F392678

General Info

Members Datasets Scaffolds Average Seq Length
295 167 590 320

Family's Representative Sequence

Representative Sequence 3300025926|Ga0207659_10356677|Ga0207659_103566771
Length 334
Sequence MGDSTLNFARGRGMRRTGTCVVLACALVALPAVAQVRPFPTGPITLVVPLAPGDAADIAARALGEELSRLLKTPVVSINRPGAGGAVGTQNVVQAKKDGHTILFAQNSALTLRAVLDPQSVPYDALRDLLPLGTASRTPSLLVVRGDAPYKTFAELIEYAKSRPGQVRIGHPGVGSVGDFCVQSINALTGADLVGIPFVGAAPATVALRGEHIEGVVLSLGALSSQLRSGAFRGLVTSSRYPEFGDIPTMRELGYQEDLFGIWFSFLAPAGIPESARDALVVAIEQAVNAPALAARLASLGILLKYATPEQTTTEIRTESRRVGDIARKTGLVK

Samples

Sample ID Description Type Environment
1 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
112 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
113 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
114 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
115 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
116 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
123 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
126 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
127 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
128 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
129 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
130 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
131 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
132 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
146 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
147 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
148 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
149 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
150 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
153 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
155 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
156 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
157 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
158 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
159 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
160 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
161 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
162 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
163 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.36
Rhizosphere 98.64
Stem 0
Stem Tuber 0
Unclassified 7.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207659_10356677 3300025926 Bacteria 1214
2 Ga0065715_10140597 3300005293 Bacteria 1859
3 Ga0070676_10000120 3300005328 Bacteria 29193
4 Ga0070676_10090548 3300005328 Bacteria 1873
5 Ga0070690_100032646 3300005330 Bacteria 3253
6 Ga0070690_100129594 3300005330 Bacteria 1702
7 Ga0070670_100004119 3300005331 Bacteria 12150
8 Ga0070670_100015703 3300005331 Bacteria 6500
9 Ga0070670_100045238 3300005331 Bacteria 3783
10 Ga0070670_100067970 3300005331 Bacteria 3058
11 Ga0070670_100102421 3300005331 Unclassified 2466
12 Ga0070670_100205542 3300005331 Bacteria 1711
13 Ga0070677_10002913 3300005333 Bacteria 5495
14 Ga0070677_10091519 3300005333 Bacteria 1324
15 Ga0068869_100006624 3300005334 Bacteria 7351
16 Ga0070666_10008381 3300005335 Bacteria 6415
17 Ga0070666_10087392 3300005335 Bacteria 2137
18 Ga0070680_100170743 3300005336 Bacteria 1830
19 Ga0068868_100022046 3300005338 Bacteria 4803
20 Ga0070689_100173545 3300005340 Bacteria 1748
21 Ga0070687_100017845 3300005343 Bacteria 3273
22 Ga0070661_100007683 3300005344 Bacteria 7446
23 Ga0070668_100002714 3300005347 Bacteria 13023
24 Ga0070669_100007091 3300005353 Bacteria 8052
25 Ga0070669_100067855 3300005353 Plasmid 2632
26 Ga0070675_100014591 3300005354 Bacteria 6196
27 Ga0070675_100030275 3300005354 Bacteria 4369
28 Ga0070675_100087875 3300005354 Bacteria 2600
29 Ga0070671_100000628 3300005355 Bacteria 25190
30 Ga0070671_100012524 3300005355 Bacteria 6830
31 Ga0070671_100139436 3300005355 Bacteria 2046
32 Ga0070674_100025857 3300005356 Bacteria 3826
33 Ga0070674_100028210 3300005356 Bacteria 3686
34 Ga0070674_100413661 3300005356 Unclassified 1105
35 Ga0070674_100474299 3300005356 Unclassified 1037
36 Ga0070673_100012812 3300005364 Bacteria 5771
37 Ga0070673_100168280 3300005364 Bacteria 1869
38 Ga0070673_100302257 3300005364 Bacteria 1409
39 Ga0070667_100037872 3300005367 Bacteria 4044
40 Ga0070700_100009372 3300005441 Bacteria 5370
41 Ga0070663_100015313 3300005455 Bacteria 4947
42 Ga0070663_100044242 3300005455 Bacteria 3137
43 Ga0070678_100045216 3300005456 Bacteria 3148
44 Ga0070678_100055969 3300005456 Bacteria 2882
45 Ga0070678_100059768 3300005456 Bacteria 2802
46 Ga0070678_100230580 3300005456 Bacteria 1544
47 Ga0070662_100003878 3300005457 Bacteria 9374
48 Ga0068867_100000533 3300005459 Bacteria 25085
49 Ga0068867_100106130 3300005459 Bacteria 2151
50 Ga0068867_100355359 3300005459 Archaea 1224
51 Ga0070685_10035020 3300005466 Bacteria 2831
52 Ga0070707_100278783 3300005468 Unclassified 1625
53 Ga0068853_100088611 3300005539 Bacteria 2717
54 Ga0068853_100324631 3300005539 Bacteria 1427
55 Ga0070672_100001675 3300005543 Bacteria 13810
56 Ga0070672_100025260 3300005543 Bacteria 4403
57 Ga0070672_100031646 3300005543 Bacteria 3984
58 Ga0070672_100066630 3300005543 Bacteria 2851
59 Ga0070672_100083451 3300005543 Bacteria 2564
60 Ga0070672_100325160 3300005543 Bacteria 1308
61 Ga0070695_100127974 3300005545 Bacteria 1747
62 Ga0070665_100383251 3300005548 Bacteria 1413
63 Ga0070664_100003132 3300005564 Bacteria 13367
64 Ga0070664_100037004 3300005564 Bacteria 4101
65 Ga0068852_100019051 3300005616 Bacteria 5422
66 Ga0068852_100028558 3300005616 Bacteria 4568
67 Ga0068852_100189514 3300005616 Bacteria 1939
68 Ga0068852_100308943 3300005616 Bacteria 1532
69 Ga0068852_100489199 3300005616 Bacteria 1224
70 Ga0068864_100025057 3300005618 Bacteria 5022
71 Ga0068864_100027232 3300005618 Bacteria 4825
72 Ga0068864_100071478 3300005618 Bacteria 3021
73 Ga0068864_100105921 3300005618 Bacteria 2500
74 Ga0068864_100204175 3300005618 Bacteria 1817
75 Ga0068864_100270462 3300005618 Bacteria 1583
76 Ga0068864_100338525 3300005618 Bacteria 1417
77 Ga0068864_100416287 3300005618 Bacteria 1280
78 Ga0068861_100031391 3300005719 Bacteria 3903
79 Ga0068861_100040021 3300005719 Bacteria 3502
80 Ga0068851_10005468 3300005834 Bacteria 5763
81 Ga0068851_10080636 3300005834 Bacteria 1699
82 Ga0068863_100127133 3300005841 Bacteria 2432
83 Ga0068863_100218056 3300005841 Bacteria 1838
84 Ga0068858_100000628 3300005842 Bacteria 36756
85 Ga0068858_100415785 3300005842 Bacteria 1293
86 Ga0068860_100028136 3300005843 Bacteria 5411
87 Ga0068860_100273847 3300005843 Bacteria 1648
88 Ga0068862_100304297 3300005844 Bacteria 1467
89 Ga0081538_10031998 3300005981 Unclassified 3536
90 Ga0070716_100054080 3300006173 Bacteria 2292
91 Ga0097621_100121060 3300006237 Bacteria 2220
92 Ga0068871_100010101 3300006358 Bacteria 6869
93 Ga0068871_100043967 3300006358 Bacteria 3590
94 Ga0068871_100077293 3300006358 Bacteria 2751
95 Ga0068871_100103448 3300006358 Bacteria 2388
96 Ga0075428_100126964 3300006844 Unclassified 2775
97 Ga0075430_100319338 3300006846 Bacteria 1284
98 Ga0075431_100079192 3300006847 Unclassified 3392
99 Ga0075433_10025330 3300006852 Bacteria 5013
100 Ga0075434_100338467 3300006871 Bacteria 1525
101 Ga0075429_100145094 3300006880 Unclassified 2078
102 Ga0068865_100378297 3300006881 Bacteria 1154
103 Ga0075436_100006240 3300006914 Bacteria 8167
104 Ga0075436_100089365 3300006914 Unclassified 2140
105 Ga0105240_10144883 3300009093 Bacteria 2836
106 Ga0111539_10015257 3300009094 Bacteria 9568
107 Ga0111539_10109756 3300009094 Bacteria 3237
108 Ga0105243_10011942 3300009148 Bacteria 6565
109 Ga0105243_10309218 3300009148 Bacteria 1435
110 Ga0105242_10005966 3300009176 Bacteria 9394
111 Ga0105248_10002397 3300009177 Bacteria 20826
112 Ga0105248_10029992 3300009177 Bacteria 6070
113 Ga0105248_10072616 3300009177 Bacteria 3867
114 Ga0105248_10075958 3300009177 Bacteria 3776
115 Ga0105248_10220156 3300009177 Bacteria 2137
116 Ga0105249_10045863 3300009553 Bacteria 3977
117 Ga0105249_10047806 3300009553 Bacteria 3899
118 Ga0157370_10277278 3300013104 Bacteria 1549
119 Ga0157374_10167611 3300013296 Bacteria 2141
120 Ga0157378_10044043 3300013297 Bacteria 3962
121 Ga0157378_10101533 3300013297 Bacteria 2627
122 Ga0157372_10422385 3300013307 Bacteria 1554
123 Ga0157375_10002541 3300013308 Bacteria 15830
124 Ga0157375_10067838 3300013308 Bacteria 3565
125 Ga0157375_10194776 3300013308 Bacteria 2182
126 Ga0157375_10205174 3300013308 Bacteria 2127
127 Ga0157375_10482821 3300013308 Bacteria 1404
128 Ga0163163_10441487 3300014325 Bacteria 1361
129 Ga0157380_10027978 3300014326 Bacteria 4294
130 Ga0157380_10112221 3300014326 Bacteria 2293
131 Ga0157380_10206065 3300014326 Bacteria 1749
132 Ga0157379_10000439 3300014968 Bacteria 33735
133 Ga0157379_10013745 3300014968 Bacteria 7096
134 Ga0157379_10037289 3300014968 Bacteria 4334
135 Ga0157379_10376720 3300014968 Bacteria 1302
136 Ga0157376_10131333 3300014969 Bacteria 2235
137 Ga0157376_10197566 3300014969 Bacteria 1848
138 Ga0157376_10304519 3300014969 Bacteria 1510
139 Ga0163161_10000775 3300017792 Bacteria 25135
140 Ga0207656_10016496 3300025321 Bacteria 2876
141 Ga0207682_10002273 3300025893 Bacteria 8657
142 Ga0207682_10019807 3300025893 Bacteria 2637
143 Ga0207642_10022327 3300025899 Bacteria 2507
144 Ga0207688_10042958 3300025901 Bacteria 2517
145 Ga0207680_10102933 3300025903 Bacteria 1838
146 Ga0207645_10005149 3300025907 Bacteria 9559
147 Ga0207645_10074157 3300025907 Bacteria 2178
148 Ga0207705_10052581 3300025909 Bacteria 2933
149 Ga0207662_10007704 3300025918 Bacteria 5866
150 Ga0207649_10060329 3300025920 Bacteria 2383
151 Ga0207681_10004662 3300025923 Bacteria 8430
152 Ga0207681_10241011 3300025923 Bacteria 1407
153 Ga0207650_10001313 3300025925 Bacteria 18002
154 Ga0207650_10032313 3300025925 Bacteria 3785
155 Ga0207650_10051194 3300025925 Bacteria 3056
156 Ga0207650_10065090 3300025925 Bacteria 2730
157 Ga0207659_10001778 3300025926 Bacteria 12723
158 Ga0207659_10054210 3300025926 Bacteria 2863
159 Ga0207659_10135094 3300025926 Bacteria 1908
160 Ga0207644_10000236 3300025931 Bacteria 37953
161 Ga0207644_10041252 3300025931 Bacteria 3264
162 Ga0207644_10054071 3300025931 Bacteria 2891
163 Ga0207706_10003736 3300025933 Bacteria 14517
164 Ga0207706_10139353 3300025933 Bacteria 2134
165 Ga0207706_10171984 3300025933 Bacteria 1903
166 Ga0207686_10013835 3300025934 Bacteria 4475
167 Ga0207709_10018555 3300025935 Bacteria 3898
168 Ga0207669_10000310 3300025937 Bacteria 22249
169 Ga0207669_10086959 3300025937 Bacteria 2023
170 Ga0207704_10063615 3300025938 Bacteria 2300
171 Ga0207704_10074845 3300025938 Bacteria 2163
172 Ga0207691_10000347 3300025940 Bacteria 46651
173 Ga0207691_10013821 3300025940 Bacteria 7709
174 Ga0207691_10016786 3300025940 Bacteria 6947
175 Ga0207691_10021125 3300025940 Bacteria 6151
176 Ga0207691_10032394 3300025940 Bacteria 4872
177 Ga0207691_10046575 3300025940 Bacteria 3983
178 Ga0207691_10121957 3300025940 Bacteria 2309
179 Ga0207691_10157314 3300025940 Bacteria 1995
180 Ga0207711_10005379 3300025941 Bacteria 10836
181 Ga0207711_10016674 3300025941 Bacteria 6100
182 Ga0207711_10019379 3300025941 Bacteria 5666
183 Ga0207711_10021317 3300025941 Bacteria 5414
184 Ga0207711_10032529 3300025941 Bacteria 4410
185 Ga0207711_10116585 3300025941 Bacteria 2381
186 Ga0207689_10003033 3300025942 Bacteria 15481
187 Ga0207679_10020625 3300025945 Bacteria 4450
188 Ga0207679_10043204 3300025945 Bacteria 3244
189 Ga0207679_10474521 3300025945 Bacteria 1113
190 Ga0207651_10078214 3300025960 Bacteria 2371
191 Ga0207712_10022260 3300025961 Bacteria 4171
192 Ga0207668_10023865 3300025972 Bacteria 3939
193 Ga0207640_10193969 3300025981 Bacteria 1533
194 Ga0207658_10002417 3300025986 Bacteria 13671
195 Ga0207658_10145856 3300025986 Bacteria 1922
196 Ga0207677_10030501 3300026023 Bacteria 3443
197 Ga0207703_10002872 3300026035 Bacteria 14665
198 Ga0207639_10205241 3300026041 Bacteria 1693
199 Ga0207678_10047903 3300026067 Bacteria 3695
200 Ga0207641_10013689 3300026088 Bacteria 6657
201 Ga0207641_10041679 3300026088 Bacteria 3848
202 Ga0207641_10089165 3300026088 Bacteria 2695
203 Ga0207648_10001333 3300026089 Bacteria 27433
204 Ga0207648_10517250 3300026089 Unclassified 1093
205 Ga0207676_10017659 3300026095 Bacteria 5174
206 Ga0207676_10024790 3300026095 Bacteria 4443
207 Ga0207676_10046813 3300026095 Bacteria 3349
208 Ga0207676_10104192 3300026095 Bacteria 2359
209 Ga0207675_100000927 3300026118 Bacteria 29280
210 Ga0207675_100040110 3300026118 Bacteria 4370
211 Ga0207675_100672384 3300026118 Bacteria 1043
212 Ga0207683_10011972 3300026121 Bacteria 7405
213 Ga0207683_10028832 3300026121 Bacteria 4803
214 Ga0207683_10076948 3300026121 Bacteria 2954
215 Ga0207683_10096629 3300026121 Bacteria 2634
216 Ga0207698_10033583 3300026142 Bacteria 3730
217 Ga0207698_10149653 3300026142 Bacteria 2024
218 Ga0207698_10239971 3300026142 Bacteria 1651
219 Ga0207428_10038176 3300027907 Unclassified 3905
220 Ga0268266_10069251 3300028379 Bacteria 3057
221 Ga0268266_10078818 3300028379 Bacteria 2867
222 Ga0268264_10262175 3300028381 Bacteria 1610
223 Ga0307408_100064031 3300031548 Bacteria 2692
224 Ga0307405_10318933 3300031731 Bacteria 1186
225 Ga0307411_10080089 3300032005 Bacteria 2245
226 Ga0373934_0000269 3300035086 Bacteria 18636
227 Ga0373954_0014746 3300035118 Bacteria 3487
228 Ga0373956_0001009 3300035119 Bacteria 11611
229 Ga0373957_0009023 3300035120 Bacteria 3252
230 Ga0373942_0050142 3300035207 Bacteria 1168
231 Ga0373961_0012911 3300035241 Bacteria 2098
232 Ga0373933_0000759 3300035724 Bacteria 19748
233 Ga0373937_0000931 3300036401 Bacteria 24797
234 Ga0373937_0034539 3300036401 Unclassified 4600
235 Ga0451577_0011785 3300042876 Bacteria 8251
236 Ga0495651_0000314 3300046462 Bacteria 37543
237 Ga0495628_0001377 3300046516 Bacteria 22309
238 Ga0495628_0008876 3300046516 Bacteria 8601
239 Ga0495652_0001770 3300046529 Bacteria 23136
240 Ga0495652_0046109 3300046529 Bacteria 3743
241 Ga0495621_0033800 3300046539 Bacteria 1765
242 Ga0495645_0000216 3300046543 Bacteria 41409
243 Ga0495656_0001682 3300046615 Bacteria 7237
244 Ga0495657_0152024 3300046675 Bacteria 1437
245 Ga0495599_0000176 3300046678 Bacteria 42077
246 Ga0495670_0062571 3300046691 Bacteria 1873
247 Ga0495614_0064539 3300048089 Bacteria 1575
248 Ga0496108_0108784 3300048911 Bacteria 2368
249 Ga0496109_0064511 3300048912 Bacteria 3352
250 Ga0496110_0270834 3300048913 Bacteria 1546
251 Ga0496114_0414841 3300048917 Bacteria 1192
252 Ga0501033_0277173 3300049570 Unclassified 1184
253 Ga0501036_0034150 3300049572 Bacteria 4302
254 Ga0501037_0052197 3300049573 Bacteria 2991
255 Ga0501039_0002376 3300049575 Bacteria 14017
256 Ga0501040_0001437 3300049576 Bacteria 15077
257 Ga0501041_0001040 3300049577 Bacteria 15197
258 Ga0501041_0087200 3300049577 Unclassified 1926
259 Ga0501042_0000034 3300049578 Bacteria 43770
260 Ga0501046_0016210 3300049580 Bacteria 6247
261 Ga0501068_0013530 3300049584 Unclassified 4643
262 Ga0501071_0030429 3300049587 Unclassified 3818
263 Ga0501072_0000420 3300049588 Bacteria 30352
264 Ga0501072_0058370 3300049588 Bacteria 3042
265 Ga0501074_0061947 3300049590 Bacteria 2695
266 Ga0501075_0000890 3300049591 Bacteria 18847
267 Ga0501076_0001870 3300049592 Bacteria 14342
268 Ga0501077_0000051 3300049593 Bacteria 61179
269 Ga0501079_0000789 3300049741 Bacteria 21567
270 Ga0501080_0012560 3300049742 Bacteria 7767
271 Ga0501081_0011058 3300049743 Bacteria 5901
272 Ga0501083_0009412 3300049744 Bacteria 6902
273 Ga0501035_0053268 3300049822 Unclassified 3619
274 Ga0501045_0001700 3300049824 Bacteria 14820
275 nmdc:mga05p37_32920_c1 3300050507 Bacteria 6345
276 nmdc:mga05p37_39352_c1 3300050507 Bacteria 5805
277 nmdc:mga05p37_495563_c1 3300050507 Unclassified 1404
278 nmdc:mga09592_32226_c1 3300050508 Unclassified 4369
279 nmdc:mga09592_74031_c1 3300050508 Unclassified 2894
280 nmdc:mga0qj67_17028_c1 3300050509 Bacteria 5521
281 nmdc:mga0qj67_98137_c1 3300050509 Bacteria 2360
282 nmdc:mga06r32_478876_c1 3300050510 Unclassified 1223
283 nmdc:mga06r32_51931_c1 3300050510 Unclassified 3925
284 nmdc:mga08y16_29311_c1 3300050511 Bacteria 5799
285 nmdc:mga0n895_73183_c1 3300050512 Bacteria 3402
286 nmdc:mga0rr50_80622_c1 3300050513 Bacteria 2510
287 nmdc:mga08x19_137620_c1 3300050514 Bacteria 1647
288 nmdc:mga08x19_18454_c1 3300050514 Bacteria 4275
289 nmdc:mga0a205_153992_c1 3300050515 Bacteria 2198
290 nmdc:mga0a205_4698_c1 3300050515 Bacteria 12263
291 Ga0495601_0012175 3300053077 Bacteria 5157
292 Ga0495601_0024334 3300053077 Bacteria 3729
293 Ga0501084_0001124 3300054114 Bacteria 20861
294 Ga0501082_0002379 3300060353 Bacteria 16478
295 Ga0530510_0002235 3300061734 Bacteria 13273
296 Ga0207659_10356677
297 Ga0065715_10140597
298 Ga0070676_10000120
299 Ga0070676_10090548
300 Ga0070690_100032646
301 Ga0070690_100129594
302 Ga0070670_100004119
303 Ga0070670_100015703
304 Ga0070670_100045238
305 Ga0070670_100067970
306 Ga0070670_100102421
307 Ga0070670_100205542
308 Ga0070677_10002913
309 Ga0070677_10091519
310 Ga0068869_100006624
311 Ga0070666_10008381
312 Ga0070666_10087392
313 Ga0070680_100170743
314 Ga0068868_100022046
315 Ga0070689_100173545
316 Ga0070687_100017845
317 Ga0070661_100007683
318 Ga0070668_100002714
319 Ga0070669_100007091
320 Ga0070669_100067855
321 Ga0070675_100014591
322 Ga0070675_100030275
323 Ga0070675_100087875
324 Ga0070671_100000628
325 Ga0070671_100012524
326 Ga0070671_100139436
327 Ga0070674_100025857
328 Ga0070674_100028210
329 Ga0070674_100413661
330 Ga0070674_100474299
331 Ga0070673_100012812
332 Ga0070673_100168280
333 Ga0070673_100302257
334 Ga0070667_100037872
335 Ga0070700_100009372
336 Ga0070663_100015313
337 Ga0070663_100044242
338 Ga0070678_100045216
339 Ga0070678_100055969
340 Ga0070678_100059768
341 Ga0070678_100230580
342 Ga0070662_100003878
343 Ga0068867_100000533
344 Ga0068867_100106130
345 Ga0068867_100355359
346 Ga0070685_10035020
347 Ga0070707_100278783
348 Ga0068853_100088611
349 Ga0068853_100324631
350 Ga0070672_100001675
351 Ga0070672_100025260
352 Ga0070672_100031646
353 Ga0070672_100066630
354 Ga0070672_100083451
355 Ga0070672_100325160
356 Ga0070695_100127974
357 Ga0070665_100383251
358 Ga0070664_100003132
359 Ga0070664_100037004
360 Ga0068852_100019051
361 Ga0068852_100028558
362 Ga0068852_100189514
363 Ga0068852_100308943
364 Ga0068852_100489199
365 Ga0068864_100025057
366 Ga0068864_100027232
367 Ga0068864_100071478
368 Ga0068864_100105921
369 Ga0068864_100204175
370 Ga0068864_100270462
371 Ga0068864_100338525
372 Ga0068864_100416287
373 Ga0068861_100031391
374 Ga0068861_100040021
375 Ga0068851_10005468
376 Ga0068851_10080636
377 Ga0068863_100127133
378 Ga0068863_100218056
379 Ga0068858_100000628
380 Ga0068858_100415785
381 Ga0068860_100028136
382 Ga0068860_100273847
383 Ga0068862_100304297
384 Ga0081538_10031998
385 Ga0070716_100054080
386 Ga0097621_100121060
387 Ga0068871_100010101
388 Ga0068871_100043967
389 Ga0068871_100077293
390 Ga0068871_100103448
391 Ga0075428_100126964
392 Ga0075430_100319338
393 Ga0075431_100079192
394 Ga0075433_10025330
395 Ga0075434_100338467
396 Ga0075429_100145094
397 Ga0068865_100378297
398 Ga0075436_100006240
399 Ga0075436_100089365
400 Ga0105240_10144883
401 Ga0111539_10015257
402 Ga0111539_10109756
403 Ga0105243_10011942
404 Ga0105243_10309218
405 Ga0105242_10005966
406 Ga0105248_10002397
407 Ga0105248_10029992
408 Ga0105248_10072616
409 Ga0105248_10075958
410 Ga0105248_10220156
411 Ga0105249_10045863
412 Ga0105249_10047806
413 Ga0157370_10277278
414 Ga0157374_10167611
415 Ga0157378_10044043
416 Ga0157378_10101533
417 Ga0157372_10422385
418 Ga0157375_10002541
419 Ga0157375_10067838
420 Ga0157375_10194776
421 Ga0157375_10205174
422 Ga0157375_10482821
423 Ga0163163_10441487
424 Ga0157380_10027978
425 Ga0157380_10112221
426 Ga0157380_10206065
427 Ga0157379_10000439
428 Ga0157379_10013745
429 Ga0157379_10037289
430 Ga0157379_10376720
431 Ga0157376_10131333
432 Ga0157376_10197566
433 Ga0157376_10304519
434 Ga0163161_10000775
435 Ga0207656_10016496
436 Ga0207682_10002273
437 Ga0207682_10019807
438 Ga0207642_10022327
439 Ga0207688_10042958
440 Ga0207680_10102933
441 Ga0207645_10005149
442 Ga0207645_10074157
443 Ga0207705_10052581
444 Ga0207662_10007704
445 Ga0207649_10060329
446 Ga0207681_10004662
447 Ga0207681_10241011
448 Ga0207650_10001313
449 Ga0207650_10032313
450 Ga0207650_10051194
451 Ga0207650_10065090
452 Ga0207659_10001778
453 Ga0207659_10054210
454 Ga0207659_10135094
455 Ga0207644_10000236
456 Ga0207644_10041252
457 Ga0207644_10054071
458 Ga0207706_10003736
459 Ga0207706_10139353
460 Ga0207706_10171984
461 Ga0207686_10013835
462 Ga0207709_10018555
463 Ga0207669_10000310
464 Ga0207669_10086959
465 Ga0207704_10063615
466 Ga0207704_10074845
467 Ga0207691_10000347
468 Ga0207691_10013821
469 Ga0207691_10016786
470 Ga0207691_10021125
471 Ga0207691_10032394
472 Ga0207691_10046575
473 Ga0207691_10121957
474 Ga0207691_10157314
475 Ga0207711_10005379
476 Ga0207711_10016674
477 Ga0207711_10019379
478 Ga0207711_10021317
479 Ga0207711_10032529
480 Ga0207711_10116585
481 Ga0207689_10003033
482 Ga0207679_10020625
483 Ga0207679_10043204
484 Ga0207679_10474521
485 Ga0207651_10078214
486 Ga0207712_10022260
487 Ga0207668_10023865
488 Ga0207640_10193969
489 Ga0207658_10002417
490 Ga0207658_10145856
491 Ga0207677_10030501
492 Ga0207703_10002872
493 Ga0207639_10205241
494 Ga0207678_10047903
495 Ga0207641_10013689
496 Ga0207641_10041679
497 Ga0207641_10089165
498 Ga0207648_10001333
499 Ga0207648_10517250
500 Ga0207676_10017659
501 Ga0207676_10024790
502 Ga0207676_10046813
503 Ga0207676_10104192
504 Ga0207675_100000927
505 Ga0207675_100040110
506 Ga0207675_100672384
507 Ga0207683_10011972
508 Ga0207683_10028832
509 Ga0207683_10076948
510 Ga0207683_10096629
511 Ga0207698_10033583
512 Ga0207698_10149653
513 Ga0207698_10239971
514 Ga0207428_10038176
515 Ga0268266_10069251
516 Ga0268266_10078818
517 Ga0268264_10262175
518 Ga0307408_100064031
519 Ga0307405_10318933
520 Ga0307411_10080089
521 Ga0373934_0000269
522 Ga0373954_0014746
523 Ga0373956_0001009
524 Ga0373957_0009023
525 Ga0373942_0050142
526 Ga0373961_0012911
527 Ga0373933_0000759
528 Ga0373937_0000931
529 Ga0373937_0034539
530 Ga0451577_0011785
531 Ga0495651_0000314
532 Ga0495628_0001377
533 Ga0495628_0008876
534 Ga0495652_0001770
535 Ga0495652_0046109
536 Ga0495621_0033800
537 Ga0495645_0000216
538 Ga0495656_0001682
539 Ga0495657_0152024
540 Ga0495599_0000176
541 Ga0495670_0062571
542 Ga0495614_0064539
543 Ga0496108_0108784
544 Ga0496109_0064511
545 Ga0496110_0270834
546 Ga0496114_0414841
547 Ga0501033_0277173
548 Ga0501036_0034150
549 Ga0501037_0052197
550 Ga0501039_0002376
551 Ga0501040_0001437
552 Ga0501041_0001040
553 Ga0501041_0087200
554 Ga0501042_0000034
555 Ga0501046_0016210
556 Ga0501068_0013530
557 Ga0501071_0030429
558 Ga0501072_0000420
559 Ga0501072_0058370
560 Ga0501074_0061947
561 Ga0501075_0000890
562 Ga0501076_0001870
563 Ga0501077_0000051
564 Ga0501079_0000789
565 Ga0501080_0012560
566 Ga0501081_0011058
567 Ga0501083_0009412
568 Ga0501035_0053268
569 Ga0501045_0001700
570 nmdc:mga05p37_32920_c1
571 nmdc:mga05p37_39352_c1
572 nmdc:mga05p37_495563_c1
573 nmdc:mga09592_32226_c1
574 nmdc:mga09592_74031_c1
575 nmdc:mga0qj67_17028_c1
576 nmdc:mga0qj67_98137_c1
577 nmdc:mga06r32_478876_c1
578 nmdc:mga06r32_51931_c1
579 nmdc:mga08y16_29311_c1
580 nmdc:mga0n895_73183_c1
581 nmdc:mga0rr50_80622_c1
582 nmdc:mga08x19_137620_c1
583 nmdc:mga08x19_18454_c1
584 nmdc:mga0a205_153992_c1
585 nmdc:mga0a205_4698_c1
586 Ga0495601_0012175
587 Ga0495601_0024334
588 Ga0501084_0001124
589 Ga0501082_0002379
590 Ga0530510_0002235

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

59

332

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9293 26 318
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9214 29 318
2qpq-assembly3.cif.gz_C structure of bug27 from bordetella pertussis 0.9171 27 318
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.9154 29 318
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.9141 26 318
ID Description Score Start End Superfamily
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9283 127 244 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9237 25 316 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9185 127 241 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9158 127 247 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8991 127 244 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A0Q5MFW9-F1-model_v4 ABC transporter substrate-binding protein 0.9669 26 321
AF-A0A1S8FWM4-F1-model_v4 deleted 0.9665 51 321
AF-A0A537SVJ2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.962 26 318
AF-A0A7H0GIP4-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9615 51 319
AF-A0A1S8FWM4-F1-model_v4 deleted 0.9596 51 321

Map