F392512

General Info

Members Datasets Scaffolds Average Seq Length
295 139 590 169

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_10127168|Ga0070701_101271683
Length 194
Sequence MKTQFRRSILASSILIIATLAIVYAQQPKHGSADEQMNKRGDHVMGFDHMKTTHHFLLQESGGSIEVTANSSDDVESSEQIRMHLKHIAKMFAEGNFNAPMLIHDQTPPGTPVMQKLKGEITYNFEEIDRGAAVRISTTNPTALKAIHDFLRFQIKEHKTGDSLDVGKGTDPLYNQPAVSTLAFRWVITCVSCS

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
114 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
115 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
116 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
121 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
122 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
123 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
124 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
125 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
126 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
127 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
128 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
129 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
130 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
131 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
132 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
133 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
134 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
135 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
136 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.03
Rhizosphere 97.97
Stem 0
Stem Tuber 0
Unclassified 36.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_10127168 3300005438 Unclassified 1443
2 Ga0065704_10141866 3300005289 Bacteria 1510
3 Ga0065715_10152565 3300005293 Bacteria 1694
4 Ga0065715_10170802 3300005293 Bacteria 1548
5 Ga0065715_10255056 3300005293 Unclassified 1155
6 Ga0070690_100939665 3300005330 Unclassified 678
7 Ga0070670_100000023 3300005331 Bacteria 194438
8 Ga0070670_100229684 3300005331 Bacteria 1615
9 Ga0068869_100830702 3300005334 Unclassified 796
10 Ga0070682_100005011 3300005337 Bacteria 7362
11 Ga0070682_100018348 3300005337 Bacteria 4089
12 Ga0070682_100660679 3300005337 Unclassified 833
13 Ga0070689_100004292 3300005340 Bacteria 9615
14 Ga0070689_100602376 3300005340 Unclassified 952
15 Ga0070692_10011214 3300005345 Bacteria 4109
16 Ga0070692_10012048 3300005345 Bacteria 3989
17 Ga0070692_10290862 3300005345 Bacteria 994
18 Ga0070669_100033314 3300005353 Bacteria 3726
19 Ga0070669_100469509 3300005353 Bacteria 1040
20 Ga0070671_100988334 3300005355 Bacteria 737
21 Ga0070673_100387750 3300005364 Unclassified 1247
22 Ga0070659_100068839 3300005366 Bacteria 2809
23 Ga0070667_101890939 3300005367 Bacteria 562
24 Ga0070703_10021579 3300005406 Bacteria 1884
25 Ga0070705_100009252 3300005440 Bacteria 4894
26 Ga0070700_100021187 3300005441 Bacteria 3775
27 Ga0070700_100039794 3300005441 Bacteria 2874
28 Ga0070700_100041917 3300005441 Unclassified 2808
29 Ga0070700_101283596 3300005441 Unclassified 615
30 Ga0070694_100039117 3300005444 Bacteria 3155
31 Ga0070694_100376694 3300005444 Bacteria 1106
32 Ga0070694_100471140 3300005444 Unclassified 995
33 Ga0070694_100477410 3300005444 Unclassified 989
34 Ga0070694_101057652 3300005444 Unclassified 676
35 Ga0070694_101308968 3300005444 Unclassified 610
36 Ga0070681_10030973 3300005458 Bacteria 5370
37 Ga0070681_10051691 3300005458 Bacteria 4099
38 Ga0068867_100456948 3300005459 Bacteria 1089
39 Ga0068867_100595034 3300005459 Bacteria 964
40 Ga0070685_10130056 3300005466 Unclassified 1573
41 Ga0070699_100322781 3300005518 Unclassified 1388
42 Ga0070699_100369567 3300005518 Unclassified 1294
43 Ga0068853_100045456 3300005539 Bacteria 3761
44 Ga0068853_100953822 3300005539 Bacteria 825
45 Ga0070672_100890800 3300005543 Bacteria 786
46 Ga0070695_100056187 3300005545 Bacteria 2539
47 Ga0070695_100398487 3300005545 Unclassified 1043
48 Ga0070695_100938877 3300005545 Unclassified 701
49 Ga0070696_100302802 3300005546 Unclassified 1225
50 Ga0070696_100406900 3300005546 Bacteria 1066
51 Ga0070696_100507695 3300005546 Bacteria 960
52 Ga0070696_100834011 3300005546 Bacteria 761
53 Ga0070696_101142893 3300005546 Unclassified 656
54 Ga0070693_100007635 3300005547 Bacteria 5295
55 Ga0070693_100019837 3300005547 Bacteria 3534
56 Ga0070693_100628249 3300005547 Bacteria 778
57 Ga0070693_101009118 3300005547 Unclassified 630
58 Ga0070704_100147405 3300005549 Bacteria 1846
59 Ga0070704_100191351 3300005549 Unclassified 1645
60 Ga0068855_100691814 3300005563 Bacteria 1092
61 Ga0070664_100569608 3300005564 Bacteria 1048
62 Ga0070664_100725508 3300005564 Unclassified 927
63 Ga0070664_100865058 3300005564 Bacteria 847
64 Ga0068857_100095924 3300005577 Bacteria 2657
65 Ga0068857_100414687 3300005577 Unclassified 1255
66 Ga0068857_100939197 3300005577 Bacteria 831
67 Ga0068857_100941000 3300005577 Unclassified 830
68 Ga0068857_101084292 3300005577 Bacteria 773
69 Ga0068854_100209035 3300005578 Bacteria 1538
70 Ga0070702_100003203 3300005615 Bacteria 7270
71 Ga0070702_100046370 3300005615 Bacteria 2463
72 Ga0070702_101014473 3300005615 Bacteria 658
73 Ga0068852_100032118 3300005616 Bacteria 4343
74 Ga0068859_100069104 3300005617 Bacteria 3567
75 Ga0068859_100085146 3300005617 Bacteria 3206
76 Ga0068859_100192726 3300005617 Bacteria 2122
77 Ga0068859_100222956 3300005617 Bacteria 1973
78 Ga0068859_100258106 3300005617 Bacteria 1834
79 Ga0068859_100406495 3300005617 Unclassified 1457
80 Ga0068859_100455532 3300005617 Unclassified 1375
81 Ga0068859_100585039 3300005617 Unclassified 1210
82 Ga0068859_100590752 3300005617 Bacteria 1204
83 Ga0068859_100687644 3300005617 Bacteria 1114
84 Ga0068859_101625182 3300005617 Unclassified 714
85 Ga0068864_100007974 3300005618 Bacteria 8728
86 Ga0068864_100011481 3300005618 Bacteria 7315
87 Ga0068864_100061366 3300005618 Unclassified 3256
88 Ga0068864_100121534 3300005618 Bacteria 2335
89 Ga0068864_100493388 3300005618 Unclassified 1177
90 Ga0068861_100233848 3300005719 Bacteria 1560
91 Ga0068851_10639650 3300005834 Unclassified 650
92 Ga0068870_10287196 3300005840 Unclassified 1033
93 Ga0068870_10294476 3300005840 Unclassified 1022
94 Ga0068863_100057040 3300005841 Unclassified 3697
95 Ga0068863_100304872 3300005841 Bacteria 1545
96 Ga0068863_100361963 3300005841 Bacteria 1414
97 Ga0068863_100459770 3300005841 Bacteria 1250
98 Ga0068863_100905376 3300005841 Bacteria 882
99 Ga0068858_100067382 3300005842 Bacteria 3316
100 Ga0068858_100103305 3300005842 Bacteria 2658
101 Ga0068858_100205855 3300005842 Bacteria 1862
102 Ga0068858_100219688 3300005842 Bacteria 1799
103 Ga0068858_100785261 3300005842 Bacteria 929
104 Ga0068860_100043462 3300005843 Bacteria 4286
105 Ga0068860_100210840 3300005843 Bacteria 1884
106 Ga0068860_100256798 3300005843 Bacteria 1703
107 Ga0068860_101264155 3300005843 Bacteria 759
108 Ga0068862_100753063 3300005844 Bacteria 948
109 Ga0068862_101165206 3300005844 Unclassified 768
110 Ga0097621_100021550 3300006237 Bacteria 4988
111 Ga0097621_100496520 3300006237 Unclassified 1105
112 Ga0068871_100005474 3300006358 Bacteria 8906
113 Ga0075431_100123292 3300006847 Bacteria 2673
114 Ga0097620_100069107 3300006931 Bacteria 3567
115 Ga0097620_100085146 3300006931 Bacteria 3206
116 Ga0097620_100192728 3300006931 Bacteria 2122
117 Ga0097620_100222964 3300006931 Bacteria 1973
118 Ga0097620_100258102 3300006931 Bacteria 1834
119 Ga0097620_100406463 3300006931 Unclassified 1457
120 Ga0097620_100455540 3300006931 Unclassified 1375
121 Ga0097620_100584994 3300006931 Unclassified 1210
122 Ga0097620_100590761 3300006931 Bacteria 1204
123 Ga0097620_100687760 3300006931 Bacteria 1114
124 Ga0097620_101624967 3300006931 Unclassified 714
125 Ga0105251_10264589 3300009011 Bacteria 776
126 Ga0105244_10196180 3300009036 Unclassified 953
127 Ga0105240_10158738 3300009093 Bacteria 2688
128 Ga0105240_10197507 3300009093 Bacteria 2360
129 Ga0105245_10298247 3300009098 Bacteria 1581
130 Ga0105245_10691605 3300009098 Unclassified 1052
131 Ga0105245_12270551 3300009098 Unclassified 596
132 Ga0105247_10051986 3300009101 Unclassified 2525
133 Ga0105247_10241219 3300009101 Unclassified 1232
134 Ga0105247_10565633 3300009101 Bacteria 838
135 Ga0114129_10042099 3300009147 Bacteria 6431
136 Ga0114129_11105729 3300009147 Bacteria 992
137 Ga0105243_10069755 3300009148 Bacteria 2836
138 Ga0105243_10105835 3300009148 Bacteria 2344
139 Ga0105243_10126402 3300009148 Bacteria 2163
140 Ga0105243_10341996 3300009148 Bacteria 1371
141 Ga0105243_10625118 3300009148 Bacteria 1040
142 Ga0105243_11203739 3300009148 Bacteria 771
143 Ga0105241_10075112 3300009174 Bacteria 2633
144 Ga0105241_10257574 3300009174 Bacteria 1482
145 Ga0105242_10007962 3300009176 Bacteria 8162
146 Ga0105248_10040113 3300009177 Bacteria 5248
147 Ga0105248_10064566 3300009177 Bacteria 4110
148 Ga0105248_10252447 3300009177 Bacteria 1985
149 Ga0105248_10351001 3300009177 Unclassified 1661
150 Ga0105248_10417052 3300009177 Bacteria 1512
151 Ga0105248_11623343 3300009177 Unclassified 733
152 Ga0105248_11718145 3300009177 Unclassified 711
153 Ga0105237_10016486 3300009545 Bacteria 7674
154 Ga0105237_10022318 3300009545 Bacteria 6495
155 Ga0105237_10127928 3300009545 Plasmid 2534
156 Ga0105237_11652392 3300009545 Unclassified 648
157 Ga0105238_10076166 3300009551 Bacteria 3346
158 Ga0105249_10115946 3300009553 Bacteria 2539
159 Ga0105249_10131639 3300009553 Bacteria 2389
160 Ga0105239_10186339 3300010375 Bacteria 2322
161 Ga0105246_10048879 3300011119 Bacteria 2893
162 Ga0105246_10173118 3300011119 Unclassified 1655
163 Ga0105246_10737402 3300011119 Bacteria 867
164 Ga0157373_10329875 3300013100 Unclassified 1086
165 Ga0157373_10433917 3300013100 Unclassified 944
166 Ga0157373_10738742 3300013100 Unclassified 723
167 Ga0157373_10882641 3300013100 Unclassified 663
168 Ga0157378_10620772 3300013297 Unclassified 1094
169 Ga0157378_11337549 3300013297 Unclassified 758
170 Ga0163162_10015636 3300013306 Bacteria 7416
171 Ga0163162_10052388 3300013306 Plasmid 4098
172 Ga0163162_11122056 3300013306 Unclassified 891
173 Ga0157372_10012035 3300013307 Bacteria 9213
174 Ga0157372_11087526 3300013307 Unclassified 925
175 Ga0157375_10199022 3300013308 Bacteria 2159
176 Ga0157375_10402345 3300013308 Bacteria 1536
177 Ga0163163_10000070 3300014325 Bacteria 113169
178 Ga0163163_10009500 3300014325 Bacteria 8687
179 Ga0163163_11376054 3300014325 Unclassified 767
180 Ga0157380_10071181 3300014326 Bacteria 2813
181 Ga0157377_10148140 3300014745 Bacteria 1449
182 Ga0157379_10252014 3300014968 Bacteria 1603
183 Ga0157379_10881402 3300014968 Unclassified 848
184 Ga0163161_10360718 3300017792 Bacteria 1157
185 Ga0207656_10474407 3300025321 Unclassified 634
186 Ga0207653_10032258 3300025885 Bacteria 1694
187 Ga0207653_10067410 3300025885 Unclassified 1218
188 Ga0207642_10272510 3300025899 Bacteria 970
189 Ga0207710_10380117 3300025900 Bacteria 723
190 Ga0207688_10521711 3300025901 Unclassified 745
191 Ga0207647_10119205 3300025904 Unclassified 1556
192 Ga0207647_10299702 3300025904 Unclassified 915
193 Ga0207643_10075414 3300025908 Unclassified 1946
194 Ga0207643_10572819 3300025908 Unclassified 725
195 Ga0207654_10104340 3300025911 Bacteria 1752
196 Ga0207707_10005463 3300025912 Bacteria 11109
197 Ga0207707_10031602 3300025912 Bacteria 4633
198 Ga0207695_10137089 3300025913 Bacteria 2399
199 Ga0207671_10010596 3300025914 Bacteria 7589
200 Ga0207671_10104814 3300025914 Bacteria 2145
201 Ga0207662_10165216 3300025918 Unclassified 1416
202 Ga0207681_10014540 3300025923 Bacteria 4894
203 Ga0207681_10380837 3300025923 Bacteria 1136
204 Ga0207694_10001419 3300025924 Bacteria 20527
205 Ga0207694_10059788 3300025924 Bacteria 2964
206 Ga0207650_10000005 3300025925 Bacteria 663190
207 Ga0207650_10231625 3300025925 Unclassified 1490
208 Ga0207650_10391011 3300025925 Bacteria 1150
209 Ga0207659_10516545 3300025926 Unclassified 1012
210 Ga0207690_10126960 3300025932 Bacteria 1861
211 Ga0207686_10217323 3300025934 Unclassified 1378
212 Ga0207709_10056913 3300025935 Bacteria 2422
213 Ga0207709_10113176 3300025935 Bacteria 1818
214 Ga0207709_10170666 3300025935 Unclassified 1526
215 Ga0207709_10680122 3300025935 Bacteria 822
216 Ga0207670_10001019 3300025936 Bacteria 14812
217 Ga0207704_10405145 3300025938 Unclassified 1077
218 Ga0207665_10115067 3300025939 Bacteria 1894
219 Ga0207691_10261177 3300025940 Bacteria 1493
220 Ga0207711_10160295 3300025941 Bacteria 2036
221 Ga0207711_10247126 3300025941 Bacteria 1637
222 Ga0207711_10274971 3300025941 Bacteria 1550
223 Ga0207711_10837722 3300025941 Bacteria 856
224 Ga0207711_11577061 3300025941 Unclassified 600
225 Ga0207689_10104614 3300025942 Bacteria 2326
226 Ga0207689_10607279 3300025942 Unclassified 920
227 Ga0207679_11038384 3300025945 Unclassified 751
228 Ga0207679_11059764 3300025945 Unclassified 743
229 Ga0207679_11652882 3300025945 Bacteria 586
230 Ga0207667_10390783 3300025949 Unclassified 1417
231 Ga0207651_10580709 3300025960 Unclassified 978
232 Ga0207703_10026828 3300026035 Bacteria 4537
233 Ga0207703_10091658 3300026035 Bacteria 2557
234 Ga0207703_10110531 3300026035 Bacteria 2345
235 Ga0207703_10118148 3300026035 Bacteria 2273
236 Ga0207703_10188226 3300026035 Bacteria 1826
237 Ga0207703_10534488 3300026035 Bacteria 1104
238 Ga0207703_10723094 3300026035 Unclassified 948
239 Ga0207639_10276108 3300026041 Unclassified 1476
240 Ga0207708_10007015 3300026075 Bacteria 8327
241 Ga0207708_10012925 3300026075 Bacteria 6225
242 Ga0207708_10020617 3300026075 Bacteria 4971
243 Ga0207641_10036661 3300026088 Plasmid 4093
244 Ga0207641_10038019 3300026088 Bacteria 4023
245 Ga0207641_10263321 3300026088 Unclassified 1615
246 Ga0207641_10374071 3300026088 Bacteria 1363
247 Ga0207641_10386869 3300026088 Bacteria 1341
248 Ga0207641_10680098 3300026088 Unclassified 1012
249 Ga0207641_10740288 3300026088 Unclassified 970
250 Ga0207676_10003297 3300026095 Bacteria 11467
251 Ga0207676_10111215 3300026095 Bacteria 2292
252 Ga0207676_10218639 3300026095 Bacteria 1695
253 Ga0207676_11780255 3300026095 Unclassified 614
254 Ga0207674_10014037 3300026116 Bacteria 8851
255 Ga0207674_10175833 3300026116 Bacteria 2093
256 Ga0207674_10234824 3300026116 Bacteria 1781
257 Ga0207674_10268596 3300026116 Bacteria 1653
258 Ga0207674_10638288 3300026116 Unclassified 1028
259 Ga0207698_10018856 3300026142 Bacteria 4712
260 Ga0268264_10246716 3300028381 Bacteria 1657
261 Ga0268264_10312497 3300028381 Unclassified 1483
262 Ga0268264_10931128 3300028381 Unclassified 873
263 Ga0307405_10771064 3300031731 Bacteria 803
264 Ga0307412_10104927 3300031911 Bacteria 2006
265 Ga0307415_100091692 3300032126 Bacteria 2201
266 Ga0373942_0035766 3300035207 Unclassified 1334
267 Ga0242422_02821 3300038699 Bacteria 1157
268 Ga0242420_002072 3300038996 Bacteria 2811
269 Ga0496104_0420380 3300048907 Unclassified 1249
270 Ga0496106_0036218 3300048909 Unclassified 3691
271 Ga0496108_0160412 3300048911 Unclassified 1943
272 Ga0496112_0300609 3300048915 Unclassified 1550
273 Ga0496112_0818387 3300048915 Unclassified 856
274 Ga0496113_0647974 3300048916 Unclassified 845
275 Ga0501299_008383 3300049522 Unclassified 1680
276 Ga0501198_012151 3300049649 Bacteria 1292
277 Ga0501216_054313 3300049660 Unclassified 794
278 Ga0501217_005408 3300049661 Unclassified 2669
279 Ga0501227_013270 3300049665 Unclassified 1813
280 Ga0501235_038015 3300049669 Bacteria 1096
281 Ga0501236_010883 3300049670 Unclassified 1199
282 Ga0501259_024209 3300049688 Unclassified 1103
283 Ga0501261_010430 3300049690 Unclassified 1224
284 Ga0501234_078851 3300049707 Unclassified 578
285 Ga0501245_031437 3300049708 Unclassified 879
286 Ga0501263_011585 3300049760 Bacteria 1096
287 Ga0501264_010702 3300049761 Unclassified 885
288 Ga0501270_009292 3300049767 Unclassified 1267
289 Ga0501283_047854 3300049779 Bacteria 752
290 Ga0501212_018596 3300049851 Bacteria 1059
291 Ga0501226_010343 3300049853 Bacteria 1035
292 nmdc:mga05p37_191796_c1 3300050507 Unclassified 2480
293 nmdc:mga05p37_460622_c1 3300050507 Bacteria 1469
294 nmdc:mga0qj67_167370_c1 3300050509 Unclassified 1785
295 nmdc:mga0a205_63877_c1 3300050515 Bacteria 3556
296 Ga0070701_10127168
297 Ga0065704_10141866
298 Ga0065715_10152565
299 Ga0065715_10170802
300 Ga0065715_10255056
301 Ga0070690_100939665
302 Ga0070670_100000023
303 Ga0070670_100229684
304 Ga0068869_100830702
305 Ga0070682_100005011
306 Ga0070682_100018348
307 Ga0070682_100660679
308 Ga0070689_100004292
309 Ga0070689_100602376
310 Ga0070692_10011214
311 Ga0070692_10012048
312 Ga0070692_10290862
313 Ga0070669_100033314
314 Ga0070669_100469509
315 Ga0070671_100988334
316 Ga0070673_100387750
317 Ga0070659_100068839
318 Ga0070667_101890939
319 Ga0070703_10021579
320 Ga0070705_100009252
321 Ga0070700_100021187
322 Ga0070700_100039794
323 Ga0070700_100041917
324 Ga0070700_101283596
325 Ga0070694_100039117
326 Ga0070694_100376694
327 Ga0070694_100471140
328 Ga0070694_100477410
329 Ga0070694_101057652
330 Ga0070694_101308968
331 Ga0070681_10030973
332 Ga0070681_10051691
333 Ga0068867_100456948
334 Ga0068867_100595034
335 Ga0070685_10130056
336 Ga0070699_100322781
337 Ga0070699_100369567
338 Ga0068853_100045456
339 Ga0068853_100953822
340 Ga0070672_100890800
341 Ga0070695_100056187
342 Ga0070695_100398487
343 Ga0070695_100938877
344 Ga0070696_100302802
345 Ga0070696_100406900
346 Ga0070696_100507695
347 Ga0070696_100834011
348 Ga0070696_101142893
349 Ga0070693_100007635
350 Ga0070693_100019837
351 Ga0070693_100628249
352 Ga0070693_101009118
353 Ga0070704_100147405
354 Ga0070704_100191351
355 Ga0068855_100691814
356 Ga0070664_100569608
357 Ga0070664_100725508
358 Ga0070664_100865058
359 Ga0068857_100095924
360 Ga0068857_100414687
361 Ga0068857_100939197
362 Ga0068857_100941000
363 Ga0068857_101084292
364 Ga0068854_100209035
365 Ga0070702_100003203
366 Ga0070702_100046370
367 Ga0070702_101014473
368 Ga0068852_100032118
369 Ga0068859_100069104
370 Ga0068859_100085146
371 Ga0068859_100192726
372 Ga0068859_100222956
373 Ga0068859_100258106
374 Ga0068859_100406495
375 Ga0068859_100455532
376 Ga0068859_100585039
377 Ga0068859_100590752
378 Ga0068859_100687644
379 Ga0068859_101625182
380 Ga0068864_100007974
381 Ga0068864_100011481
382 Ga0068864_100061366
383 Ga0068864_100121534
384 Ga0068864_100493388
385 Ga0068861_100233848
386 Ga0068851_10639650
387 Ga0068870_10287196
388 Ga0068870_10294476
389 Ga0068863_100057040
390 Ga0068863_100304872
391 Ga0068863_100361963
392 Ga0068863_100459770
393 Ga0068863_100905376
394 Ga0068858_100067382
395 Ga0068858_100103305
396 Ga0068858_100205855
397 Ga0068858_100219688
398 Ga0068858_100785261
399 Ga0068860_100043462
400 Ga0068860_100210840
401 Ga0068860_100256798
402 Ga0068860_101264155
403 Ga0068862_100753063
404 Ga0068862_101165206
405 Ga0097621_100021550
406 Ga0097621_100496520
407 Ga0068871_100005474
408 Ga0075431_100123292
409 Ga0097620_100069107
410 Ga0097620_100085146
411 Ga0097620_100192728
412 Ga0097620_100222964
413 Ga0097620_100258102
414 Ga0097620_100406463
415 Ga0097620_100455540
416 Ga0097620_100584994
417 Ga0097620_100590761
418 Ga0097620_100687760
419 Ga0097620_101624967
420 Ga0105251_10264589
421 Ga0105244_10196180
422 Ga0105240_10158738
423 Ga0105240_10197507
424 Ga0105245_10298247
425 Ga0105245_10691605
426 Ga0105245_12270551
427 Ga0105247_10051986
428 Ga0105247_10241219
429 Ga0105247_10565633
430 Ga0114129_10042099
431 Ga0114129_11105729
432 Ga0105243_10069755
433 Ga0105243_10105835
434 Ga0105243_10126402
435 Ga0105243_10341996
436 Ga0105243_10625118
437 Ga0105243_11203739
438 Ga0105241_10075112
439 Ga0105241_10257574
440 Ga0105242_10007962
441 Ga0105248_10040113
442 Ga0105248_10064566
443 Ga0105248_10252447
444 Ga0105248_10351001
445 Ga0105248_10417052
446 Ga0105248_11623343
447 Ga0105248_11718145
448 Ga0105237_10016486
449 Ga0105237_10022318
450 Ga0105237_10127928
451 Ga0105237_11652392
452 Ga0105238_10076166
453 Ga0105249_10115946
454 Ga0105249_10131639
455 Ga0105239_10186339
456 Ga0105246_10048879
457 Ga0105246_10173118
458 Ga0105246_10737402
459 Ga0157373_10329875
460 Ga0157373_10433917
461 Ga0157373_10738742
462 Ga0157373_10882641
463 Ga0157378_10620772
464 Ga0157378_11337549
465 Ga0163162_10015636
466 Ga0163162_10052388
467 Ga0163162_11122056
468 Ga0157372_10012035
469 Ga0157372_11087526
470 Ga0157375_10199022
471 Ga0157375_10402345
472 Ga0163163_10000070
473 Ga0163163_10009500
474 Ga0163163_11376054
475 Ga0157380_10071181
476 Ga0157377_10148140
477 Ga0157379_10252014
478 Ga0157379_10881402
479 Ga0163161_10360718
480 Ga0207656_10474407
481 Ga0207653_10032258
482 Ga0207653_10067410
483 Ga0207642_10272510
484 Ga0207710_10380117
485 Ga0207688_10521711
486 Ga0207647_10119205
487 Ga0207647_10299702
488 Ga0207643_10075414
489 Ga0207643_10572819
490 Ga0207654_10104340
491 Ga0207707_10005463
492 Ga0207707_10031602
493 Ga0207695_10137089
494 Ga0207671_10010596
495 Ga0207671_10104814
496 Ga0207662_10165216
497 Ga0207681_10014540
498 Ga0207681_10380837
499 Ga0207694_10001419
500 Ga0207694_10059788
501 Ga0207650_10000005
502 Ga0207650_10231625
503 Ga0207650_10391011
504 Ga0207659_10516545
505 Ga0207690_10126960
506 Ga0207686_10217323
507 Ga0207709_10056913
508 Ga0207709_10113176
509 Ga0207709_10170666
510 Ga0207709_10680122
511 Ga0207670_10001019
512 Ga0207704_10405145
513 Ga0207665_10115067
514 Ga0207691_10261177
515 Ga0207711_10160295
516 Ga0207711_10247126
517 Ga0207711_10274971
518 Ga0207711_10837722
519 Ga0207711_11577061
520 Ga0207689_10104614
521 Ga0207689_10607279
522 Ga0207679_11038384
523 Ga0207679_11059764
524 Ga0207679_11652882
525 Ga0207667_10390783
526 Ga0207651_10580709
527 Ga0207703_10026828
528 Ga0207703_10091658
529 Ga0207703_10110531
530 Ga0207703_10118148
531 Ga0207703_10188226
532 Ga0207703_10534488
533 Ga0207703_10723094
534 Ga0207639_10276108
535 Ga0207708_10007015
536 Ga0207708_10012925
537 Ga0207708_10020617
538 Ga0207641_10036661
539 Ga0207641_10038019
540 Ga0207641_10263321
541 Ga0207641_10374071
542 Ga0207641_10386869
543 Ga0207641_10680098
544 Ga0207641_10740288
545 Ga0207676_10003297
546 Ga0207676_10111215
547 Ga0207676_10218639
548 Ga0207676_11780255
549 Ga0207674_10014037
550 Ga0207674_10175833
551 Ga0207674_10234824
552 Ga0207674_10268596
553 Ga0207674_10638288
554 Ga0207698_10018856
555 Ga0268264_10246716
556 Ga0268264_10312497
557 Ga0268264_10931128
558 Ga0307405_10771064
559 Ga0307412_10104927
560 Ga0307415_100091692
561 Ga0373942_0035766
562 Ga0242422_02821
563 Ga0242420_002072
564 Ga0496104_0420380
565 Ga0496106_0036218
566 Ga0496108_0160412
567 Ga0496112_0300609
568 Ga0496112_0818387
569 Ga0496113_0647974
570 Ga0501299_008383
571 Ga0501198_012151
572 Ga0501216_054313
573 Ga0501217_005408
574 Ga0501227_013270
575 Ga0501235_038015
576 Ga0501236_010883
577 Ga0501259_024209
578 Ga0501261_010430
579 Ga0501234_078851
580 Ga0501245_031437
581 Ga0501263_011585
582 Ga0501264_010702
583 Ga0501270_009292
584 Ga0501283_047854
585 Ga0501212_018596
586 Ga0501226_010343
587 nmdc:mga05p37_191796_c1
588 nmdc:mga05p37_460622_c1
589 nmdc:mga0qj67_167370_c1
590 nmdc:mga0a205_63877_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rjv-assembly2.cif.gz_C crystal structure of a de novo designed ferredoxin fold, northeast structural genomics consortium (nesg) target or461 0.7258 128 166
1ztg-assembly1.cif.gz_A human alpha polyc binding protein kh1 0.6597 128 164
6u6r-assembly1.cif.gz_B solution nmr structure of the delta30-ngmine protein from neisseria gonorrheae 0.6371 117 147
5zeb-assembly1.cif.gz_h m. smegmatis p/p state 70s ribosome structure 0.5955 119 148
8gb1-assembly2.cif.gz_C crystal structure of samhd1 dimer bound to deoxyguanosine linked inhibitor 0.5789 125 166
ID Description Score Start End Superfamily
af_P0AF67_2_153_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6465 127 158 3.40.50.300
af_Q7Y168_279_532_2.70.240.10 Mainly Beta;Distorted Sandwich;Leukocidin-like;Leukocidin/porin MspA 0.6017 127 155 2.70.240.10
2od4A01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5923 129 167 3.30.70.100
af_K7M914_151_220_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.5922 119 164 3.30.1370.10
af_G5EG47_147_208_3.90.1150.220 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.5772 119 146 3.90.1150.220
ID Description Score Start End GO Terms
AF-A0A1Q8AX65-F1-model_v4 Uncharacterized protein 0.9941 46 164
AF-A0A2V8G759-F1-model_v4 Aspartate carbamoyltransferase 0.99 38 172
AF-A0A2V7KYK0-F1-model_v4 Uncharacterized protein 0.99 45 169
AF-A0A1F2SS74-F1-model_v4 Uncharacterized protein 0.9886 38 174
AF-A0A3C1NHS9-F1-model_v4 DUF1795 domain-containing protein 0.9829 41 175

Map