F392667

General Info

Members Datasets Scaffolds Average Seq Length
295 112 588 128

Family's Representative Sequence

Representative Sequence 3300025906|Ga0207699_10787872|Ga0207699_107878721
Length 154
Sequence VNSRKCATVLHYEQEGFKPVEGSRHREAVIIGERLRALREEKKLSQGEVENRTGLLRCYISRVENGHTVPAIETLEKFARALEVPMYQLFYDGENPPKVSDLPKRKTGADIEWGSKSKDARLIAQFCRLFGRMDKEDLTMVMFIARKMAKRKAV

Samples

Sample ID Description Type Environment
1 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
3 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
4 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
7 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
8 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
9 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
12 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
13 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
14 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
15 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
16 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
17 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
18 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
19 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
20 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
21 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
22 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
23 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
24 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
25 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
28 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
29 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
41 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
44 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
47 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
48 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
49 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
50 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
51 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
52 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
53 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
54 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
55 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
56 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
57 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
58 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
60 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
61 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
62 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
63 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
64 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
65 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
66 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
67 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
68 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
69 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
70 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
76 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
80 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
81 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
82 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
83 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
84 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
85 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
86 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
87 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
88 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
89 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
90 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
91 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
92 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
93 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
94 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
97 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
98 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
102 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
105 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
106 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
107 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
108 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
109 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
110 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
111 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
112 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 2.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.68
Rhizosphere 99.32
Stem 0
Stem Tuber 0
Unclassified 37.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207699_10787872 3300025906 Unclassified 698
2 Ga0070709_10015727 3300005434 Bacteria 4308
3 Ga0070709_10054667 3300005434 Bacteria 2518
4 Ga0070709_10449794 3300005434 Unclassified 970
5 Ga0070713_100079794 3300005436 Bacteria 2789
6 Ga0070713_100146422 3300005436 Bacteria 2097
7 Ga0070710_10639656 3300005437 Unclassified 744
8 Ga0070681_10522534 3300005458 Bacteria 1100
9 Ga0070707_100115786 3300005468 Bacteria 2602
10 Ga0070698_100083379 3300005471 Bacteria 3186
11 Ga0070698_100463851 3300005471 Bacteria 1203
12 Ga0070699_100046842 3300005518 Bacteria 3741
13 Ga0070697_100019914 3300005536 Bacteria 5303
14 Ga0070697_100384920 3300005536 Bacteria 1215
15 Ga0070697_100477952 3300005536 Bacteria 1088
16 Ga0068855_100654059 3300005563 Bacteria 1128
17 Ga0070715_10210171 3300006163 Unclassified 994
18 Ga0070716_100001687 3300006173 Bacteria 9972
19 Ga0070716_100003791 3300006173 Bacteria 7167
20 Ga0070716_100022106 3300006173 Bacteria 3359
21 Ga0070716_100031265 3300006173 Bacteria 2894
22 Ga0070712_100066767 3300006175 Unclassified 2558
23 Ga0070712_101796074 3300006175 Unclassified 537
24 Ga0097621_100368619 3300006237 Unclassified 1281
25 Ga0075434_100201740 3300006871 Bacteria 2009
26 Ga0075436_100056217 3300006914 Bacteria 2718
27 Ga0099794_10059200 3300007265 Bacteria 1858
28 Ga0099794_10060989 3300007265 Bacteria 1832
29 Ga0099794_10172630 3300007265 Bacteria 1102
30 Ga0099794_10222367 3300007265 Unclassified 970
31 Ga0099794_10264657 3300007265 Bacteria 888
32 Ga0099794_10269415 3300007265 Unclassified 880
33 Ga0099794_10309739 3300007265 Unclassified 818
34 Ga0099794_10393390 3300007265 Unclassified 724
35 Ga0099795_10016163 3300007788 Bacteria 2354
36 Ga0105240_10079296 3300009093 Unclassified 4041
37 Ga0105240_10099626 3300009093 Bacteria 3537
38 Ga0105240_10208706 3300009093 Bacteria 2284
39 Ga0105245_10016896 3300009098 Bacteria 6370
40 Ga0105247_10081171 3300009101 Bacteria 2044
41 Ga0105247_10102687 3300009101 Bacteria 1830
42 Ga0105246_11994468 3300011119 Unclassified 560
43 Ga0157370_10440368 3300013104 Bacteria 1198
44 Ga0157374_10017840 3300013296 Bacteria 6254
45 Ga0157378_10005990 3300013297 Bacteria 10657
46 Ga0157379_10108091 3300014968 Bacteria 2497
47 Ga0157379_10902595 3300014968 Unclassified 838
48 Ga0157379_11748221 3300014968 Unclassified 610
49 Ga0157376_10665512 3300014969 Unclassified 1043
50 Ga0228598_1002080 3300024227 Bacteria 4373
51 Ga0207692_10415944 3300025898 Unclassified 841
52 Ga0207710_10061811 3300025900 Bacteria 1700
53 Ga0207699_10009321 3300025906 Bacteria 4883
54 Ga0207699_10021446 3300025906 Bacteria 3482
55 Ga0207699_10043055 3300025906 Bacteria 2621
56 Ga0207684_10198273 3300025910 Bacteria 1732
57 Ga0207684_10748609 3300025910 Bacteria 828
58 Ga0207707_10427656 3300025912 Bacteria 1135
59 Ga0207695_10071566 3300025913 Bacteria 3541
60 Ga0207695_10363523 3300025913 Bacteria 1333
61 Ga0207693_10043312 3300025915 Bacteria 3541
62 Ga0207646_10000015 3300025922 Bacteria 337243
63 Ga0207646_10233536 3300025922 Bacteria 1662
64 Ga0207687_10010552 3300025927 Bacteria 6037
65 Ga0207700_10316929 3300025928 Bacteria 1350
66 Ga0207700_11762071 3300025928 Unclassified 545
67 Ga0207665_10000103 3300025939 Bacteria 55197
68 Ga0207665_10005164 3300025939 Bacteria 8721
69 Ga0207665_10033963 3300025939 Bacteria 3384
70 Ga0207665_10041924 3300025939 Bacteria 3058
71 Ga0207665_10261411 3300025939 Unclassified 1282
72 Ga0209588_1012817 3300027671 Bacteria 2550
73 Ga0209588_1021472 3300027671 Bacteria 2029
74 Ga0209588_1022597 3300027671 Unclassified 1979
75 Ga0209588_1078734 3300027671 Bacteria 1065
76 Ga0265357_1007541 3300028023 Unclassified 1053
77 Ga0265319_1001988 3300028563 Bacteria 11531
78 Ga0265319_1043138 3300028563 Bacteria 1516
79 Ga0265318_10000614 3300028577 Bacteria 24662
80 Ga0265338_10085584 3300028800 Bacteria 2627
81 Ga0265338_10148345 3300028800 Unclassified 1826
82 Ga0265338_10508669 3300028800 Unclassified 847
83 Ga0265762_1068891 3300030760 Unclassified 739
84 Ga0265760_10005342 3300031090 Unclassified 3686
85 Ga0265760_10022492 3300031090 Unclassified 1827
86 Ga0265760_10051092 3300031090 Unclassified 1245
87 Ga0265760_10130056 3300031090 Bacteria 814
88 Ga0265330_10106296 3300031235 Bacteria 1200
89 Ga0265330_10289975 3300031235 Unclassified 689
90 Ga0265332_10008261 3300031238 Bacteria 4677
91 Ga0265332_10352756 3300031238 Unclassified 607
92 Ga0265320_10002497 3300031240 Bacteria 12791
93 Ga0265320_10231274 3300031240 Unclassified 822
94 Ga0265320_10458473 3300031240 Unclassified 563
95 Ga0265325_10004401 3300031241 Bacteria 8903
96 Ga0265325_10054558 3300031241 Bacteria 2045
97 Ga0265325_10058403 3300031241 Unclassified 1965
98 Ga0265325_10071015 3300031241 Unclassified 1748
99 Ga0265325_10085217 3300031241 Bacteria 1566
100 Ga0265325_10307988 3300031241 Unclassified 706
101 Ga0265325_10334539 3300031241 Bacteria 671
102 Ga0265329_10000689 3300031242 Bacteria 17248
103 Ga0265329_10072136 3300031242 Unclassified 1092
104 Ga0265340_10044746 3300031247 Bacteria 2165
105 Ga0265339_10515756 3300031249 Unclassified 551
106 Ga0265331_10000021 3300031250 Bacteria 242632
107 Ga0265331_10018810 3300031250 Bacteria 3573
108 Ga0265331_10028394 3300031250 Bacteria 2798
109 Ga0265331_10079403 3300031250 Bacteria 1527
110 Ga0265316_10002339 3300031344 Bacteria 19784
111 Ga0265316_10029657 3300031344 Bacteria 4494
112 Ga0265316_10067601 3300031344 Bacteria 2763
113 Ga0265316_10136517 3300031344 Unclassified 1845
114 Ga0265316_10410353 3300031344 Bacteria 975
115 Ga0265313_10020784 3300031595 Bacteria 3611
116 Ga0265313_10028226 3300031595 Bacteria 2921
117 Ga0265313_10115633 3300031595 Unclassified 1175
118 Ga0265313_10189382 3300031595 Bacteria 861
119 Ga0265314_10064401 3300031711 Bacteria 2482
120 Ga0265314_10625806 3300031711 Unclassified 552
121 Ga0265342_10000032 3300031712 Bacteria 150633
122 Ga0265342_10212994 3300031712 Unclassified 1044
123 Ga0316053_105838 3300032120 Unclassified 789
124 Ga0373926_0001779 3300035083 Bacteria 6693
125 Ga0373926_0076894 3300035083 Unclassified 1231
126 Ga0373934_0422628 3300035086 Unclassified 558
127 Ga0373923_0000161 3300035111 Bacteria 13158
128 Ga0373923_0022959 3300035111 Unclassified 2450
129 Ga0373945_0246162 3300035116 Unclassified 754
130 Ga0373954_0073377 3300035118 Bacteria 1628
131 Ga0373954_0113437 3300035118 Unclassified 1312
132 Ga0373954_0245056 3300035118 Unclassified 882
133 Ga0373946_0679864 3300035171 Unclassified 537
134 Ga0373955_0486417 3300035172 Unclassified 753
135 Ga0373924_0069520 3300035410 Unclassified 1484
136 Ga0373935_0008913 3300035692 Bacteria 6003
137 Ga0373935_0026440 3300035692 Bacteria 3581
138 Ga0373927_0001226 3300035695 Bacteria 19488
139 Ga0373927_0069298 3300035695 Unclassified 2282
140 Ga0373927_0073814 3300035695 Bacteria 2209
141 Ga0373947_0034460 3300035725 Unclassified 2994
142 Ga0373937_0117560 3300036401 Unclassified 2476
143 Ga0373937_0548115 3300036401 Unclassified 1098
144 Ga0373925_0100570 3300037068 Bacteria 2222
145 Ga0373925_0105772 3300037068 Unclassified 2169
146 Ga0495592_0129556 3300046454 Bacteria 1766
147 Ga0495592_0164808 3300046454 Unclassified 1522
148 Ga0495651_0000075 3300046462 Bacteria 73020
149 Ga0495651_0000694 3300046462 Bacteria 26168
150 Ga0495651_0002765 3300046462 Bacteria 13610
151 Ga0495651_0005177 3300046462 Bacteria 9947
152 Ga0495651_0088649 3300046462 Unclassified 2324
153 Ga0495651_0240872 3300046462 Bacteria 1241
154 Ga0495653_0000587 3300046463 Bacteria 27989
155 Ga0495653_0003176 3300046463 Bacteria 13165
156 Ga0495653_0081498 3300046463 Bacteria 2391
157 Ga0495653_0120001 3300046463 Bacteria 1876
158 Ga0495653_0448138 3300046463 Unclassified 812
159 Ga0495653_0797260 3300046463 Unclassified 568
160 Ga0495580_0018610 3300046472 Bacteria 5170
161 Ga0495580_0114247 3300046472 Unclassified 1875
162 Ga0495580_0189494 3300046472 Bacteria 1419
163 Ga0495580_0286649 3300046472 Bacteria 1123
164 Ga0495582_0678054 3300046473 Unclassified 596
165 Ga0495664_0012694 3300046477 Bacteria 4771
166 Ga0495664_0028172 3300046477 Unclassified 3280
167 Ga0495664_0120144 3300046477 Unclassified 1589
168 Ga0495664_0414378 3300046477 Unclassified 808
169 Ga0495608_0003964 3300046511 Bacteria 10633
170 Ga0495608_0022252 3300046511 Bacteria 4345
171 Ga0495608_0121780 3300046511 Unclassified 1673
172 Ga0495608_0177511 3300046511 Unclassified 1348
173 Ga0495608_0266120 3300046511 Unclassified 1066
174 Ga0495608_0323721 3300046511 Bacteria 952
175 Ga0495608_0458641 3300046511 Unclassified 775
176 Ga0495618_0062617 3300046514 Bacteria 2361
177 Ga0495628_0004097 3300046516 Bacteria 12966
178 Ga0495628_0006815 3300046516 Bacteria 9931
179 Ga0495628_0054925 3300046516 Bacteria 3138
180 Ga0495628_0085887 3300046516 Unclassified 2440
181 Ga0495628_0393130 3300046516 Bacteria 1014
182 Ga0495628_0838486 3300046516 Unclassified 641
183 Ga0495630_0006609 3300046517 Bacteria 8263
184 Ga0495630_0008054 3300046517 Bacteria 7577
185 Ga0495630_0049015 3300046517 Unclassified 3161
186 Ga0495630_0075868 3300046517 Unclassified 2532
187 Ga0495630_0173319 3300046517 Bacteria 1644
188 Ga0495630_1344305 3300046517 Unclassified 538
189 Ga0495666_0002087 3300046526 Bacteria 9899
190 Ga0495666_0022489 3300046526 Unclassified 3122
191 Ga0495652_0004680 3300046529 Bacteria 13054
192 Ga0495652_0010804 3300046529 Bacteria 8275
193 Ga0495652_0019820 3300046529 Bacteria 5985
194 Ga0495665_0014134 3300046531 Bacteria 4308
195 Ga0495665_0046111 3300046531 Bacteria 2315
196 Ga0495640_0337373 3300046533 Bacteria 932
197 Ga0495586_0007986 3300046535 Bacteria 5646
198 Ga0495586_0023663 3300046535 Bacteria 3281
199 Ga0495586_0055175 3300046535 Unclassified 2153
200 Ga0495587_0005773 3300046536 Bacteria 8065
201 Ga0495587_0151812 3300046536 Bacteria 1320
202 Ga0495587_0409539 3300046536 Unclassified 753
203 Ga0495645_0040193 3300046543 Plasmid 3412
204 Ga0495645_0133818 3300046543 Unclassified 1735
205 Ga0495645_0271309 3300046543 Unclassified 1120
206 Ga0495645_0285729 3300046543 Unclassified 1083
207 Ga0495645_0610461 3300046543 Unclassified 670
208 Ga0495667_0004145 3300046559 Bacteria 9748
209 Ga0495667_0008324 3300046559 Bacteria 7033
210 Ga0495667_0009184 3300046559 Bacteria 6714
211 Ga0495667_0016743 3300046559 Bacteria 4952
212 Ga0495667_0134621 3300046559 Unclassified 1593
213 Ga0495667_0416780 3300046559 Unclassified 845
214 Ga0495667_0690028 3300046559 Bacteria 633
215 Ga0495635_0001410 3300046663 Bacteria 16017
216 Ga0495635_0048408 3300046663 Bacteria 2930
217 Ga0495588_0123316 3300046674 Unclassified 1366
218 Ga0495657_0003557 3300046675 Bacteria 12694
219 Ga0495657_0028913 3300046675 Unclassified 3891
220 Ga0495657_0061010 3300046675 Unclassified 2496
221 Ga0495657_0061048 3300046675 Unclassified 2494
222 Ga0495657_0093800 3300046675 Unclassified 1920
223 Ga0495657_0733607 3300046675 Unclassified 567
224 Ga0495599_0003200 3300046678 Bacteria 9540
225 Ga0495599_0022543 3300046678 Bacteria 3932
226 Ga0495599_0288657 3300046678 Unclassified 992
227 Ga0495599_0550826 3300046678 Unclassified 675
228 Ga0495623_0018572 3300046679 Bacteria 4490
229 Ga0495623_0049026 3300046679 Bacteria 2677
230 Ga0495623_0094176 3300046679 Unclassified 1832
231 Ga0495623_0207276 3300046679 Unclassified 1124
232 Ga0495646_0009649 3300046680 Bacteria 6127
233 Ga0495646_0083145 3300046680 Unclassified 1861
234 Ga0495613_0022595 3300046689 Bacteria 4685
235 Ga0495613_0263180 3300046689 Unclassified 1201
236 Ga0495613_0291532 3300046689 Unclassified 1131
237 Ga0495624_0051020 3300046690 Unclassified 2619
238 Ga0495624_0074282 3300046690 Bacteria 2112
239 Ga0495624_0437360 3300046690 Bacteria 784
240 Ga0495600_0001689 3300046809 Bacteria 12339
241 Ga0495600_0051789 3300046809 Bacteria 2680
242 Ga0495604_0007925 3300047317 Bacteria 8414
243 Ga0495604_0025780 3300047317 Bacteria 4682
244 Ga0495604_0096276 3300047317 Bacteria 2185
245 Ga0495604_0157179 3300047317 Unclassified 1609
246 Ga0495604_0244362 3300047317 Bacteria 1226
247 Ga0495604_0547222 3300047317 Unclassified 747
248 Ga0495604_0630579 3300047317 Unclassified 685
249 Ga0495674_0010341 3300047319 Bacteria 8834
250 Ga0495674_0017382 3300047319 Bacteria 6690
251 Ga0495674_0022024 3300047319 Bacteria 5881
252 Ga0495674_0028777 3300047319 Bacteria 5063
253 Ga0495674_0048991 3300047319 Bacteria 3736
254 Ga0495674_0051284 3300047319 Bacteria 3638
255 Ga0495674_0072097 3300047319 Bacteria 2979
256 Ga0495674_0106623 3300047319 Bacteria 2379
257 Ga0495676_0097454 3300047321 Unclassified 2184
258 Ga0495676_0165284 3300047321 Unclassified 1562
259 Ga0495680_0000075 3300047322 Bacteria 86720
260 Ga0495680_0000479 3300047322 Bacteria 44993
261 Ga0495680_0009237 3300047322 Bacteria 8884
262 Ga0495680_0316575 3300047322 Unclassified 1093
263 Ga0495675_0000012 3300047444 Bacteria 146748
264 Ga0495675_0001242 3300047444 Bacteria 15433
265 Ga0495675_0012464 3300047444 Bacteria 5351
266 Ga0495675_0020140 3300047444 Bacteria 4240
267 Ga0495675_0020517 3300047444 Bacteria 4204
268 Ga0495675_0027202 3300047444 Plasmid 3645
269 Ga0495675_0035830 3300047444 Bacteria 3168
270 Ga0495675_0104039 3300047444 Bacteria 1775
271 Ga0495684_0001192 3300047471 Bacteria 20935
272 Ga0495684_0004727 3300047471 Bacteria 10634
273 Ga0495684_0015985 3300047471 Bacteria 5779
274 Ga0495684_0017540 3300047471 Bacteria 5511
275 Ga0495684_0022595 3300047471 Unclassified 4836
276 Ga0495593_0002936 3300047673 Bacteria 10260
277 Ga0495593_0013054 3300047673 Bacteria 4742
278 Ga0495602_0074897 3300048088 Unclassified 2874
279 Ga0495602_0106970 3300048088 Bacteria 2281
280 Ga0495602_0108821 3300048088 Unclassified 2256
281 Ga0495602_0170351 3300048088 Unclassified 1691
282 Ga0495602_0378530 3300048088 Bacteria 1014
283 Ga0495602_0485815 3300048088 Unclassified 866
284 Ga0495602_0511569 3300048088 Unclassified 838
285 Ga0495602_0741425 3300048088 Unclassified 664
286 Ga0495614_0010146 3300048089 Bacteria 4157
287 Ga0495614_0072677 3300048089 Unclassified 1484
288 Ga0496112_0043978 3300048915 Bacteria 4374
289 Ga0496112_0144440 3300048915 Bacteria 2348
290 nmdc:mga0n895_200701_c1 3300050512 Bacteria 2025
291 nmdc:mga08x19_24842_c1 3300050514 Bacteria 3728
292 Ga0495601_0137694 3300053077 Unclassified 1592
293 Ga0495612_0023489 3300053078 Bacteria 2474
294 Ga0495612_0024501 3300053078 Unclassified 2422
295 Ga0207699_10787872
296 Ga0070709_10015727
297 Ga0070709_10054667
298 Ga0070709_10449794
299 Ga0070713_100079794
300 Ga0070713_100146422
301 Ga0070710_10639656
302 Ga0070681_10522534
303 Ga0070707_100115786
304 Ga0070698_100083379
305 Ga0070698_100463851
306 Ga0070699_100046842
307 Ga0070697_100019914
308 Ga0070697_100384920
309 Ga0070697_100477952
310 Ga0068855_100654059
311 Ga0070715_10210171
312 Ga0070716_100001687
313 Ga0070716_100003791
314 Ga0070716_100022106
315 Ga0070716_100031265
316 Ga0070712_100066767
317 Ga0070712_101796074
318 Ga0097621_100368619
319 Ga0075434_100201740
320 Ga0075436_100056217
321 Ga0099794_10059200
322 Ga0099794_10060989
323 Ga0099794_10172630
324 Ga0099794_10222367
325 Ga0099794_10264657
326 Ga0099794_10269415
327 Ga0099794_10309739
328 Ga0099794_10393390
329 Ga0099795_10016163
330 Ga0105240_10079296
331 Ga0105240_10099626
332 Ga0105240_10208706
333 Ga0105245_10016896
334 Ga0105247_10081171
335 Ga0105247_10102687
336 Ga0105246_11994468
337 Ga0157370_10440368
338 Ga0157374_10017840
339 Ga0157378_10005990
340 Ga0157379_10108091
341 Ga0157379_10902595
342 Ga0157379_11748221
343 Ga0157376_10665512
344 Ga0228598_1002080
345 Ga0207692_10415944
346 Ga0207710_10061811
347 Ga0207699_10009321
348 Ga0207699_10021446
349 Ga0207699_10043055
350 Ga0207684_10198273
351 Ga0207684_10748609
352 Ga0207707_10427656
353 Ga0207695_10071566
354 Ga0207695_10363523
355 Ga0207693_10043312
356 Ga0207646_10000015
357 Ga0207646_10233536
358 Ga0207687_10010552
359 Ga0207700_10316929
360 Ga0207700_11762071
361 Ga0207665_10000103
362 Ga0207665_10005164
363 Ga0207665_10033963
364 Ga0207665_10041924
365 Ga0207665_10261411
366 Ga0209588_1012817
367 Ga0209588_1021472
368 Ga0209588_1022597
369 Ga0209588_1078734
370 Ga0265357_1007541
371 Ga0265319_1001988
372 Ga0265319_1043138
373 Ga0265318_10000614
374 Ga0265338_10085584
375 Ga0265338_10148345
376 Ga0265338_10508669
377 Ga0265762_1068891
378 Ga0265760_10005342
379 Ga0265760_10022492
380 Ga0265760_10051092
381 Ga0265760_10130056
382 Ga0265330_10106296
383 Ga0265330_10289975
384 Ga0265332_10008261
385 Ga0265332_10352756
386 Ga0265320_10002497
387 Ga0265320_10231274
388 Ga0265320_10458473
389 Ga0265325_10004401
390 Ga0265325_10054558
391 Ga0265325_10058403
392 Ga0265325_10071015
393 Ga0265325_10085217
394 Ga0265325_10307988
395 Ga0265325_10334539
396 Ga0265329_10000689
397 Ga0265329_10072136
398 Ga0265340_10044746
399 Ga0265339_10515756
400 Ga0265331_10000021
401 Ga0265331_10018810
402 Ga0265331_10028394
403 Ga0265331_10079403
404 Ga0265316_10002339
405 Ga0265316_10029657
406 Ga0265316_10067601
407 Ga0265316_10136517
408 Ga0265316_10410353
409 Ga0265313_10020784
410 Ga0265313_10028226
411 Ga0265313_10115633
412 Ga0265313_10189382
413 Ga0265314_10064401
414 Ga0265314_10625806
415 Ga0265342_10000032
416 Ga0265342_10212994
417 Ga0316053_105838
418 Ga0373926_0001779
419 Ga0373926_0076894
420 Ga0373934_0422628
421 Ga0373923_0000161
422 Ga0373923_0022959
423 Ga0373945_0246162
424 Ga0373954_0073377
425 Ga0373954_0113437
426 Ga0373954_0245056
427 Ga0373946_0679864
428 Ga0373955_0486417
429 Ga0373924_0069520
430 Ga0373935_0008913
431 Ga0373935_0026440
432 Ga0373927_0001226
433 Ga0373927_0069298
434 Ga0373927_0073814
435 Ga0373947_0034460
436 Ga0373937_0117560
437 Ga0373937_0548115
438 Ga0373925_0100570
439 Ga0373925_0105772
440 Ga0495592_0129556
441 Ga0495592_0164808
442 Ga0495651_0000075
443 Ga0495651_0000694
444 Ga0495651_0002765
445 Ga0495651_0005177
446 Ga0495651_0088649
447 Ga0495651_0240872
448 Ga0495653_0000587
449 Ga0495653_0003176
450 Ga0495653_0081498
451 Ga0495653_0120001
452 Ga0495653_0448138
453 Ga0495653_0797260
454 Ga0495580_0018610
455 Ga0495580_0114247
456 Ga0495580_0189494
457 Ga0495580_0286649
458 Ga0495582_0678054
459 Ga0495664_0012694
460 Ga0495664_0028172
461 Ga0495664_0120144
462 Ga0495664_0414378
463 Ga0495608_0003964
464 Ga0495608_0022252
465 Ga0495608_0121780
466 Ga0495608_0177511
467 Ga0495608_0266120
468 Ga0495608_0323721
469 Ga0495608_0458641
470 Ga0495618_0062617
471 Ga0495628_0004097
472 Ga0495628_0006815
473 Ga0495628_0054925
474 Ga0495628_0085887
475 Ga0495628_0393130
476 Ga0495628_0838486
477 Ga0495630_0006609
478 Ga0495630_0008054
479 Ga0495630_0049015
480 Ga0495630_0075868
481 Ga0495630_0173319
482 Ga0495630_1344305
483 Ga0495666_0002087
484 Ga0495666_0022489
485 Ga0495652_0004680
486 Ga0495652_0010804
487 Ga0495652_0019820
488 Ga0495665_0014134
489 Ga0495665_0046111
490 Ga0495640_0337373
491 Ga0495586_0007986
492 Ga0495586_0023663
493 Ga0495586_0055175
494 Ga0495587_0005773
495 Ga0495587_0151812
496 Ga0495587_0409539
497 Ga0495645_0040193
498 Ga0495645_0133818
499 Ga0495645_0271309
500 Ga0495645_0285729
501 Ga0495645_0610461
502 Ga0495667_0004145
503 Ga0495667_0008324
504 Ga0495667_0009184
505 Ga0495667_0016743
506 Ga0495667_0134621
507 Ga0495667_0416780
508 Ga0495667_0690028
509 Ga0495635_0001410
510 Ga0495635_0048408
511 Ga0495588_0123316
512 Ga0495657_0003557
513 Ga0495657_0028913
514 Ga0495657_0061010
515 Ga0495657_0061048
516 Ga0495657_0093800
517 Ga0495657_0733607
518 Ga0495599_0003200
519 Ga0495599_0022543
520 Ga0495599_0288657
521 Ga0495599_0550826
522 Ga0495623_0018572
523 Ga0495623_0049026
524 Ga0495623_0094176
525 Ga0495623_0207276
526 Ga0495646_0009649
527 Ga0495646_0083145
528 Ga0495613_0022595
529 Ga0495613_0263180
530 Ga0495613_0291532
531 Ga0495624_0051020
532 Ga0495624_0074282
533 Ga0495624_0437360
534 Ga0495600_0001689
535 Ga0495600_0051789
536 Ga0495604_0007925
537 Ga0495604_0025780
538 Ga0495604_0096276
539 Ga0495604_0157179
540 Ga0495604_0244362
541 Ga0495604_0547222
542 Ga0495604_0630579
543 Ga0495674_0010341
544 Ga0495674_0017382
545 Ga0495674_0022024
546 Ga0495674_0028777
547 Ga0495674_0048991
548 Ga0495674_0051284
549 Ga0495674_0072097
550 Ga0495674_0106623
551 Ga0495676_0097454
552 Ga0495676_0165284
553 Ga0495680_0000075
554 Ga0495680_0000479
555 Ga0495680_0009237
556 Ga0495680_0316575
557 Ga0495675_0000012
558 Ga0495675_0001242
559 Ga0495675_0012464
560 Ga0495675_0020140
561 Ga0495675_0020517
562 Ga0495675_0027202
563 Ga0495675_0035830
564 Ga0495675_0104039
565 Ga0495684_0001192
566 Ga0495684_0004727
567 Ga0495684_0015985
568 Ga0495684_0017540
569 Ga0495684_0022595
570 Ga0495593_0002936
571 Ga0495593_0013054
572 Ga0495602_0074897
573 Ga0495602_0106970
574 Ga0495602_0108821
575 Ga0495602_0170351
576 Ga0495602_0378530
577 Ga0495602_0485815
578 Ga0495602_0511569
579 Ga0495602_0741425
580 Ga0495614_0010146
581 Ga0495614_0072677
582 Ga0496112_0043978
583 Ga0496112_0144440
584 nmdc:mga0n895_200701_c1
585 nmdc:mga08x19_24842_c1
586 Ga0495601_0137694
587 Ga0495612_0023489
588 Ga0495612_0024501

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13560

HTH_31

Helix-turn-helix domain

30

86

0.97

PF01381

HTH_3

Helix-turn-helix

35

89

0.96

PF12844

HTH_19

Helix-turn-helix domain

32

96

0.94

Map