1 3300050514 Bacteria 3542
289 nmdc:mga0sz30_2614_c1 3300050516 Bacteria 6414
290 Ga0495595_0122685 3300053084 Bacteria 1266
291 Ga0495619_0011192 3300053085 Bacteria 5642
292 Ga0500566_0256590 3300053094 Bacteria 847
293 Ga0501082_0200793 3300060353 Bacteria 1735
294 Ga0501082_0480343 3300060353 Bacteria 1086
295 Ga0530510_0061667 3300061734 Archaea 2715
296 Ga0530510_0115667 3300061734 Bacteria 1966
297 Ga0530510_0420306 3300061734 Unclassified 1009
298 Ga0070694_100101029
299 Ga0070676_10432541
300 Ga0070687_100097405
301 Ga0070659_100175600
302 Ga0070667_100365624
303 Ga0070709_10075918
304 Ga0070713_100505692
305 Ga0070710_10373178
306 Ga0070701_10169475
307 Ga0070711_100051735
308 Ga0070705_100174965
309 Ga0070700_100803826
310 Ga0070694_100127398
311 Ga0070694_100323947
312 Ga0070708_100047966
313 Ga0070708_100075130
314 Ga0070708_100208670
315 Ga0070708_100610726
316 Ga0070678_100222369
317 Ga0070681_10388901
318 Ga0070706_100000042
319 Ga0070706_100310329
320 Ga0070707_100026036
321 Ga0070698_101389549
322 Ga0070699_100155009
323 Ga0070697_100396738
324 Ga0070695_100315904
325 Ga0070696_100049764
326 Ga0070693_100003622
327 Ga0070665_100471535
328 Ga0070665_100521472
329 Ga0068855_100795831
330 Ga0070664_100306927
331 Ga0068857_102123019
332 Ga0068854_101486208
333 Ga0070702_100030939
334 Ga0068852_100214191
335 Ga0068859_100741447
336 Ga0068864_100063310
337 Ga0068870_10023259
338 Ga0068870_11091488
339 Ga0068858_100288247
340 Ga0068858_100923157
341 Ga0068858_101379165
342 Ga0068862_101033881
343 Ga0081540_1040659
344 Ga0081539_10001452
345 Ga0081539_10169580
346 Ga0075365_10105168
347 Ga0075365_10249297
348 Ga0075368_10138155
349 Ga0075363_100804601
350 Ga0075364_10391687
351 Ga0070716_100084500
352 Ga0070712_100014894
353 Ga0075367_10463974
354 Ga0075369_10006051
355 Ga0075370_10047281
356 Ga0075428_100103011
357 Ga0075434_100016489
358 Ga0075434_100143978
359 Ga0075436_100011070
360 Ga0075436_100100227
361 Ga0097620_100741402
362 Ga0075435_100007163
363 Ga0075435_100340909
364 Ga0105251_10179609
365 Ga0105240_10109457
366 Ga0105245_10050796
367 Ga0105245_10285388
368 Ga0105245_10456063
369 Ga0105245_11808368
370 Ga0105247_10191292
371 Ga0105247_10248414
372 Ga0114129_10163612
373 Ga0114129_10738601
374 Ga0114129_10968357
375 Ga0105243_10053524
376 Ga0105243_10855161
377 Ga0105243_12330918
378 Ga0105242_10113096
379 Ga0105248_10074659
380 Ga0105248_11213413
381 Ga0105238_10076786
382 Ga0105249_10234058
383 Ga0105246_10012315
384 Ga0157374_10023751
385 Ga0157378_10051287
386 Ga0157378_10333207
387 Ga0163162_10322343
388 Ga0157375_10028488
389 Ga0163163_10062435
390 Ga0157380_10687948
391 Ga0157377_10301128
392 Ga0157377_10706562
393 Ga0157376_10564834
394 Ga0207653_10000028
395 Ga0207692_10534392
396 Ga0207710_10250061
397 Ga0207645_10122487
398 Ga0207645_10344320
399 Ga0207684_10000061
400 Ga0207693_10002095
401 Ga0207646_10033419
402 Ga0207681_11658078
403 Ga0207694_10055477
404 Ga0207659_10630642
405 Ga0207687_10066124
406 Ga0207687_10173974
407 Ga0207706_10666968
408 Ga0207686_10016934
409 Ga0207709_10145296
410 Ga0207665_10028909
411 Ga0207665_10108950
412 Ga0207689_10040594
413 Ga0207689_10044134
414 Ga0207667_10733512
415 Ga0207712_11869653
416 Ga0207658_10282696
417 Ga0207703_11283438
418 Ga0207708_10012363
419 Ga0207708_10635513
420 Ga0207641_11233828
421 Ga0207648_10069943
422 Ga0207675_100197663
423 Ga0207683_10203719
424 Ga0207698_10227703
425 Ga0207428_10149153
426 Ga0268266_10344852
427 Ga0268264_12414700
428 Ga0265325_10062894
429 Ga0265340_10247784
430 Ga0265331_10091807
431 Ga0265316_10077148
432 Ga0265313_10080844
433 Ga0265314_10123974
434 Ga0307409_100747194
435 Ga0307415_100136953
436 Ga0307415_100210847
437 Ga0373926_0000130
438 Ga0373944_0003171
439 Ga0373923_0003598
440 Ga0373936_0003072
441 Ga0373945_0012751
442 Ga0373946_0001387
443 Ga0373955_0081123
444 Ga0373927_0027055
445 Ga0373937_0101907
446 Ga0373925_0135108
447 Ga0373925_0460745
448 Ga0439465_0144036
449 Ga0450913_020877
450 Ga0453683_0612356
451 Ga0451576_0112009
452 Ga0495629_0101619
453 Ga0495641_0010328
454 Ga0495651_0185822
455 Ga0495653_0113757
456 Ga0495653_0431430
457 Ga0495580_0009482
458 Ga0495582_0018896
459 Ga0495639_0004767
460 Ga0495594_0095260
461 Ga0495608_0025852
462 Ga0495618_0055819
463 Ga0495630_0005925
464 Ga0495630_0256925
465 Ga0495666_0011148
466 Ga0495665_0003710
467 Ga0495640_0003627
468 Ga0495586_0004717
469 Ga0495587_0147691
470 Ga0495597_0215972
471 Ga0495667_0048839
472 Ga0495656_0484638
473 Ga0495634_0012336
474 Ga0495635_0006509
475 Ga0495635_0337731
476 Ga0495588_0002176
477 Ga0495647_0035990
478 Ga0495647_0267468
479 Ga0495658_0030965
480 Ga0495658_0381730
481 Ga0495613_0004995
482 Ga0495613_0172221
483 Ga0495600_0544883
484 Ga0495581_0002947
485 Ga0495604_0435437
486 Ga0495674_0005372
487 Ga0495676_0011903
488 Ga0495680_0001169
489 Ga0495680_0172538
490 Ga0495593_0014328
491 Ga0495614_0008035
492 Ga0496101_0004836
493 Ga0496102_0107037
494 Ga0496102_1444622
495 Ga0496103_0010439
496 Ga0496106_0006680
497 Ga0496107_0019704
498 Ga0496109_0922103
499 Ga0496110_0083325
500 Ga0496111_0079397
501 Ga0496112_0068561
502 Ga0496113_0104902
503 Ga0496114_0042100
504 Ga0496114_1055565
505 Ga0496115_0386770
506 Ga0501031_0398942
507 Ga0501031_0485176
508 Ga0501032_0036729
509 Ga0501032_0396315
510 Ga0501033_0840919
511 Ga0501034_0207658
512 Ga0501036_0099689
513 Ga0501036_0465690
514 Ga0501036_0600065
515 Ga0501037_0094826
516 Ga0501037_0121518
517 Ga0501038_0040579
518 Ga0501038_0248449
519 Ga0501038_0499825
520 Ga0501039_0131377
521 Ga0501039_0141587
522 Ga0501039_0170723
523 Ga0501040_0013164
524 Ga0501040_0119731
525 Ga0501040_0406953
526 Ga0501041_0083074
527 Ga0501041_0320555
528 Ga0501042_0076366
529 Ga0501042_0611596
530 Ga0501043_0045800
531 Ga0501043_1004729
532 Ga0501048_0029163
533 Ga0501048_0187472
534 Ga0501068_0273357
535 Ga0501070_0057713
536 Ga0501071_0056560
537 Ga0501071_0136383
538 Ga0501071_0353072
539 Ga0501071_0714325
540 Ga0501072_0230984
541 Ga0501072_0242563
542 Ga0501072_0326528
543 Ga0501072_0723425
544 Ga0501073_0031561
545 Ga0501074_0219118
546 Ga0501075_0434865
547 Ga0501075_0626939
548 Ga0501076_0003003
549 Ga0501076_0035761
550 Ga0501076_0057207
551 Ga0501076_0370786
552 Ga0501077_0058921
553 Ga0501077_0485447
554 Ga0501079_0140984
555 Ga0501079_0144004
556 Ga0501079_0182612
557 Ga0501080_0161360
558 Ga0501080_0199753
559 Ga0501080_0484153
560 Ga0501080_0590689
561 Ga0501080_0953651
562 Ga0501081_0408674
563 Ga0501081_0880978
564 Ga0501035_0261928
565 Ga0501035_0559953
566 Ga0501044_0473335
567 Ga0501044_0575848
568 Ga0501045_0022976
569 Ga0501045_0134451
570 Ga0501045_0186872
571 nmdc:mga03683_21424_c1
572 nmdc:mga03n38_297973_c1
573 nmdc:mga0k408_263074_c1
574 nmdc:mga04h51_118556_c1
575 nmdc:mga07m45_20142_c1
576 nmdc:mga05p37_423257_c1
577 nmdc:mga05p37_814872_c1
578 nmdc:mga05p37_878973_c1
579 nmdc:mga09592_1397864_c1
580 nmdc:mga08y16_1689310_c1
581 nmdc:mga0n895_244890_c1
582 nmdc:mga0n895_284438_c1
583 nmdc:mga0rr50_142233_c1
584 nmdc:mga0rr50_4584_c1
585 nmdc:mga08x19_27753_c1
586 nmdc:mga0sz30_2614_c1
587 Ga0495595_0122685
588 Ga0495619_0011192
589 Ga0500566_0256590
590 Ga0501082_0200793
591 Ga0501082_0480343
592 Ga0530510_0061667
593 Ga0530510_0115667
594 Ga0530510_0420306

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

42

126

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vna-assembly1.cif.gz_C pden_1323 0.8038 14 132
1rfe-assembly1.cif.gz_A crystal structure of conserved hypothetical protein rv2991 from mycobacterium tuberculosis 0.798 16 133
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.7789 20 132
3db0-assembly1.cif.gz_B crystal structure of putative pyridoxamine 5'-phosphate oxidase (np_472219.1) from listeria innocua at 2.00 a resolution 0.7768 11 131
7kq2-assembly1.cif.gz_A 1.98 a resolution crystal structure of group a streptococcus h111a hupz-v5-his6 0.7767 21 131
ID Description Score Start End Superfamily
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8023 16 133 2.30.110.10
5escD00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7933 21 131 2.30.110.10
af_O53240_10_156_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7847 12 133 2.30.110.10
af_I1KGP8_130_285_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7842 13 140 2.30.110.10
af_P67762_2_140_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.7787 14 147 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A538AFJ0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9797 1 149
AF-A0A538AFJ0-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9606 1 149
AF-A0A5N9CU78-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9568 3 94 GO:0005829
GO:0016627
GO:0070967
AF-A0A6L9J039-F1-model_v4 Pyridoxamine 5'-phosphate oxidase 0.9449 3 149 GO:0005829
GO:0016627
GO:0070967
AF-A0A2W6AWV5-F1-model_v4 Pyridoxamine 5'-phosphate oxidase family protein 0.9436 3 135

Map