F392388

General Info

Members Datasets Scaffolds Average Seq Length
294 198 270 182

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2842324504|2842325517
Length 221
Sequence HRDQGGIRGSDEKGSGWTYLRTAVARMHSMKRLSPSVTHSDSLQGLSDILAPGLSVVFCGINPGLRAASTGRHFAGRGNRFWRTLHLAGFTPGQIDPQDDRTILQYGCGLTTVVSRPTARADELSQGEFKAAAIEFERKIEGYAPHCVAFLGKMALSAMSGTRDIDWGPQPALFGGARVWVLPNPSGLNRTFSLDALVTAYRELRLALASAEAGLRNVPRQ

Samples

Sample ID Description Type Environment
1 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
2 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
3 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
4 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
5 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
6 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
7 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
8 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
9 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
10 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
11 2818991450 Burkholderia sp. 604 Isolate Unclassified
12 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
13 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
14 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
15 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
16 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
17 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
18 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
19 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
20 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
21 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
22 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
23 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
24 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
25 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
30 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
31 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
32 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
33 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
34 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
35 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
36 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
37 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
38 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
39 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
40 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
41 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
51 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
70 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
71 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
74 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
75 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
106 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
107 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
111 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
120 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
121 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
128 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
134 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
142 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
143 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
144 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
145 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
146 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
156 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
173 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
176 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
177 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
182 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
183 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
194 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
197 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
198 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0
Isolates 8.16

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.18
Nodule 3.74
Rhizoplane 7.82
Rhizosphere 65.99
Stem 0
Stem Tuber 0
Unclassified 13.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1003266 3300002705 Bacteria 5378
2 JGI25156J39149_1025751 3300002705 Bacteria 940
3 rootH1_10065477 3300003316 Bacteria 3043
4 rootH2_10087452 3300003320 Bacteria 9791
5 rootL2_10016645 3300003322 Bacteria 4506
6 rootL2_10027749 3300003322 Bacteria 12311
7 rootH1_10146592 3300003323 Bacteria 3147
8 rootH1_10203024 3300003323 Bacteria 3341
9 JGI25160J50197_1000164 3300003354 Bacteria 57441
10 Ga0055533_1000493 3300003756 Bacteria 14532
11 Ga0055532_1000246 3300003758 Bacteria 39069
12 Ga0055527_1000184 3300003760 Bacteria 41781
13 Ga0055535_1000385 3300003761 Bacteria 41781
14 Ga0055542_1001723 3300003762 Bacteria 9425
15 Ga0055529_1001537 3300003763 Bacteria 6598
16 Ga0065165_1000713 3300005262 Bacteria 46892
17 Ga0070680_100025955 3300005336 Bacteria 4685
18 Ga0070660_100022043 3300005339 Bacteria 4706
19 Ga0070660_100100558 3300005339 Bacteria 2290
20 Ga0070691_10013144 3300005341 Bacteria 3792
21 Ga0070669_100219049 3300005353 Bacteria 1504
22 Ga0070671_100290904 3300005355 Bacteria 1390
23 Ga0070667_100056264 3300005367 Bacteria 3323
24 Ga0070711_100042319 3300005439 Bacteria 3079
25 Ga0070663_100066214 3300005455 Bacteria 2617
26 Ga0070663_100301164 3300005455 Bacteria 1283
27 Ga0068855_100015331 3300005563 Bacteria 9228
28 Ga0068855_100363793 3300005563 Bacteria 1591
29 Ga0068854_100081412 3300005578 Bacteria 2391
30 Ga0075364_10002521 3300006051 Bacteria 10257
31 Ga0075369_10001409 3300006186 Bacteria 8187
32 Ga0075370_10017950 3300006353 Bacteria 3831
33 Ga0105251_10000457 3300009011 Bacteria 39205
34 Ga0105251_10064128 3300009011 Bacteria 1723
35 Ga0105251_10079006 3300009011 Bacteria 1523
36 Ga0105250_10079590 3300009092 Bacteria 1328
37 Ga0105240_10105887 3300009093 Bacteria 3413
38 Ga0105240_10124481 3300009093 Bacteria 3100
39 Ga0105240_10295463 3300009093 Bacteria 1855
40 Ga0114129_10449466 3300009147 Bacteria 1690
41 Ga0105243_11977258 3300009148 Bacteria 617
42 Ga0105241_10369413 3300009174 Bacteria 1250
43 Ga0105248_10009372 3300009177 Bacteria 10778
44 Ga0105248_10052348 3300009177 Bacteria 4581
45 Ga0105248_10081735 3300009177 Bacteria 3632
46 Ga0105238_10190870 3300009551 Bacteria 2025
47 Ga0105238_10413691 3300009551 Bacteria 1342
48 Ga0105249_10523192 3300009553 Bacteria 1234
49 Ga0105239_10874950 3300010375 Bacteria 1031
50 Ga0105239_11932678 3300010375 Bacteria 684
51 Ga0105239_12047438 3300010375 Bacteria 665
52 Ga0157371_10008384 3300013102 Bacteria 8240
53 Ga0157370_10194813 3300013104 Bacteria 1881
54 Ga0157369_10000113 3300013105 Bacteria 113723
55 Ga0157369_10031528 3300013105 Bacteria 5835
56 Ga0157369_10098704 3300013105 Bacteria 3113
57 Ga0157374_10027736 3300013296 Bacteria 5112
58 Ga0157378_10025076 3300013297 Bacteria 5253
59 Ga0163162_10001454 3300013306 Bacteria 22027
60 Ga0157372_10041483 3300013307 Bacteria 5089
61 Ga0157372_11442477 3300013307 Bacteria 793
62 Ga0157375_10012849 3300013308 Bacteria 7436
63 Ga0157376_10256878 3300014969 Bacteria 1635
64 Ga0182006_1045848 3300015261 Bacteria 1700
65 Ga0182007_10001499 3300015262 Bacteria 12496
66 Ga0209435_104661 3300025206 Bacteria 1545
67 Ga0209674_100048 3300025226 Bacteria 353032
68 Ga0209759_1000032 3300025256 Bacteria 278697
69 Ga0209759_1000085 3300025256 Bacteria 168382
70 Ga0209233_1003334 3300025261 Bacteria 5686
71 Ga0209130_1002845 3300025284 Bacteria 8022
72 Ga0207426_1000353 3300025302 Bacteria 83869
73 Ga0207426_1016986 3300025302 Bacteria 2597
74 Ga0209051_1002351 3300025303 Bacteria 13687
75 Ga0207713_1000492 3300025735 Bacteria 40745
76 Ga0207680_10072613 3300025903 Bacteria 2137
77 Ga0207647_10000615 3300025904 Bacteria 27759
78 Ga0207647_10010851 3300025904 Bacteria 6414
79 Ga0207705_10013692 3300025909 Bacteria 5852
80 Ga0207695_10030361 3300025913 Bacteria 5950
81 Ga0207663_10018203 3300025916 Bacteria 3931
82 Ga0207657_10000114 3300025919 Bacteria 79120
83 Ga0207657_10031314 3300025919 Bacteria 4820
84 Ga0207694_10100601 3300025924 Bacteria 2290
85 Ga0207694_10745159 3300025924 Bacteria 827
86 Ga0207700_10028687 3300025928 Bacteria 3918
87 Ga0207711_10005463 3300025941 Bacteria 10744
88 Ga0207711_10042505 3300025941 Bacteria 3873
89 Ga0207711_10048083 3300025941 Bacteria 3649
90 Ga0207667_10007308 3300025949 Bacteria 13307
91 Ga0207667_10096250 3300025949 Bacteria 3055
92 Ga0207658_10119370 3300025986 Bacteria 2099
93 Ga0207639_10025797 3300026041 Bacteria 4264
94 Ga0207678_10271559 3300026067 Bacteria 1454
95 Ga0207702_10318920 3300026078 Unclassified 1480
96 Ga0265328_10089298 3300031239 Bacteria 1138
97 Ga0265320_10045309 3300031240 Bacteria 2162
98 Ga0265325_10025233 3300031241 Bacteria 3228
99 Ga0265340_10141993 3300031247 Bacteria 1098
100 Ga0265339_10029158 3300031249 Bacteria 3133
101 Ga0265339_10191995 3300031249 Bacteria 1012
102 Ga0265331_10101947 3300031250 Bacteria 1320
103 Ga0265316_10122335 3300031344 Bacteria 1965
104 Ga0265313_10005141 3300031595 Bacteria 9741
105 Ga0265342_10036530 3300031712 Bacteria 3000
106 Ga0265342_10245805 3300031712 Bacteria 956
107 Ga0307412_10004220 3300031911 Bacteria 8015
108 Ga0307416_100060503 3300032002 Bacteria 3085
109 Ga0395898_0000437 3300037466 Bacteria 87616
110 Ga0395905_0000020 3300037471 Bacteria 337672
111 Ga0395905_1224523 3300037471 Bacteria 654
112 Ga0395901_1025414 3300038443 Bacteria 799
113 Ga0466967_0158092 3300045976 Bacteria 2125
114 Ga0495590_0010359 3300046457 Bacteria 3507
115 Ga0495629_0000097 3300046459 Bacteria 76355
116 Ga0495629_0045325 3300046459 Bacteria 3085
117 Ga0495638_0004004 3300046460 Bacteria 11314
118 Ga0495638_0016905 3300046460 Bacteria 4877
119 Ga0495653_0000802 3300046463 Bacteria 24114
120 Ga0495650_0001626 3300046471 Bacteria 20921
121 Ga0495650_0010978 3300046471 Bacteria 5009
122 Ga0495650_0016512 3300046471 Bacteria 3737
123 Ga0495650_0037470 3300046471 Bacteria 2111
124 Ga0495580_0003314 3300046472 Bacteria 13773
125 Ga0495580_0008051 3300046472 Bacteria 8412
126 Ga0495580_0015580 3300046472 Bacteria 5730
127 Ga0495582_0194525 3300046473 Bacteria 1157
128 Ga0495605_0002610 3300046474 Bacteria 11072
129 Ga0495605_0002937 3300046474 Bacteria 10318
130 Ga0495605_0003508 3300046474 Bacteria 9324
131 Ga0495605_0003757 3300046474 Bacteria 9008
132 Ga0495639_0011794 3300046475 Bacteria 3769
133 Ga0495584_0175464 3300046491 Bacteria 1089
134 Ga0495585_0055107 3300046492 Bacteria 2198
135 Ga0495596_0156661 3300046500 Bacteria 885
136 Ga0495607_0018265 3300046501 Bacteria 4475
137 Ga0495583_0000148 3300046506 Bacteria 118749
138 Ga0495583_0001784 3300046506 Bacteria 20486
139 Ga0495583_0012351 3300046506 Bacteria 4840
140 Ga0495583_0014934 3300046506 Bacteria 4250
141 Ga0495583_0093683 3300046506 Bacteria 1290
142 Ga0495616_0014703 3300046513 Bacteria 4374
143 Ga0495616_0160155 3300046513 Bacteria 1013
144 Ga0495628_0005176 3300046516 Bacteria 11461
145 Ga0495630_0130003 3300046517 Bacteria 1912
146 Ga0495631_0002810 3300046518 Bacteria 9667
147 Ga0495632_0031510 3300046519 Bacteria 2740
148 Ga0495648_0000037 3300046524 Bacteria 195401
149 Ga0495648_0031659 3300046524 Bacteria 3480
150 Ga0495648_0065410 3300046524 Bacteria 2137
151 Ga0495666_0054030 3300046526 Bacteria 1927
152 Ga0495642_0001252 3300046528 Bacteria 11604
153 Ga0495642_0093280 3300046528 Bacteria 1276
154 Ga0495654_0098512 3300046530 Bacteria 1349
155 Ga0495665_0037949 3300046531 Bacteria 2570
156 Ga0495665_0038243 3300046531 Bacteria 2559
157 Ga0495587_0387604 3300046536 Bacteria 777
158 Ga0495587_0446372 3300046536 Bacteria 717
159 Ga0495609_0065534 3300046538 Bacteria 1601
160 Ga0495597_0065023 3300046542 Bacteria 1583
161 Ga0495622_0000040 3300046557 Bacteria 118542
162 Ga0495622_0048290 3300046557 Bacteria 1978
163 Ga0495633_0000653 3300046558 Bacteria 32049
164 Ga0495656_0161214 3300046615 Bacteria 1090
165 Ga0495668_0002555 3300046616 Bacteria 14799
166 Ga0495611_0007032 3300046648 Bacteria 4780
167 Ga0495611_0085846 3300046648 Bacteria 1452
168 Ga0495625_0000023 3300046660 Bacteria 274067
169 Ga0495625_0010556 3300046660 Bacteria 7628
170 Ga0495625_0059929 3300046660 Bacteria 2699
171 Ga0495625_0661263 3300046660 Bacteria 621
172 Ga0495588_0397193 3300046674 Bacteria 724
173 Ga0495623_0002409 3300046679 Bacteria 12408
174 Ga0495646_0001583 3300046680 Bacteria 13577
175 Ga0495669_0008904 3300046684 Bacteria 4229
176 Ga0495613_0136312 3300046689 Bacteria 1756
177 Ga0495624_0007637 3300046690 Bacteria 7591
178 Ga0495624_0095201 3300046690 Bacteria 1835
179 Ga0495671_0146198 3300046692 Bacteria 1151
180 Ga0495649_0062303 3300046694 Bacteria 2005
181 Ga0495649_0096769 3300046694 Bacteria 1570
182 Ga0495589_0001517 3300046794 Bacteria 13353
183 Ga0495589_0037192 3300046794 Bacteria 2439
184 Ga0495589_0037626 3300046794 Bacteria 2424
185 Ga0495660_0152205 3300046810 Bacteria 1141
186 Ga0495604_0000652 3300047317 Bacteria 29535
187 Ga0495674_0008531 3300047319 Bacteria 9753
188 Ga0495674_0009471 3300047319 Bacteria 9252
189 Ga0495674_0039055 3300047319 Bacteria 4255
190 Ga0495674_0070813 3300047319 Bacteria 3012
191 Ga0495674_0084696 3300047319 Bacteria 2716
192 Ga0495672_0108177 3300047320 Bacteria 1496
193 Ga0495676_0513723 3300047321 Bacteria 785
194 Ga0495683_0010183 3300047323 Bacteria 4980
195 Ga0495687_030114 3300047443 Bacteria 2502
196 Ga0495675_0004752 3300047444 Bacteria 8248
197 Ga0495679_000008 3300047446 Bacteria 367186
198 Ga0495679_023811 3300047446 Bacteria 2072
199 Ga0495686_0122520 3300047472 Bacteria 1548
200 Ga0495593_0022097 3300047673 Bacteria 3549
201 Ga0495593_0075200 3300047673 Bacteria 1751
202 Ga0495602_0036909 3300048088 Bacteria 4542
203 Ga0495626_0079139 3300048091 Bacteria 1463
204 Ga0495626_0095469 3300048091 Bacteria 1302
205 Ga0495626_0111117 3300048091 Bacteria 1187
206 Ga0496100_0000135 3300048903 Bacteria 41013
207 Ga0496100_0709126 3300048903 Bacteria 785
208 Ga0496100_0763775 3300048903 Bacteria 756
209 Ga0496101_0000212 3300048904 Bacteria 43773
210 Ga0496101_0304265 3300048904 Bacteria 1249
211 Ga0496102_0000541 3300048905 Bacteria 40900
212 Ga0496102_0003844 3300048905 Bacteria 12711
213 Ga0496103_0001322 3300048906 Bacteria 16814
214 Ga0496103_0074945 3300048906 Bacteria 2122
215 Ga0496104_0103755 3300048907 Bacteria 2724
216 Ga0496104_0475510 3300048907 Bacteria 1161
217 Ga0496105_0039516 3300048908 Bacteria 3889
218 Ga0496105_0138882 3300048908 Bacteria 2001
219 Ga0496106_0000009 3300048909 Bacteria 238601
220 Ga0496106_0039051 3300048909 Bacteria 3555
221 Ga0496106_0045545 3300048909 Bacteria 3295
222 Ga0496107_0023334 3300048910 Bacteria 4375
223 Ga0496112_0054792 3300048915 Bacteria 3919
224 Ga0496113_0031770 3300048916 Bacteria 3834
225 Ga0496114_0095880 3300048917 Bacteria 2525
226 Ga0496115_0014374 3300048918 Bacteria 5993
227 Ga0496115_0288298 3300048918 Bacteria 1347
228 Ga0496115_0322936 3300048918 Bacteria 1262
229 Ga0496116_0046225 3300048919 Bacteria 2940
230 Ga0496116_0061572 3300048919 Bacteria 2429
231 Ga0496116_0141474 3300048919 Bacteria 1353
232 Ga0496117_0001089 3300048920 Bacteria 41030
233 Ga0496117_0040949 3300048920 Bacteria 3401
234 Ga0496117_0086284 3300048920 Bacteria 2040
235 Ga0496117_0228553 3300048920 Bacteria 1030
236 Ga0496118_0000827 3300048921 Bacteria 49185
237 Ga0496118_0000897 3300048921 Bacteria 46751
238 Ga0496121_0001393 3300048924 Bacteria 40899
239 Ga0496121_0011704 3300048924 Bacteria 9687
240 Ga0496121_0012132 3300048924 Bacteria 9459
241 Ga0496121_0039432 3300048924 Bacteria 4163
242 Ga0496121_0175036 3300048924 Bacteria 1554
243 Ga0496124_0006141 3300048927 Bacteria 13179
244 Ga0496124_0433259 3300048927 Bacteria 902
245 Ga0496125_0044429 3300048928 Bacteria 3757
246 Ga0496126_0000082 3300048929 Bacteria 218571
247 Ga0496126_0000099 3300048929 Bacteria 204249
248 Ga0496126_0002241 3300048929 Bacteria 26687
249 Ga0496126_0030740 3300048929 Bacteria 5085
250 Ga0496126_0095157 3300048929 Bacteria 2613
251 Ga0495678_002627 3300049459 Bacteria 11981
252 Ga0495678_014003 3300049459 Bacteria 3743
253 Ga0495678_063215 3300049459 Bacteria 1383
254 Ga0495682_0204755 3300049460 Bacteria 699
255 Ga0501034_0064919 3300049571 Bacteria 3664
256 Ga0501034_0767480 3300049571 Bacteria 859
257 Ga0501034_0803571 3300049571 Bacteria 833
258 Ga0501046_0243905 3300049580 Bacteria 1324
259 Ga0501070_0000417 3300049586 Bacteria 38645
260 Ga0501083_0606813 3300049744 Unclassified 712
261 nmdc:mga03n38_2544_c1 3300050490 Bacteria 5659
262 nmdc:mga00v17_3616_c1 3300050491 Bacteria 7989
263 nmdc:mga06z11_82063_c1 3300050494 Bacteria 1732
264 nmdc:mga0sz30_3826_c1 3300050516 Bacteria 5426
265 Ga0500578_0212436 3300053086 Bacteria 1179
266 Ga0500594_0000512 3300053118 Bacteria 8398
267 Ga0500642_0051142 3300053130 Bacteria 1825
268 Ga0500568_0002460 3300053139 Bacteria 10890
269 Ga0500633_0000341 3300053160 Bacteria 7047
270 Ga0500636_0087686 3300053177 Bacteria 1786

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0160155 Ga0495616_0160155_39_500 153
2 3300046459 Ga0495629_0045325 Ga0495629_0045325_32_502 156
3 3300046536 Ga0495587_0387604 Ga0495587_0387604_257_763 167
4 3300048924 Ga0496121_0175036 Ga0496121_0175036_1027_1539 167
5 iso_pu_bacteria 2582581316 2585330501 167
6 3300005336 Ga0070680_100025955 Ga0070680_1000259555 169
7 3300005339 Ga0070660_100022043 Ga0070660_1000220433 169
8 3300005341 Ga0070691_10013144 Ga0070691_100131444 169
9 3300005563 Ga0068855_100015331 Ga0068855_1000153313 169
10 3300025919 Ga0207657_10000114 Ga0207657_1000011420 169
11 3300025924 Ga0207694_10100601 Ga0207694_101006011 169
12 3300025949 Ga0207667_10096250 Ga0207667_100962505 169
13 3300031239 Ga0265328_10089298 Ga0265328_100892981 172
14 3300031240 Ga0265320_10045309 Ga0265320_100453092 172
15 3300031241 Ga0265325_10025233 Ga0265325_100252334 172
16 3300031247 Ga0265340_10141993 Ga0265340_101419932 172
17 3300031249 Ga0265339_10191995 Ga0265339_101919952 172
18 3300031250 Ga0265331_10101947 Ga0265331_101019471 172
19 3300031344 Ga0265316_10122335 Ga0265316_101223353 172
20 3300031595 Ga0265313_10005141 Ga0265313_100051415 172
21 3300031712 Ga0265342_10036530 Ga0265342_100365303 172
22 iso_pu_bacteria 2808606384 2808971418 172
23 iso_pu_bacteria 2808606390 2809006198 172
24 iso_pu_bacteria 2808606391 2809013385 172
25 3300002705 JGI25156J39149_1025751 JGI25156J39149_10257512 176
26 3300003758 Ga0055532_1000246 Ga0055532_100024623 176
27 3300003760 Ga0055527_1000184 Ga0055527_100018424 176
28 3300003761 Ga0055535_1000385 Ga0055535_100038524 176
29 3300003762 Ga0055542_1001723 Ga0055542_10017234 176
30 3300003763 Ga0055529_1001537 Ga0055529_10015375 176
31 3300005563 Ga0068855_100363793 Ga0068855_1003637932 176
32 3300006051 Ga0075364_10002521 Ga0075364_100025218 176
33 3300006186 Ga0075369_10001409 Ga0075369_100014096 176
34 3300006353 Ga0075370_10017950 Ga0075370_100179505 176
35 3300009093 Ga0105240_10105887 Ga0105240_101058875 176
36 3300009147 Ga0114129_10449466 Ga0114129_104494662 176
37 3300013104 Ga0157370_10194813 Ga0157370_101948132 176
38 3300013105 Ga0157369_10031528 Ga0157369_100315287 176
39 3300045976 Ga0466967_0158092 Ga0466967_0158092_1500_2033 176
40 3300046474 Ga0495605_0003508 Ga0495605_0003508_2220_2777 176
41 3300046506 Ga0495583_0012351 Ga0495583_0012351_2168_2725 176
42 3300046518 Ga0495631_0002810 Ga0495631_0002810_2400_2957 176
43 3300046519 Ga0495632_0031510 Ga0495632_0031510_1032_1589 176
44 3300046616 Ga0495668_0002555 Ga0495668_0002555_7891_8448 176
45 3300046660 Ga0495625_0010556 Ga0495625_0010556_6670_7227 176
46 3300048918 Ga0496115_0014374 Ga0496115_0014374_1523_2062 176
47 3300049459 Ga0495678_063215 Ga0495678_063215_256_813 176
48 3300049571 Ga0501034_0803571 Ga0501034_0803571_176_793 176
49 3300049580 Ga0501046_0243905 Ga0501046_0243905_281_898 176
50 3300049586 Ga0501070_0000417 Ga0501070_0000417_5639_6256 176
51 3300049744 Ga0501083_0606813 Ga0501083_0606813_30_647 176
52 3300050490 nmdc:mga03n38_2544_c1 nmdc:mga03n38_2544_c1_454_987 176
53 3300050491 nmdc:mga00v17_3616_c1 nmdc:mga00v17_3616_c1_3799_4332 176
54 3300050494 nmdc:mga06z11_82063_c1 nmdc:mga06z11_82063_c1_1160_1693 176
55 3300050516 nmdc:mga0sz30_3826_c1 nmdc:mga0sz30_3826_c1_2383_2916 176
56 3300053086 Ga0500578_0212436 Ga0500578_0212436_306_863 176
57 3300053118 Ga0500594_0000512 Ga0500594_0000512_5153_5710 176
58 3300053130 Ga0500642_0051142 Ga0500642_0051142_1138_1695 176
59 3300053139 Ga0500568_0002460 Ga0500568_0002460_9005_9556 176
60 3300053160 Ga0500633_0000341 Ga0500633_0000341_3969_4520 176
61 3300053177 Ga0500636_0087686 Ga0500636_0087686_1064_1609 176
62 3300025302 Ga0207426_1016986 Ga0207426_10169863 177
63 3300048927 Ga0496124_0006141 Ga0496124_0006141_1378_1920 177
64 3300048928 Ga0496125_0044429 Ga0496125_0044429_1486_2028 177
65 3300048929 Ga0496126_0002241 Ga0496126_0002241_8196_8735 177
66 iso_pu_bacteria 2900634093 2900634719 177
67 iso_pu_bacteria 2921643360 2921643384 177
68 3300005353 Ga0070669_100219049 Ga0070669_1002190492 178
69 3300005355 Ga0070671_100290904 Ga0070671_1002909041 178
70 3300005367 Ga0070667_100056264 Ga0070667_1000562642 178
71 3300009011 Ga0105251_10064128 Ga0105251_100641282 178
72 3300009092 Ga0105250_10079590 Ga0105250_100795902 178
73 3300009148 Ga0105243_11977258 Ga0105243_119772581 178
74 3300009174 Ga0105241_10369413 Ga0105241_103694131 178
75 3300009177 Ga0105248_10081735 Ga0105248_100817352 178
76 3300009553 Ga0105249_10523192 Ga0105249_105231921 178
77 3300013306 Ga0163162_10001454 Ga0163162_1000145410 178
78 3300013308 Ga0157375_10012849 Ga0157375_100128495 178
79 3300025903 Ga0207680_10072613 Ga0207680_100726132 178
80 3300025941 Ga0207711_10048083 Ga0207711_100480833 178
81 3300025986 Ga0207658_10119370 Ga0207658_101193702 178
82 3300046457 Ga0495590_0010359 Ga0495590_0010359_705_1241 178
83 3300046459 Ga0495629_0000097 Ga0495629_0000097_66371_66907 178
84 3300046460 Ga0495638_0004004 Ga0495638_0004004_10300_10836 178
85 3300046463 Ga0495653_0000802 Ga0495653_0000802_8898_9434 178
86 3300046471 Ga0495650_0010978 Ga0495650_0010978_1424_1960 178
87 3300046471 Ga0495650_0016512 Ga0495650_0016512_2504_3043 178
88 3300046471 Ga0495650_0037470 Ga0495650_0037470_447_983 178
89 3300046472 Ga0495580_0003314 Ga0495580_0003314_9445_9981 178
90 3300046472 Ga0495580_0008051 Ga0495580_0008051_5435_5971 178
91 3300046473 Ga0495582_0194525 Ga0495582_0194525_142_678 178
92 3300046474 Ga0495605_0002610 Ga0495605_0002610_6734_7270 178
93 3300046474 Ga0495605_0002937 Ga0495605_0002937_7350_7886 178
94 3300046491 Ga0495584_0175464 Ga0495584_0175464_18_554 178
95 3300046492 Ga0495585_0055107 Ga0495585_0055107_1408_1944 178
96 3300046500 Ga0495596_0156661 Ga0495596_0156661_307_843 178
97 3300046501 Ga0495607_0018265 Ga0495607_0018265_308_844 178
98 3300046506 Ga0495583_0093683 Ga0495583_0093683_405_941 178
99 3300046516 Ga0495628_0005176 Ga0495628_0005176_5651_6187 178
100 3300046517 Ga0495630_0130003 Ga0495630_0130003_1277_1813 178
101 3300046524 Ga0495648_0031659 Ga0495648_0031659_2225_2761 178
102 3300046526 Ga0495666_0054030 Ga0495666_0054030_531_1067 178
103 3300046530 Ga0495654_0098512 Ga0495654_0098512_647_1183 178
104 3300046531 Ga0495665_0037949 Ga0495665_0037949_1425_1961 178
105 3300046531 Ga0495665_0038243 Ga0495665_0038243_1992_2528 178
106 3300046536 Ga0495587_0446372 Ga0495587_0446372_106_642 178
107 3300046538 Ga0495609_0065534 Ga0495609_0065534_747_1283 178
108 3300046542 Ga0495597_0065023 Ga0495597_0065023_673_1209 178
109 3300046648 Ga0495611_0007032 Ga0495611_0007032_3649_4185 178
110 3300046674 Ga0495588_0397193 Ga0495588_0397193_135_671 178
111 3300046679 Ga0495623_0002409 Ga0495623_0002409_6677_7213 178
112 3300046680 Ga0495646_0001583 Ga0495646_0001583_3734_4270 178
113 3300046684 Ga0495669_0008904 Ga0495669_0008904_2730_3266 178
114 3300046689 Ga0495613_0136312 Ga0495613_0136312_1175_1711 178
115 3300046690 Ga0495624_0007637 Ga0495624_0007637_5275_5811 178
116 3300046690 Ga0495624_0095201 Ga0495624_0095201_1170_1706 178
117 3300046692 Ga0495671_0146198 Ga0495671_0146198_442_978 178
118 3300046694 Ga0495649_0062303 Ga0495649_0062303_165_701 178
119 3300046794 Ga0495589_0001517 Ga0495589_0001517_11132_11668 178
120 3300046794 Ga0495589_0037192 Ga0495589_0037192_1396_1932 178
121 3300046810 Ga0495660_0152205 Ga0495660_0152205_154_690 178
122 3300047317 Ga0495604_0000652 Ga0495604_0000652_27248_27784 178
123 3300047319 Ga0495674_0039055 Ga0495674_0039055_2117_2653 178
124 3300047319 Ga0495674_0070813 Ga0495674_0070813_874_1410 178
125 3300047320 Ga0495672_0108177 Ga0495672_0108177_214_750 178
126 3300047321 Ga0495676_0513723 Ga0495676_0513723_168_704 178
127 3300047444 Ga0495675_0004752 Ga0495675_0004752_1539_2075 178
128 3300047446 Ga0495679_000008 Ga0495679_000008_224561_225097 178
129 3300047446 Ga0495679_023811 Ga0495679_023811_458_994 178
130 3300047673 Ga0495593_0022097 Ga0495593_0022097_1235_1771 178
131 3300047673 Ga0495593_0075200 Ga0495593_0075200_635_1171 178
132 3300048088 Ga0495602_0036909 Ga0495602_0036909_1840_2376 178
133 3300048091 Ga0495626_0095469 Ga0495626_0095469_290_826 178
134 3300048903 Ga0496100_0709126 Ga0496100_0709126_218_754 178
135 3300048904 Ga0496101_0304265 Ga0496101_0304265_665_1201 178
136 3300048905 Ga0496102_0003844 Ga0496102_0003844_1686_2222 178
137 3300048906 Ga0496103_0074945 Ga0496103_0074945_187_723 178
138 3300048908 Ga0496105_0039516 Ga0496105_0039516_2115_2651 178
139 3300048909 Ga0496106_0045545 Ga0496106_0045545_1111_1647 178
140 3300048910 Ga0496107_0023334 Ga0496107_0023334_3707_4243 178
141 3300048917 Ga0496114_0095880 Ga0496114_0095880_808_1344 178
142 3300048918 Ga0496115_0288298 Ga0496115_0288298_79_615 178
143 3300048920 Ga0496117_0040949 Ga0496117_0040949_1349_1885 178
144 3300048924 Ga0496121_0039432 Ga0496121_0039432_996_1532 178
145 3300049459 Ga0495678_014003 Ga0495678_014003_2714_3250 178
146 iso_pu_bacteria 2515154123 2515692151 178
147 3300003316 rootH1_10065477 rootH1_100654774 179
148 3300003354 JGI25160J50197_1000164 JGI25160J50197_100016431 179
149 3300005262 Ga0065165_1000713 Ga0065165_100071333 179
150 3300005455 Ga0070663_100301164 Ga0070663_1003011642 179
151 3300009093 Ga0105240_10124481 Ga0105240_101244811 179
152 3300009551 Ga0105238_10413691 Ga0105238_104136912 179
153 3300010375 Ga0105239_10874950 Ga0105239_108749501 179
154 3300010375 Ga0105239_11932678 Ga0105239_119326781 179
155 3300025284 Ga0209130_1002845 Ga0209130_10028457 179
156 3300025302 Ga0207426_1000353 Ga0207426_100035332 179
157 3300025303 Ga0209051_1002351 Ga0209051_10023515 179
158 3300025904 Ga0207647_10010851 Ga0207647_100108512 179
159 3300026067 Ga0207678_10271559 Ga0207678_102715592 179
160 3300026078 Ga0207702_10318920 Ga0207702_103189202 179
161 3300046472 Ga0495580_0015580 Ga0495580_0015580_3191_3730 179
162 3300046474 Ga0495605_0003757 Ga0495605_0003757_7048_7587 179
163 3300046506 Ga0495583_0014934 Ga0495583_0014934_620_1159 179
164 3300046513 Ga0495616_0014703 Ga0495616_0014703_804_1343 179
165 3300046524 Ga0495648_0065410 Ga0495648_0065410_546_1085 179
166 3300046528 Ga0495642_0093280 Ga0495642_0093280_18_557 179
167 3300046557 Ga0495622_0048290 Ga0495622_0048290_1229_1768 179
168 3300046648 Ga0495611_0085846 Ga0495611_0085846_371_910 179
169 3300046660 Ga0495625_0661263 Ga0495625_0661263_67_606 179
170 3300046794 Ga0495589_0037626 Ga0495589_0037626_443_982 179
171 3300047319 Ga0495674_0084696 Ga0495674_0084696_455_994 179
172 3300048091 Ga0495626_0111117 Ga0495626_0111117_400_939 179
173 3300048903 Ga0496100_0000135 Ga0496100_0000135_18141_18680 179
174 3300048903 Ga0496100_0763775 Ga0496100_0763775_91_630 179
175 3300048904 Ga0496101_0000212 Ga0496101_0000212_22318_22857 179
176 3300048905 Ga0496102_0000541 Ga0496102_0000541_22329_22868 179
177 3300048906 Ga0496103_0001322 Ga0496103_0001322_1623_2162 179
178 3300048907 Ga0496104_0103755 Ga0496104_0103755_855_1394 179
179 3300048908 Ga0496105_0138882 Ga0496105_0138882_1113_1652 179
180 3300048909 Ga0496106_0039051 Ga0496106_0039051_827_1366 179
181 3300048915 Ga0496112_0054792 Ga0496112_0054792_984_1523 179
182 3300048916 Ga0496113_0031770 Ga0496113_0031770_1327_1866 179
183 3300048918 Ga0496115_0322936 Ga0496115_0322936_228_767 179
184 3300048919 Ga0496116_0141474 Ga0496116_0141474_352_891 179
185 3300048920 Ga0496117_0001089 Ga0496117_0001089_18141_18680 179
186 3300048921 Ga0496118_0000827 Ga0496118_0000827_26335_26874 179
187 3300048924 Ga0496121_0001393 Ga0496121_0001393_22345_22884 179
188 3300048924 Ga0496121_0012132 Ga0496121_0012132_1405_1944 179
189 3300048927 Ga0496124_0433259 Ga0496124_0433259_55_594 179
190 3300048929 Ga0496126_0095157 Ga0496126_0095157_1756_2295 179
191 3300049460 Ga0495682_0204755 Ga0495682_0204755_92_631 179
192 3300003320 rootH2_10087452 rootH2_100874526 180
193 3300003322 rootL2_10016645 rootL2_100166453 180
194 3300003323 rootH1_10146592 rootH1_101465921 180
195 3300005439 Ga0070711_100042319 Ga0070711_1000423193 180
196 3300013296 Ga0157374_10027736 Ga0157374_100277365 180
197 3300013297 Ga0157378_10025076 Ga0157378_100250763 180
198 3300013307 Ga0157372_11442477 Ga0157372_114424771 180
199 3300014969 Ga0157376_10256878 Ga0157376_102568782 180
200 3300025916 Ga0207663_10018203 Ga0207663_100182032 180
201 3300025928 Ga0207700_10028687 Ga0207700_100286873 180
202 3300026041 Ga0207639_10025797 Ga0207639_100257973 180
203 3300046460 Ga0495638_0016905 Ga0495638_0016905_2938_3480 180
204 3300046471 Ga0495650_0001626 Ga0495650_0001626_11007_11555 180
205 3300046475 Ga0495639_0011794 Ga0495639_0011794_1511_2059 180
206 3300046506 Ga0495583_0000148 Ga0495583_0000148_9678_10226 180
207 3300046506 Ga0495583_0001784 Ga0495583_0001784_11750_12292 180
208 3300046524 Ga0495648_0000037 Ga0495648_0000037_185174_185722 180
209 3300046528 Ga0495642_0001252 Ga0495642_0001252_3019_3567 180
210 3300046557 Ga0495622_0000040 Ga0495622_0000040_108319_108867 180
211 3300046558 Ga0495633_0000653 Ga0495633_0000653_5891_6439 180
212 3300046615 Ga0495656_0161214 Ga0495656_0161214_65_610 180
213 3300046660 Ga0495625_0000023 Ga0495625_0000023_194254_194802 180
214 3300046660 Ga0495625_0059929 Ga0495625_0059929_822_1364 180
215 3300046694 Ga0495649_0096769 Ga0495649_0096769_699_1241 180
216 3300047323 Ga0495683_0010183 Ga0495683_0010183_1011_1553 180
217 3300047443 Ga0495687_030114 Ga0495687_030114_572_1114 180
218 3300048091 Ga0495626_0079139 Ga0495626_0079139_49_591 180
219 3300048907 Ga0496104_0475510 Ga0496104_0475510_256_798 180
220 3300048909 Ga0496106_0000009 Ga0496106_0000009_165470_166015 180
221 3300048920 Ga0496117_0228553 Ga0496117_0228553_461_1003 180
222 3300048924 Ga0496121_0011704 Ga0496121_0011704_5462_6007 180
223 3300048929 Ga0496126_0000099 Ga0496126_0000099_65087_65629 180
224 3300049459 Ga0495678_002627 Ga0495678_002627_6684_7232 180
225 3300003322 rootL2_10027749 rootL2_1002774913 181
226 3300009011 Ga0105251_10079006 Ga0105251_100790062 181
227 3300010375 Ga0105239_12047438 Ga0105239_120474381 181
228 3300031249 Ga0265339_10029158 Ga0265339_100291583 181
229 3300031712 Ga0265342_10245805 Ga0265342_102458052 181
230 3300031911 Ga0307412_10004220 Ga0307412_100042206 181
231 3300032002 Ga0307416_100060503 Ga0307416_1000605032 181
232 3300049571 Ga0501034_0064919 Ga0501034_0064919_1784_2329 181
233 3300049571 Ga0501034_0767480 Ga0501034_0767480_174_719 181
234 3300013102 Ga0157371_10008384 Ga0157371_100083842 182
235 3300013105 Ga0157369_10000113 Ga0157369_1000011366 182
236 3300025261 Ga0209233_1003334 Ga0209233_10033343 182
237 3300025924 Ga0207694_10745159 Ga0207694_107451592 182
238 iso_pu_bacteria 2721755763 2723878011 182
239 3300003323 rootH1_10203024 rootH1_102030243 183
240 3300009177 Ga0105248_10009372 Ga0105248_100093725 183
241 3300009177 Ga0105248_10052348 Ga0105248_100523482 183
242 3300025941 Ga0207711_10005463 Ga0207711_100054637 183
243 3300025941 Ga0207711_10042505 Ga0207711_100425052 183
244 3300047472 Ga0495686_0122520 Ga0495686_0122520_956_1510 183
245 3300048919 Ga0496116_0046225 Ga0496116_0046225_1723_2277 183
246 iso_pu_bacteria 2838029111 2838029651 183
247 iso_pu_bacteria 2842475841 2842475919 183
248 iso_pu_bacteria 2842502639 2842503179 183
249 iso_pu_bacteria 2919408235 2919408441 183
250 3300037471 Ga0395905_0000020 Ga0395905_0000020_230955_231509 184
251 3300037471 Ga0395905_1224523 Ga0395905_1224523_57_611 184
252 iso_pu_bacteria 2513237082 2513553219 184
253 iso_pu_bacteria 2515154189 2516017281 184
254 iso_pu_bacteria 642555113 642621681 184
255 3300003756 Ga0055533_1000493 Ga0055533_10004934 185
256 3300025206 Ga0209435_104661 Ga0209435_1046611 185
257 3300025226 Ga0209674_100048 Ga0209674_100048206 185
258 3300025256 Ga0209759_1000032 Ga0209759_1000032135 185
259 3300047319 Ga0495674_0009471 Ga0495674_0009471_5830_6387 185
260 3300048929 Ga0496126_0030740 Ga0496126_0030740_1278_1844 185
261 iso_pu_bacteria 2526164713 2527076349 185
262 3300005339 Ga0070660_100100558 Ga0070660_1001005582 186
263 3300005455 Ga0070663_100066214 Ga0070663_1000662143 186
264 3300005578 Ga0068854_100081412 Ga0068854_1000814122 186
265 3300009093 Ga0105240_10295463 Ga0105240_102954633 186
266 3300009551 Ga0105238_10190870 Ga0105238_101908702 186
267 3300013105 Ga0157369_10098704 Ga0157369_100987043 186
268 3300013307 Ga0157372_10041483 Ga0157372_100414833 186
269 3300025909 Ga0207705_10013692 Ga0207705_100136923 186
270 3300025913 Ga0207695_10030361 Ga0207695_100303613 186
271 3300025919 Ga0207657_10031314 Ga0207657_100313145 186
272 3300025949 Ga0207667_10007308 Ga0207667_100073085 186
273 3300037466 Ga0395898_0000437 Ga0395898_0000437_28611_29177 186
274 3300038443 Ga0395901_1025414 Ga0395901_1025414_11_577 186
275 3300048929 Ga0496126_0000082 Ga0496126_0000082_93101_93670 186
276 iso_pu_bacteria 2513237166 2514049269 186
277 iso_pu_bacteria 2928108538 2928111887 187
278 iso_pu_bacteria 2928135762 2928139126 187
279 iso_pu_bacteria 2928503688 2928508825 187
280 3300002705 JGI25156J39149_1003266 JGI25156J39149_10032664 188
281 3300009011 Ga0105251_10000457 Ga0105251_100004576 188
282 3300015261 Ga0182006_1045848 Ga0182006_10458482 188
283 3300015262 Ga0182007_10001499 Ga0182007_100014999 188
284 3300025256 Ga0209759_1000085 Ga0209759_1000085147 188
285 3300025735 Ga0207713_1000492 Ga0207713_10004926 188
286 3300025904 Ga0207647_10000615 Ga0207647_100006152 188
287 3300047319 Ga0495674_0008531 Ga0495674_0008531_2660_3400 188
288 3300048919 Ga0496116_0061572 Ga0496116_0061572_885_1466 188
289 3300048920 Ga0496117_0086284 Ga0496117_0086284_141_770 188
290 3300048921 Ga0496118_0000897 Ga0496118_0000897_27148_27777 188
291 iso_pu_bacteria 2818991450 2819622473 188
292 iso_pu_bacteria 2842324504 2842325517 188
293 iso_pu_bacteria 2842348783 2842349796 188
294 iso_pu_bacteria 2842454564 2842454966 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03167

UDG

Uracil DNA glycosylase superfamily

47

205

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.9739 17 181
1mtl-assembly1.cif.gz_B non-productive mug-dna complex 0.9624 17 180
1mwj-assembly1.cif.gz_A crystal structure of a mug-dna pseudo substrate complex 0.9624 17 181
3uo7-assembly1.cif.gz_A crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine 0.9583 17 179
1mtl-assembly1.cif.gz_A non-productive mug-dna complex 0.9569 18 180
ID Description Score Start End Superfamily
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9569 18 180 3.40.470.10
3uobA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9565 17 179 3.40.470.10
af_Q9V4D8_761_956_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.954 16 179 3.40.470.10
1mtlA00 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.9451 18 180 3.40.470.10
af_O59825_127_324_3.40.470.10 Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain 0.8935 2 179 3.40.470.10
ID Description Score Start End GO Terms
AF-A0A6J5G1L6-F1-model_v4 deleted 0.9991 28 178
AF-A0A7U6GSL7-F1-model_v4 deleted 0.9983 13 179
AF-J3GFQ2-F1-model_v4 G:T/U mismatch-specific DNA glycosylase 0.9976 16 179 GO:0004844
GO:0006285
GO:0008263
AF-A0A372KC49-F1-model_v4 G/U mismatch-specific DNA glycosylase 0.9968 28 179 GO:0004844
GO:0006285
GO:0008263
AF-Q46SQ2-F1-model_v4 G/U mismatch-specific uracil-DNA glycosylase (EC 3.2.2.-) 0.9957 16 179 GO:0004844
GO:0006285
GO:0008263

Feature Viewer

pLDDT pTM Quality
88.81 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map