F393261

General Info

Members Datasets Scaffolds Average Seq Length
296 181 592 118

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100193351|Ga0307408_1001933511
Length 131
Sequence MAPVVTRYTKTPVGAHYGLGDWLLQRLTAVVMAVYTVGLVVCLVWHAPAGYAAWKAIFAGTVAKLSTMLFIAALLYHAWVGMRDIVMDYVKSAGLRLVLQTAIGVGLLFYLVWGAAILWSLPSSAVIGGAQ

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
138 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
142 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
143 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
144 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
145 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
146 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
180 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
181 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.03
Nodule 0
Rhizoplane 1.01
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 4.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100193351 3300031548 Bacteria 1641
2 Ga0065712_10186754 3300005290 Bacteria 1167
3 Ga0065712_10289906 3300005290 Bacteria 879
4 Ga0070690_100159912 3300005330 Bacteria 1543
5 Ga0070690_100737106 3300005330 Bacteria 760
6 Ga0070690_100826896 3300005330 Bacteria 720
7 Ga0070670_100015842 3300005331 Bacteria 6469
8 Ga0068869_100305436 3300005334 Bacteria 1286
9 Ga0070682_101918474 3300005337 Bacteria 519
10 Ga0068868_100341360 3300005338 Bacteria 1281
11 Ga0068868_101092021 3300005338 Bacteria 734
12 Ga0070689_100011824 3300005340 Bacteria 6265
13 Ga0070689_100208742 3300005340 Bacteria 1598
14 Ga0070689_100404374 3300005340 Bacteria 1155
15 Ga0070689_100536189 3300005340 Bacteria 1007
16 Ga0070692_10350509 3300005345 Bacteria 917
17 Ga0070692_10405396 3300005345 Bacteria 862
18 Ga0070669_101077008 3300005353 Bacteria 692
19 Ga0070675_100036731 3300005354 Bacteria 3988
20 Ga0070675_100133398 3300005354 Bacteria 2118
21 Ga0070675_101948803 3300005354 Bacteria 542
22 Ga0070671_102035398 3300005355 Unclassified 511
23 Ga0070674_100019984 3300005356 Bacteria 4267
24 Ga0070674_100274378 3300005356 Bacteria 1334
25 Ga0070674_102103074 3300005356 Bacteria 515
26 Ga0070673_100094490 3300005364 Bacteria 2451
27 Ga0070673_101450663 3300005364 Bacteria 646
28 Ga0070688_100064695 3300005365 Bacteria 2322
29 Ga0070659_101434026 3300005366 Bacteria 614
30 Ga0070667_100257376 3300005367 Bacteria 1562
31 Ga0070709_10961213 3300005434 Bacteria 678
32 Ga0070713_101410802 3300005436 Bacteria 675
33 Ga0070701_10234402 3300005438 Bacteria 1101
34 Ga0070701_10501655 3300005438 Unclassified 788
35 Ga0070701_10509542 3300005438 Bacteria 783
36 Ga0070700_101094574 3300005441 Bacteria 660
37 Ga0070708_100962508 3300005445 Bacteria 801
38 Ga0070708_101077959 3300005445 Bacteria 753
39 Ga0070678_100463985 3300005456 Bacteria 1112
40 Ga0070678_100767719 3300005456 Bacteria 873
41 Ga0070678_100773469 3300005456 Bacteria 870
42 Ga0070678_101319469 3300005456 Bacteria 672
43 Ga0068867_100020082 3300005459 Bacteria 4760
44 Ga0068867_100441167 3300005459 Bacteria 1107
45 Ga0070707_100453113 3300005468 Bacteria 1244
46 Ga0070698_100337430 3300005471 Bacteria 1439
47 Ga0070699_100265146 3300005518 Bacteria 1537
48 Ga0070697_101167291 3300005536 Bacteria 686
49 Ga0068853_100094084 3300005539 Bacteria 2640
50 Ga0070672_100581244 3300005543 Bacteria 974
51 Ga0070686_100382587 3300005544 Bacteria 1066
52 Ga0070686_101075207 3300005544 Bacteria 663
53 Ga0070695_100607597 3300005545 Bacteria 859
54 Ga0070696_100375550 3300005546 Bacteria 1107
55 Ga0070696_101245498 3300005546 Bacteria 630
56 Ga0070696_101495558 3300005546 Bacteria 578
57 Ga0070693_100002260 3300005547 Bacteria 8830
58 Ga0070665_100065032 3300005548 Bacteria 3659
59 Ga0070704_100349919 3300005549 Bacteria 1247
60 Ga0070664_100460145 3300005564 Bacteria 1169
61 Ga0068857_102292974 3300005577 Bacteria 530
62 Ga0068854_100544257 3300005578 Bacteria 984
63 Ga0070702_101063854 3300005615 Bacteria 644
64 Ga0068852_101527763 3300005616 Bacteria 690
65 Ga0068859_100058550 3300005617 Bacteria 3881
66 Ga0068859_100694812 3300005617 Unclassified 1108
67 Ga0068859_100980979 3300005617 Bacteria 927
68 Ga0068859_101456666 3300005617 Bacteria 755
69 Ga0068859_102752586 3300005617 Bacteria 540
70 Ga0068864_100780215 3300005618 Bacteria 938
71 Ga0068866_10389406 3300005718 Bacteria 896
72 Ga0068861_100340394 3300005719 Bacteria 1312
73 Ga0068861_100419614 3300005719 Bacteria 1192
74 Ga0068851_10239086 3300005834 Bacteria 1026
75 Ga0068870_11309572 3300005840 Unclassified 528
76 Ga0068863_100118075 3300005841 Bacteria 2528
77 Ga0068863_100194260 3300005841 Bacteria 1951
78 Ga0068858_100011090 3300005842 Bacteria 8521
79 Ga0068858_100117647 3300005842 Bacteria 2484
80 Ga0068860_100511229 3300005843 Bacteria 1200
81 Ga0068862_101336839 3300005844 Bacteria 719
82 Ga0075364_11132179 3300006051 Bacteria 531
83 Ga0070715_10253039 3300006163 Bacteria 921
84 Ga0070715_10340008 3300006163 Bacteria 816
85 Ga0075366_10010793 3300006195 Bacteria 5137
86 Ga0075366_10136116 3300006195 Bacteria 1483
87 Ga0097621_100004904 3300006237 Bacteria 9385
88 Ga0097621_100067049 3300006237 Bacteria 2957
89 Ga0097621_100445639 3300006237 Bacteria 1166
90 Ga0097621_100480657 3300006237 Bacteria 1123
91 Ga0097621_100518407 3300006237 Bacteria 1082
92 Ga0075370_10153296 3300006353 Bacteria 1351
93 Ga0068871_100012235 3300006358 Bacteria 6318
94 Ga0068871_100061996 3300006358 Bacteria 3055
95 Ga0068871_101558125 3300006358 Bacteria 625
96 Ga0075428_100041048 3300006844 Bacteria 5089
97 Ga0075431_101669611 3300006847 Bacteria 594
98 Ga0075434_100716830 3300006871 Bacteria 1017
99 Ga0075429_101795337 3300006880 Bacteria 532
100 Ga0068865_100192395 3300006881 Bacteria 1579
101 Ga0075436_100015869 3300006914 Bacteria 5157
102 Ga0075436_100340730 3300006914 Bacteria 1079
103 Ga0097620_100058551 3300006931 Bacteria 3881
104 Ga0097620_100694874 3300006931 Unclassified 1108
105 Ga0097620_100980973 3300006931 Bacteria 927
106 Ga0097620_101456581 3300006931 Bacteria 755
107 Ga0097620_102753882 3300006931 Bacteria 540
108 Ga0099794_10705418 3300007265 Bacteria 537
109 Ga0105240_10146041 3300009093 Bacteria 2822
110 Ga0105240_10979294 3300009093 Bacteria 906
111 Ga0111539_10001299 3300009094 Bacteria 33371
112 Ga0111539_10762965 3300009094 Bacteria 1126
113 Ga0105245_10082983 3300009098 Bacteria 2932
114 Ga0105245_10112109 3300009098 Bacteria 2538
115 Ga0105245_10411423 3300009098 Bacteria 1354
116 Ga0105245_11574174 3300009098 Bacteria 709
117 Ga0105243_10071555 3300009148 Bacteria 2804
118 Ga0105243_10497080 3300009148 Bacteria 1155
119 Ga0105242_10015783 3300009176 Bacteria 5868
120 Ga0105242_10045746 3300009176 Bacteria 3548
121 Ga0105242_10468359 3300009176 Bacteria 1191
122 Ga0105248_10023772 3300009177 Bacteria 6810
123 Ga0105248_10092818 3300009177 Bacteria 3399
124 Ga0105248_10232069 3300009177 Bacteria 2077
125 Ga0105248_11369696 3300009177 Bacteria 800
126 Ga0105248_11971907 3300009177 Bacteria 663
127 Ga0105237_10141065 3300009545 Bacteria 2404
128 Ga0105238_10103920 3300009551 Bacteria 2822
129 Ga0105238_11111652 3300009551 Bacteria 813
130 Ga0105238_11625308 3300009551 Bacteria 676
131 Ga0105238_12405142 3300009551 Bacteria 562
132 Ga0105238_12519652 3300009551 Bacteria 550
133 Ga0105238_12946459 3300009551 Bacteria 512
134 Ga0105249_10542549 3300009553 Bacteria 1213
135 Ga0105249_10546651 3300009553 Bacteria 1208
136 Ga0157374_10137446 3300013296 Bacteria 2370
137 Ga0157374_10340597 3300013296 Bacteria 1489
138 Ga0157374_11069867 3300013296 Bacteria 827
139 Ga0157378_10366677 3300013297 Bacteria 1411
140 Ga0157378_10497890 3300013297 Bacteria 1217
141 Ga0157378_10751805 3300013297 Bacteria 998
142 Ga0157378_10817010 3300013297 Bacteria 959
143 Ga0157378_11236810 3300013297 Bacteria 787
144 Ga0163162_10419813 3300013306 Bacteria 1470
145 Ga0163162_10937714 3300013306 Bacteria 977
146 Ga0163162_11245422 3300013306 Bacteria 845
147 Ga0157372_12170925 3300013307 Bacteria 638
148 Ga0157375_10375305 3300013308 Bacteria 1589
149 Ga0157380_10496419 3300014326 Bacteria 1184
150 Ga0157380_11482897 3300014326 Bacteria 731
151 Ga0157377_10141698 3300014745 Bacteria 1478
152 Ga0157379_10165816 3300014968 Bacteria 1994
153 Ga0157379_10210250 3300014968 Bacteria 1761
154 Ga0157376_10176990 3300014969 Bacteria 1947
155 Ga0213876_10336027 3300021384 Unclassified 803
156 Ga0207682_10227137 3300025893 Bacteria 865
157 Ga0207642_10669692 3300025899 Bacteria 652
158 Ga0207642_11006231 3300025899 Unclassified 537
159 Ga0207688_10014116 3300025901 Bacteria 4345
160 Ga0207643_10328769 3300025908 Bacteria 956
161 Ga0207654_11329498 3300025911 Bacteria 524
162 Ga0207695_10194601 3300025913 Bacteria 1944
163 Ga0207694_10295662 3300025924 Bacteria 1332
164 Ga0207694_11434065 3300025924 Bacteria 583
165 Ga0207650_10116994 3300025925 Bacteria 2071
166 Ga0207659_10353894 3300025926 Bacteria 1219
167 Ga0207659_10725961 3300025926 Bacteria 851
168 Ga0207659_11407214 3300025926 Bacteria 598
169 Ga0207687_10029585 3300025927 Bacteria 3686
170 Ga0207687_10248357 3300025927 Bacteria 1413
171 Ga0207687_10417307 3300025927 Bacteria 1107
172 Ga0207687_11355279 3300025927 Bacteria 611
173 Ga0207700_10333788 3300025928 Bacteria 1316
174 Ga0207706_10188244 3300025933 Bacteria 1812
175 Ga0207686_10005092 3300025934 Bacteria 7067
176 Ga0207686_10028329 3300025934 Bacteria 3292
177 Ga0207686_10029135 3300025934 Bacteria 3254
178 Ga0207686_10653979 3300025934 Bacteria 832
179 Ga0207709_10060282 3300025935 Bacteria 2365
180 Ga0207709_10361340 3300025935 Bacteria 1099
181 Ga0207670_10024813 3300025936 Bacteria 3753
182 Ga0207670_10025627 3300025936 Bacteria 3704
183 Ga0207670_10330041 3300025936 Bacteria 1203
184 Ga0207670_10596008 3300025936 Bacteria 907
185 Ga0207669_10034547 3300025937 Bacteria 2866
186 Ga0207704_10061750 3300025938 Bacteria 2326
187 Ga0207665_10375703 3300025939 Bacteria 1078
188 Ga0207691_10088010 3300025940 Bacteria 2786
189 Ga0207691_10866230 3300025940 Bacteria 757
190 Ga0207711_10130155 3300025941 Bacteria 2255
191 Ga0207711_10137836 3300025941 Bacteria 2193
192 Ga0207711_10265919 3300025941 Bacteria 1577
193 Ga0207689_10133513 3300025942 Bacteria 2043
194 Ga0207689_10463546 3300025942 Bacteria 1060
195 Ga0207689_11113913 3300025942 Bacteria 665
196 Ga0207661_11277343 3300025944 Bacteria 675
197 Ga0207679_11293939 3300025945 Bacteria 669
198 Ga0207651_10241215 3300025960 Bacteria 1473
199 Ga0207651_10683141 3300025960 Bacteria 903
200 Ga0207712_10396054 3300025961 Bacteria 1159
201 Ga0207712_10603793 3300025961 Bacteria 949
202 Ga0207640_10446730 3300025981 Bacteria 1064
203 Ga0207658_10526650 3300025986 Bacteria 1055
204 Ga0207658_11060630 3300025986 Bacteria 740
205 Ga0207677_10873390 3300026023 Bacteria 809
206 Ga0207703_10050864 3300026035 Bacteria 3355
207 Ga0207703_10128952 3300026035 Bacteria 2181
208 Ga0207708_10026909 3300026075 Bacteria 4355
209 Ga0207641_10394453 3300026088 Bacteria 1328
210 Ga0207641_10439568 3300026088 Bacteria 1259
211 Ga0207648_10243982 3300026089 Bacteria 1600
212 Ga0207648_10290981 3300026089 Bacteria 1462
213 Ga0207648_11944237 3300026089 Bacteria 550
214 Ga0207674_10030478 3300026116 Bacteria 5670
215 Ga0207674_11323370 3300026116 Bacteria 690
216 Ga0207674_12072094 3300026116 Bacteria 533
217 Ga0207683_10044074 3300026121 Bacteria 3900
218 Ga0207683_11236167 3300026121 Bacteria 692
219 Ga0209984_1014774 3300027424 Bacteria 1034
220 Ga0209968_1028062 3300027526 Bacteria 934
221 Ga0209983_1005487 3300027665 Bacteria 2624
222 Ga0209971_1026734 3300027682 Bacteria 1379
223 Ga0207428_10007402 3300027907 Bacteria 10011
224 Ga0268266_10135051 3300028379 Bacteria 2209
225 Ga0268265_12169568 3300028380 Unclassified 562
226 Ga0268264_10113347 3300028381 Bacteria 2379
227 Ga0268264_11389286 3300028381 Bacteria 713
228 Ga0268264_11882053 3300028381 Bacteria 608
229 Ga0307408_100477045 3300031548 Bacteria 1087
230 Ga0307408_100805484 3300031548 Unclassified 853
231 Ga0307405_10369826 3300031731 Bacteria 1112
232 Ga0307405_10701994 3300031731 Bacteria 838
233 Ga0307405_11188765 3300031731 Bacteria 659
234 Ga0307410_10136645 3300031852 Bacteria 1808
235 Ga0307410_10276029 3300031852 Bacteria 1317
236 Ga0307407_10230341 3300031903 Bacteria 1258
237 Ga0307412_10539232 3300031911 Bacteria 978
238 Ga0307409_100394462 3300031995 Bacteria 1320
239 Ga0307416_100199197 3300032002 Bacteria 1898
240 Ga0307416_100847678 3300032002 Bacteria 1012
241 Ga0307416_100918175 3300032002 Bacteria 976
242 Ga0307416_100983565 3300032002 Bacteria 946
243 Ga0307411_10596774 3300032005 Bacteria 949
244 Ga0307415_100333813 3300032126 Bacteria 1270
245 Ga0307415_100684227 3300032126 Bacteria 924
246 Ga0316585_10197416 3300032137 Bacteria 665
247 Ga0373929_0007694 3300035085 Bacteria 1972
248 Ga0373955_0012938 3300035172 Bacteria 4023
249 Ga0373933_0078584 3300035724 Bacteria 2019
250 Ga0373937_0433097 3300036401 Bacteria 1248
251 Ga0436365_0957981 3300039437 Unclassified 803
252 Ga0436365_1259029 3300039437 Bacteria 5053
253 Ga0439439_0065298 3300041406 Bacteria 970
254 Ga0439447_058877 3300041407 Bacteria 906
255 Ga0439453_0097922 3300041408 Bacteria 651
256 Ga0451787_486295 3300041441 Bacteria 884
257 Ga0451800_0712119 3300041459 Bacteria 779
258 Ga0451835_0692283 3300041492 Bacteria 509
259 Ga0451853_2468511 3300041512 Bacteria 1299
260 Ga0453683_0224094 3300044673 Bacteria 1196
261 Ga0466959_1122720 3300045049 Bacteria 523
262 Ga0451576_1135762 3300045051 Bacteria 817
263 Ga0495662_0167882 3300046476 Bacteria 1081
264 Ga0495608_0004050 3300046511 Bacteria 10517
265 Ga0495628_0014106 3300046516 Bacteria 6708
266 Ga0495587_0697533 3300046536 Bacteria 556
267 Ga0495598_0052644 3300046537 Bacteria 1231
268 Ga0495598_0174138 3300046537 Bacteria 764
269 Ga0495621_0013407 3300046539 Bacteria 2574
270 Ga0495645_0002145 3300046543 Bacteria 13389
271 Ga0495633_0406365 3300046558 Unclassified 616
272 Ga0495667_0028742 3300046559 Bacteria 3744
273 Ga0495657_0062767 3300046675 Bacteria 2453
274 Ga0495599_0017376 3300046678 Bacteria 4472
275 Ga0495623_0098117 3300046679 Bacteria 1789
276 Ga0495646_0144290 3300046680 Bacteria 1329
277 Ga0495669_0146114 3300046684 Bacteria 1118
278 Ga0495613_0862412 3300046689 Unclassified 588
279 Ga0495670_0338536 3300046691 Bacteria 809
280 Ga0495671_0346278 3300046692 Bacteria 713
281 Ga0495600_0254959 3300046809 Bacteria 1115
282 Ga0495581_0907040 3300047315 Bacteria 503
283 Ga0495675_0206476 3300047444 Bacteria 1194
284 Ga0495602_0121941 3300048088 Bacteria 2096
285 Ga0496108_0748180 3300048911 Bacteria 846
286 Ga0501036_0574719 3300049572 Unclassified 936
287 nmdc:mga0k408_111551_c1 3300050493 Bacteria 1616
288 nmdc:mga0k408_24159_c1 3300050493 Bacteria 3434
289 nmdc:mga05p37_646199_c1 3300050507 Bacteria 1185
290 nmdc:mga09592_111891_c1 3300050508 Bacteria 2342
291 nmdc:mga08y16_11124_c1 3300050511 Bacteria 9451
292 nmdc:mga08y16_1118891_c1 3300050511 Bacteria 762
293 nmdc:mga0n895_679365_c1 3300050512 Bacteria 1027
294 nmdc:mga08x19_17667_c1 3300050514 Bacteria 4368
295 Ga0495601_0393886 3300053077 Bacteria 898
296 Ga0495619_0721880 3300053085 Bacteria 677
297 Ga0307408_100193351
298 Ga0065712_10186754
299 Ga0065712_10289906
300 Ga0070690_100159912
301 Ga0070690_100737106
302 Ga0070690_100826896
303 Ga0070670_100015842
304 Ga0068869_100305436
305 Ga0070682_101918474
306 Ga0068868_100341360
307 Ga0068868_101092021
308 Ga0070689_100011824
309 Ga0070689_100208742
310 Ga0070689_100404374
311 Ga0070689_100536189
312 Ga0070692_10350509
313 Ga0070692_10405396
314 Ga0070669_101077008
315 Ga0070675_100036731
316 Ga0070675_100133398
317 Ga0070675_101948803
318 Ga0070671_102035398
319 Ga0070674_100019984
320 Ga0070674_100274378
321 Ga0070674_102103074
322 Ga0070673_100094490
323 Ga0070673_101450663
324 Ga0070688_100064695
325 Ga0070659_101434026
326 Ga0070667_100257376
327 Ga0070709_10961213
328 Ga0070713_101410802
329 Ga0070701_10234402
330 Ga0070701_10501655
331 Ga0070701_10509542
332 Ga0070700_101094574
333 Ga0070708_100962508
334 Ga0070708_101077959
335 Ga0070678_100463985
336 Ga0070678_100767719
337 Ga0070678_100773469
338 Ga0070678_101319469
339 Ga0068867_100020082
340 Ga0068867_100441167
341 Ga0070707_100453113
342 Ga0070698_100337430
343 Ga0070699_100265146
344 Ga0070697_101167291
345 Ga0068853_100094084
346 Ga0070672_100581244
347 Ga0070686_100382587
348 Ga0070686_101075207
349 Ga0070695_100607597
350 Ga0070696_100375550
351 Ga0070696_101245498
352 Ga0070696_101495558
353 Ga0070693_100002260
354 Ga0070665_100065032
355 Ga0070704_100349919
356 Ga0070664_100460145
357 Ga0068857_102292974
358 Ga0068854_100544257
359 Ga0070702_101063854
360 Ga0068852_101527763
361 Ga0068859_100058550
362 Ga0068859_100694812
363 Ga0068859_100980979
364 Ga0068859_101456666
365 Ga0068859_102752586
366 Ga0068864_100780215
367 Ga0068866_10389406
368 Ga0068861_100340394
369 Ga0068861_100419614
370 Ga0068851_10239086
371 Ga0068870_11309572
372 Ga0068863_100118075
373 Ga0068863_100194260
374 Ga0068858_100011090
375 Ga0068858_100117647
376 Ga0068860_100511229
377 Ga0068862_101336839
378 Ga0075364_11132179
379 Ga0070715_10253039
380 Ga0070715_10340008
381 Ga0075366_10010793
382 Ga0075366_10136116
383 Ga0097621_100004904
384 Ga0097621_100067049
385 Ga0097621_100445639
386 Ga0097621_100480657
387 Ga0097621_100518407
388 Ga0075370_10153296
389 Ga0068871_100012235
390 Ga0068871_100061996
391 Ga0068871_101558125
392 Ga0075428_100041048
393 Ga0075431_101669611
394 Ga0075434_100716830
395 Ga0075429_101795337
396 Ga0068865_100192395
397 Ga0075436_100015869
398 Ga0075436_100340730
399 Ga0097620_100058551
400 Ga0097620_100694874
401 Ga0097620_100980973
402 Ga0097620_101456581
403 Ga0097620_102753882
404 Ga0099794_10705418
405 Ga0105240_10146041
406 Ga0105240_10979294
407 Ga0111539_10001299
408 Ga0111539_10762965
409 Ga0105245_10082983
410 Ga0105245_10112109
411 Ga0105245_10411423
412 Ga0105245_11574174
413 Ga0105243_10071555
414 Ga0105243_10497080
415 Ga0105242_10015783
416 Ga0105242_10045746
417 Ga0105242_10468359
418 Ga0105248_10023772
419 Ga0105248_10092818
420 Ga0105248_10232069
421 Ga0105248_11369696
422 Ga0105248_11971907
423 Ga0105237_10141065
424 Ga0105238_10103920
425 Ga0105238_11111652
426 Ga0105238_11625308
427 Ga0105238_12405142
428 Ga0105238_12519652
429 Ga0105238_12946459
430 Ga0105249_10542549
431 Ga0105249_10546651
432 Ga0157374_10137446
433 Ga0157374_10340597
434 Ga0157374_11069867
435 Ga0157378_10366677
436 Ga0157378_10497890
437 Ga0157378_10751805
438 Ga0157378_10817010
439 Ga0157378_11236810
440 Ga0163162_10419813
441 Ga0163162_10937714
442 Ga0163162_11245422
443 Ga0157372_12170925
444 Ga0157375_10375305
445 Ga0157380_10496419
446 Ga0157380_11482897
447 Ga0157377_10141698
448 Ga0157379_10165816
449 Ga0157379_10210250
450 Ga0157376_10176990
451 Ga0213876_10336027
452 Ga0207682_10227137
453 Ga0207642_10669692
454 Ga0207642_11006231
455 Ga0207688_10014116
456 Ga0207643_10328769
457 Ga0207654_11329498
458 Ga0207695_10194601
459 Ga0207694_10295662
460 Ga0207694_11434065
461 Ga0207650_10116994
462 Ga0207659_10353894
463 Ga0207659_10725961
464 Ga0207659_11407214
465 Ga0207687_10029585
466 Ga0207687_10248357
467 Ga0207687_10417307
468 Ga0207687_11355279
469 Ga0207700_10333788
470 Ga0207706_10188244
471 Ga0207686_10005092
472 Ga0207686_10028329
473 Ga0207686_10029135
474 Ga0207686_10653979
475 Ga0207709_10060282
476 Ga0207709_10361340
477 Ga0207670_10024813
478 Ga0207670_10025627
479 Ga0207670_10330041
480 Ga0207670_10596008
481 Ga0207669_10034547
482 Ga0207704_10061750
483 Ga0207665_10375703
484 Ga0207691_10088010
485 Ga0207691_10866230
486 Ga0207711_10130155
487 Ga0207711_10137836
488 Ga0207711_10265919
489 Ga0207689_10133513
490 Ga0207689_10463546
491 Ga0207689_11113913
492 Ga0207661_11277343
493 Ga0207679_11293939
494 Ga0207651_10241215
495 Ga0207651_10683141
496 Ga0207712_10396054
497 Ga0207712_10603793
498 Ga0207640_10446730
499 Ga0207658_10526650
500 Ga0207658_11060630
501 Ga0207677_10873390
502 Ga0207703_10050864
503 Ga0207703_10128952
504 Ga0207708_10026909
505 Ga0207641_10394453
506 Ga0207641_10439568
507 Ga0207648_10243982
508 Ga0207648_10290981
509 Ga0207648_11944237
510 Ga0207674_10030478
511 Ga0207674_11323370
512 Ga0207674_12072094
513 Ga0207683_10044074
514 Ga0207683_11236167
515 Ga0209984_1014774
516 Ga0209968_1028062
517 Ga0209983_1005487
518 Ga0209971_1026734
519 Ga0207428_10007402
520 Ga0268266_10135051
521 Ga0268265_12169568
522 Ga0268264_10113347
523 Ga0268264_11389286
524 Ga0268264_11882053
525 Ga0307408_100477045
526 Ga0307408_100805484
527 Ga0307405_10369826
528 Ga0307405_10701994
529 Ga0307405_11188765
530 Ga0307410_10136645
531 Ga0307410_10276029
532 Ga0307407_10230341
533 Ga0307412_10539232
534 Ga0307409_100394462
535 Ga0307416_100199197
536 Ga0307416_100847678
537 Ga0307416_100918175
538 Ga0307416_100983565
539 Ga0307411_10596774
540 Ga0307415_100333813
541 Ga0307415_100684227
542 Ga0316585_10197416
543 Ga0373929_0007694
544 Ga0373955_0012938
545 Ga0373933_0078584
546 Ga0373937_0433097
547 Ga0436365_0957981
548 Ga0436365_1259029
549 Ga0439439_0065298
550 Ga0439447_058877
551 Ga0439453_0097922
552 Ga0451787_486295
553 Ga0451800_0712119
554 Ga0451835_0692283
555 Ga0451853_2468511
556 Ga0453683_0224094
557 Ga0466959_1122720
558 Ga0451576_1135762
559 Ga0495662_0167882
560 Ga0495608_0004050
561 Ga0495628_0014106
562 Ga0495587_0697533
563 Ga0495598_0052644
564 Ga0495598_0174138
565 Ga0495621_0013407
566 Ga0495645_0002145
567 Ga0495633_0406365
568 Ga0495667_0028742
569 Ga0495657_0062767
570 Ga0495599_0017376
571 Ga0495623_0098117
572 Ga0495646_0144290
573 Ga0495669_0146114
574 Ga0495613_0862412
575 Ga0495670_0338536
576 Ga0495671_0346278
577 Ga0495600_0254959
578 Ga0495581_0907040
579 Ga0495675_0206476
580 Ga0495602_0121941
581 Ga0496108_0748180
582 Ga0501036_0574719
583 nmdc:mga0k408_111551_c1
584 nmdc:mga0k408_24159_c1
585 nmdc:mga05p37_646199_c1
586 nmdc:mga09592_111891_c1
587 nmdc:mga08y16_11124_c1
588 nmdc:mga08y16_1118891_c1
589 nmdc:mga0n895_679365_c1
590 nmdc:mga08x19_17667_c1
591 Ga0495601_0393886
592 Ga0495619_0721880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01127

Sdh_cyt

Succinate dehydrogenase/Fumarate reductase transmembrane subunit

5

113

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.891 14 117
2wdr-assembly1.cif.gz_D e. coli succinate:quinone oxidoreductase (sqr) with pentachlorophenol bound 0.8876 14 117
2wdq-assembly3.cif.gz_H e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound 0.8858 14 117
2ws3-assembly3.cif.gz_D crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd tyr83phe mutant 0.8839 14 117
7jz2-assembly1.cif.gz_D succinate: quinone oxidoreductase sqr from e.coli k12 0.8776 17 117
ID Description Score Start End Superfamily
2wu5L00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.891 14 117 1.20.1300.10
2wdrL00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8874 14 117 1.20.1300.10
2wdqD00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8858 14 117 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8837 14 117 1.20.1300.10
2wu5L00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.8756 14 117 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A6N9SNN3-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9505 31 115 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872
AF-A0A4Q3G7E5-F1-model_v4 deleted 0.9372 29 115
AF-A0A6N9SNN3-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9296 31 115 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872
AF-G2JBZ0-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9253 28 116 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872
AF-A0A849SXG0-F1-model_v4 Succinate dehydrogenase hydrophobic membrane anchor subunit 0.9226 16 117 GO:0005886
GO:0006099
GO:0009055
GO:0017004
GO:0020037
GO:0046872

Map