F392388
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 294 | 198 | 270 | 182 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2842324504|2842325517 |
| Length | 221 |
| Sequence | HRDQGGIRGSDEKGSGWTYLRTAVARMHSMKRLSPSVTHSDSLQGLSDILAPGLSVVFCGINPGLRAASTGRHFAGRGNRFWRTLHLAGFTPGQIDPQDDRTILQYGCGLTTVVSRPTARADELSQGEFKAAAIEFERKIEGYAPHCVAFLGKMALSAMSGTRDIDWGPQPALFGGARVWVLPNPSGLNRTFSLDALVTAYRELRLALASAEAGLRNVPRQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 2 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 3 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 4 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 5 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 6 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 7 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 8 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 9 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 10 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 11 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 12 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 13 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 14 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 15 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 16 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 17 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 18 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 19 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 20 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 21 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 22 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 23 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 24 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 25 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 26 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 29 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 30 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 32 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 33 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 34 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 35 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 36 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 37 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 49 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 50 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 70 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 71 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 72 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 74 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 94 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 95 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 96 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 97 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 99 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 100 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 101 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 106 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 107 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 108 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 164 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 165 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 166 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 167 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 168 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 169 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 170 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 171 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 172 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 173 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 174 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 175 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 176 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 177 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 178 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 182 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 189 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 190 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 191 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 192 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 193 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 194 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 195 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 196 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 197 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 198 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.84 |
| Metatranscriptomes | 0 |
| Isolates | 8.16 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.18 |
| Nodule | 3.74 |
| Rhizoplane | 7.82 |
| Rhizosphere | 65.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.27 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1003266 | 3300002705 | Bacteria | 5378 |
| 2 | JGI25156J39149_1025751 | 3300002705 | Bacteria | 940 |
| 3 | rootH1_10065477 | 3300003316 | Bacteria | 3043 |
| 4 | rootH2_10087452 | 3300003320 | Bacteria | 9791 |
| 5 | rootL2_10016645 | 3300003322 | Bacteria | 4506 |
| 6 | rootL2_10027749 | 3300003322 | Bacteria | 12311 |
| 7 | rootH1_10146592 | 3300003323 | Bacteria | 3147 |
| 8 | rootH1_10203024 | 3300003323 | Bacteria | 3341 |
| 9 | JGI25160J50197_1000164 | 3300003354 | Bacteria | 57441 |
| 10 | Ga0055533_1000493 | 3300003756 | Bacteria | 14532 |
| 11 | Ga0055532_1000246 | 3300003758 | Bacteria | 39069 |
| 12 | Ga0055527_1000184 | 3300003760 | Bacteria | 41781 |
| 13 | Ga0055535_1000385 | 3300003761 | Bacteria | 41781 |
| 14 | Ga0055542_1001723 | 3300003762 | Bacteria | 9425 |
| 15 | Ga0055529_1001537 | 3300003763 | Bacteria | 6598 |
| 16 | Ga0065165_1000713 | 3300005262 | Bacteria | 46892 |
| 17 | Ga0070680_100025955 | 3300005336 | Bacteria | 4685 |
| 18 | Ga0070660_100022043 | 3300005339 | Bacteria | 4706 |
| 19 | Ga0070660_100100558 | 3300005339 | Bacteria | 2290 |
| 20 | Ga0070691_10013144 | 3300005341 | Bacteria | 3792 |
| 21 | Ga0070669_100219049 | 3300005353 | Bacteria | 1504 |
| 22 | Ga0070671_100290904 | 3300005355 | Bacteria | 1390 |
| 23 | Ga0070667_100056264 | 3300005367 | Bacteria | 3323 |
| 24 | Ga0070711_100042319 | 3300005439 | Bacteria | 3079 |
| 25 | Ga0070663_100066214 | 3300005455 | Bacteria | 2617 |
| 26 | Ga0070663_100301164 | 3300005455 | Bacteria | 1283 |
| 27 | Ga0068855_100015331 | 3300005563 | Bacteria | 9228 |
| 28 | Ga0068855_100363793 | 3300005563 | Bacteria | 1591 |
| 29 | Ga0068854_100081412 | 3300005578 | Bacteria | 2391 |
| 30 | Ga0075364_10002521 | 3300006051 | Bacteria | 10257 |
| 31 | Ga0075369_10001409 | 3300006186 | Bacteria | 8187 |
| 32 | Ga0075370_10017950 | 3300006353 | Bacteria | 3831 |
| 33 | Ga0105251_10000457 | 3300009011 | Bacteria | 39205 |
| 34 | Ga0105251_10064128 | 3300009011 | Bacteria | 1723 |
| 35 | Ga0105251_10079006 | 3300009011 | Bacteria | 1523 |
| 36 | Ga0105250_10079590 | 3300009092 | Bacteria | 1328 |
| 37 | Ga0105240_10105887 | 3300009093 | Bacteria | 3413 |
| 38 | Ga0105240_10124481 | 3300009093 | Bacteria | 3100 |
| 39 | Ga0105240_10295463 | 3300009093 | Bacteria | 1855 |
| 40 | Ga0114129_10449466 | 3300009147 | Bacteria | 1690 |
| 41 | Ga0105243_11977258 | 3300009148 | Bacteria | 617 |
| 42 | Ga0105241_10369413 | 3300009174 | Bacteria | 1250 |
| 43 | Ga0105248_10009372 | 3300009177 | Bacteria | 10778 |
| 44 | Ga0105248_10052348 | 3300009177 | Bacteria | 4581 |
| 45 | Ga0105248_10081735 | 3300009177 | Bacteria | 3632 |
| 46 | Ga0105238_10190870 | 3300009551 | Bacteria | 2025 |
| 47 | Ga0105238_10413691 | 3300009551 | Bacteria | 1342 |
| 48 | Ga0105249_10523192 | 3300009553 | Bacteria | 1234 |
| 49 | Ga0105239_10874950 | 3300010375 | Bacteria | 1031 |
| 50 | Ga0105239_11932678 | 3300010375 | Bacteria | 684 |
| 51 | Ga0105239_12047438 | 3300010375 | Bacteria | 665 |
| 52 | Ga0157371_10008384 | 3300013102 | Bacteria | 8240 |
| 53 | Ga0157370_10194813 | 3300013104 | Bacteria | 1881 |
| 54 | Ga0157369_10000113 | 3300013105 | Bacteria | 113723 |
| 55 | Ga0157369_10031528 | 3300013105 | Bacteria | 5835 |
| 56 | Ga0157369_10098704 | 3300013105 | Bacteria | 3113 |
| 57 | Ga0157374_10027736 | 3300013296 | Bacteria | 5112 |
| 58 | Ga0157378_10025076 | 3300013297 | Bacteria | 5253 |
| 59 | Ga0163162_10001454 | 3300013306 | Bacteria | 22027 |
| 60 | Ga0157372_10041483 | 3300013307 | Bacteria | 5089 |
| 61 | Ga0157372_11442477 | 3300013307 | Bacteria | 793 |
| 62 | Ga0157375_10012849 | 3300013308 | Bacteria | 7436 |
| 63 | Ga0157376_10256878 | 3300014969 | Bacteria | 1635 |
| 64 | Ga0182006_1045848 | 3300015261 | Bacteria | 1700 |
| 65 | Ga0182007_10001499 | 3300015262 | Bacteria | 12496 |
| 66 | Ga0209435_104661 | 3300025206 | Bacteria | 1545 |
| 67 | Ga0209674_100048 | 3300025226 | Bacteria | 353032 |
| 68 | Ga0209759_1000032 | 3300025256 | Bacteria | 278697 |
| 69 | Ga0209759_1000085 | 3300025256 | Bacteria | 168382 |
| 70 | Ga0209233_1003334 | 3300025261 | Bacteria | 5686 |
| 71 | Ga0209130_1002845 | 3300025284 | Bacteria | 8022 |
| 72 | Ga0207426_1000353 | 3300025302 | Bacteria | 83869 |
| 73 | Ga0207426_1016986 | 3300025302 | Bacteria | 2597 |
| 74 | Ga0209051_1002351 | 3300025303 | Bacteria | 13687 |
| 75 | Ga0207713_1000492 | 3300025735 | Bacteria | 40745 |
| 76 | Ga0207680_10072613 | 3300025903 | Bacteria | 2137 |
| 77 | Ga0207647_10000615 | 3300025904 | Bacteria | 27759 |
| 78 | Ga0207647_10010851 | 3300025904 | Bacteria | 6414 |
| 79 | Ga0207705_10013692 | 3300025909 | Bacteria | 5852 |
| 80 | Ga0207695_10030361 | 3300025913 | Bacteria | 5950 |
| 81 | Ga0207663_10018203 | 3300025916 | Bacteria | 3931 |
| 82 | Ga0207657_10000114 | 3300025919 | Bacteria | 79120 |
| 83 | Ga0207657_10031314 | 3300025919 | Bacteria | 4820 |
| 84 | Ga0207694_10100601 | 3300025924 | Bacteria | 2290 |
| 85 | Ga0207694_10745159 | 3300025924 | Bacteria | 827 |
| 86 | Ga0207700_10028687 | 3300025928 | Bacteria | 3918 |
| 87 | Ga0207711_10005463 | 3300025941 | Bacteria | 10744 |
| 88 | Ga0207711_10042505 | 3300025941 | Bacteria | 3873 |
| 89 | Ga0207711_10048083 | 3300025941 | Bacteria | 3649 |
| 90 | Ga0207667_10007308 | 3300025949 | Bacteria | 13307 |
| 91 | Ga0207667_10096250 | 3300025949 | Bacteria | 3055 |
| 92 | Ga0207658_10119370 | 3300025986 | Bacteria | 2099 |
| 93 | Ga0207639_10025797 | 3300026041 | Bacteria | 4264 |
| 94 | Ga0207678_10271559 | 3300026067 | Bacteria | 1454 |
| 95 | Ga0207702_10318920 | 3300026078 | Unclassified | 1480 |
| 96 | Ga0265328_10089298 | 3300031239 | Bacteria | 1138 |
| 97 | Ga0265320_10045309 | 3300031240 | Bacteria | 2162 |
| 98 | Ga0265325_10025233 | 3300031241 | Bacteria | 3228 |
| 99 | Ga0265340_10141993 | 3300031247 | Bacteria | 1098 |
| 100 | Ga0265339_10029158 | 3300031249 | Bacteria | 3133 |
| 101 | Ga0265339_10191995 | 3300031249 | Bacteria | 1012 |
| 102 | Ga0265331_10101947 | 3300031250 | Bacteria | 1320 |
| 103 | Ga0265316_10122335 | 3300031344 | Bacteria | 1965 |
| 104 | Ga0265313_10005141 | 3300031595 | Bacteria | 9741 |
| 105 | Ga0265342_10036530 | 3300031712 | Bacteria | 3000 |
| 106 | Ga0265342_10245805 | 3300031712 | Bacteria | 956 |
| 107 | Ga0307412_10004220 | 3300031911 | Bacteria | 8015 |
| 108 | Ga0307416_100060503 | 3300032002 | Bacteria | 3085 |
| 109 | Ga0395898_0000437 | 3300037466 | Bacteria | 87616 |
| 110 | Ga0395905_0000020 | 3300037471 | Bacteria | 337672 |
| 111 | Ga0395905_1224523 | 3300037471 | Bacteria | 654 |
| 112 | Ga0395901_1025414 | 3300038443 | Bacteria | 799 |
| 113 | Ga0466967_0158092 | 3300045976 | Bacteria | 2125 |
| 114 | Ga0495590_0010359 | 3300046457 | Bacteria | 3507 |
| 115 | Ga0495629_0000097 | 3300046459 | Bacteria | 76355 |
| 116 | Ga0495629_0045325 | 3300046459 | Bacteria | 3085 |
| 117 | Ga0495638_0004004 | 3300046460 | Bacteria | 11314 |
| 118 | Ga0495638_0016905 | 3300046460 | Bacteria | 4877 |
| 119 | Ga0495653_0000802 | 3300046463 | Bacteria | 24114 |
| 120 | Ga0495650_0001626 | 3300046471 | Bacteria | 20921 |
| 121 | Ga0495650_0010978 | 3300046471 | Bacteria | 5009 |
| 122 | Ga0495650_0016512 | 3300046471 | Bacteria | 3737 |
| 123 | Ga0495650_0037470 | 3300046471 | Bacteria | 2111 |
| 124 | Ga0495580_0003314 | 3300046472 | Bacteria | 13773 |
| 125 | Ga0495580_0008051 | 3300046472 | Bacteria | 8412 |
| 126 | Ga0495580_0015580 | 3300046472 | Bacteria | 5730 |
| 127 | Ga0495582_0194525 | 3300046473 | Bacteria | 1157 |
| 128 | Ga0495605_0002610 | 3300046474 | Bacteria | 11072 |
| 129 | Ga0495605_0002937 | 3300046474 | Bacteria | 10318 |
| 130 | Ga0495605_0003508 | 3300046474 | Bacteria | 9324 |
| 131 | Ga0495605_0003757 | 3300046474 | Bacteria | 9008 |
| 132 | Ga0495639_0011794 | 3300046475 | Bacteria | 3769 |
| 133 | Ga0495584_0175464 | 3300046491 | Bacteria | 1089 |
| 134 | Ga0495585_0055107 | 3300046492 | Bacteria | 2198 |
| 135 | Ga0495596_0156661 | 3300046500 | Bacteria | 885 |
| 136 | Ga0495607_0018265 | 3300046501 | Bacteria | 4475 |
| 137 | Ga0495583_0000148 | 3300046506 | Bacteria | 118749 |
| 138 | Ga0495583_0001784 | 3300046506 | Bacteria | 20486 |
| 139 | Ga0495583_0012351 | 3300046506 | Bacteria | 4840 |
| 140 | Ga0495583_0014934 | 3300046506 | Bacteria | 4250 |
| 141 | Ga0495583_0093683 | 3300046506 | Bacteria | 1290 |
| 142 | Ga0495616_0014703 | 3300046513 | Bacteria | 4374 |
| 143 | Ga0495616_0160155 | 3300046513 | Bacteria | 1013 |
| 144 | Ga0495628_0005176 | 3300046516 | Bacteria | 11461 |
| 145 | Ga0495630_0130003 | 3300046517 | Bacteria | 1912 |
| 146 | Ga0495631_0002810 | 3300046518 | Bacteria | 9667 |
| 147 | Ga0495632_0031510 | 3300046519 | Bacteria | 2740 |
| 148 | Ga0495648_0000037 | 3300046524 | Bacteria | 195401 |
| 149 | Ga0495648_0031659 | 3300046524 | Bacteria | 3480 |
| 150 | Ga0495648_0065410 | 3300046524 | Bacteria | 2137 |
| 151 | Ga0495666_0054030 | 3300046526 | Bacteria | 1927 |
| 152 | Ga0495642_0001252 | 3300046528 | Bacteria | 11604 |
| 153 | Ga0495642_0093280 | 3300046528 | Bacteria | 1276 |
| 154 | Ga0495654_0098512 | 3300046530 | Bacteria | 1349 |
| 155 | Ga0495665_0037949 | 3300046531 | Bacteria | 2570 |
| 156 | Ga0495665_0038243 | 3300046531 | Bacteria | 2559 |
| 157 | Ga0495587_0387604 | 3300046536 | Bacteria | 777 |
| 158 | Ga0495587_0446372 | 3300046536 | Bacteria | 717 |
| 159 | Ga0495609_0065534 | 3300046538 | Bacteria | 1601 |
| 160 | Ga0495597_0065023 | 3300046542 | Bacteria | 1583 |
| 161 | Ga0495622_0000040 | 3300046557 | Bacteria | 118542 |
| 162 | Ga0495622_0048290 | 3300046557 | Bacteria | 1978 |
| 163 | Ga0495633_0000653 | 3300046558 | Bacteria | 32049 |
| 164 | Ga0495656_0161214 | 3300046615 | Bacteria | 1090 |
| 165 | Ga0495668_0002555 | 3300046616 | Bacteria | 14799 |
| 166 | Ga0495611_0007032 | 3300046648 | Bacteria | 4780 |
| 167 | Ga0495611_0085846 | 3300046648 | Bacteria | 1452 |
| 168 | Ga0495625_0000023 | 3300046660 | Bacteria | 274067 |
| 169 | Ga0495625_0010556 | 3300046660 | Bacteria | 7628 |
| 170 | Ga0495625_0059929 | 3300046660 | Bacteria | 2699 |
| 171 | Ga0495625_0661263 | 3300046660 | Bacteria | 621 |
| 172 | Ga0495588_0397193 | 3300046674 | Bacteria | 724 |
| 173 | Ga0495623_0002409 | 3300046679 | Bacteria | 12408 |
| 174 | Ga0495646_0001583 | 3300046680 | Bacteria | 13577 |
| 175 | Ga0495669_0008904 | 3300046684 | Bacteria | 4229 |
| 176 | Ga0495613_0136312 | 3300046689 | Bacteria | 1756 |
| 177 | Ga0495624_0007637 | 3300046690 | Bacteria | 7591 |
| 178 | Ga0495624_0095201 | 3300046690 | Bacteria | 1835 |
| 179 | Ga0495671_0146198 | 3300046692 | Bacteria | 1151 |
| 180 | Ga0495649_0062303 | 3300046694 | Bacteria | 2005 |
| 181 | Ga0495649_0096769 | 3300046694 | Bacteria | 1570 |
| 182 | Ga0495589_0001517 | 3300046794 | Bacteria | 13353 |
| 183 | Ga0495589_0037192 | 3300046794 | Bacteria | 2439 |
| 184 | Ga0495589_0037626 | 3300046794 | Bacteria | 2424 |
| 185 | Ga0495660_0152205 | 3300046810 | Bacteria | 1141 |
| 186 | Ga0495604_0000652 | 3300047317 | Bacteria | 29535 |
| 187 | Ga0495674_0008531 | 3300047319 | Bacteria | 9753 |
| 188 | Ga0495674_0009471 | 3300047319 | Bacteria | 9252 |
| 189 | Ga0495674_0039055 | 3300047319 | Bacteria | 4255 |
| 190 | Ga0495674_0070813 | 3300047319 | Bacteria | 3012 |
| 191 | Ga0495674_0084696 | 3300047319 | Bacteria | 2716 |
| 192 | Ga0495672_0108177 | 3300047320 | Bacteria | 1496 |
| 193 | Ga0495676_0513723 | 3300047321 | Bacteria | 785 |
| 194 | Ga0495683_0010183 | 3300047323 | Bacteria | 4980 |
| 195 | Ga0495687_030114 | 3300047443 | Bacteria | 2502 |
| 196 | Ga0495675_0004752 | 3300047444 | Bacteria | 8248 |
| 197 | Ga0495679_000008 | 3300047446 | Bacteria | 367186 |
| 198 | Ga0495679_023811 | 3300047446 | Bacteria | 2072 |
| 199 | Ga0495686_0122520 | 3300047472 | Bacteria | 1548 |
| 200 | Ga0495593_0022097 | 3300047673 | Bacteria | 3549 |
| 201 | Ga0495593_0075200 | 3300047673 | Bacteria | 1751 |
| 202 | Ga0495602_0036909 | 3300048088 | Bacteria | 4542 |
| 203 | Ga0495626_0079139 | 3300048091 | Bacteria | 1463 |
| 204 | Ga0495626_0095469 | 3300048091 | Bacteria | 1302 |
| 205 | Ga0495626_0111117 | 3300048091 | Bacteria | 1187 |
| 206 | Ga0496100_0000135 | 3300048903 | Bacteria | 41013 |
| 207 | Ga0496100_0709126 | 3300048903 | Bacteria | 785 |
| 208 | Ga0496100_0763775 | 3300048903 | Bacteria | 756 |
| 209 | Ga0496101_0000212 | 3300048904 | Bacteria | 43773 |
| 210 | Ga0496101_0304265 | 3300048904 | Bacteria | 1249 |
| 211 | Ga0496102_0000541 | 3300048905 | Bacteria | 40900 |
| 212 | Ga0496102_0003844 | 3300048905 | Bacteria | 12711 |
| 213 | Ga0496103_0001322 | 3300048906 | Bacteria | 16814 |
| 214 | Ga0496103_0074945 | 3300048906 | Bacteria | 2122 |
| 215 | Ga0496104_0103755 | 3300048907 | Bacteria | 2724 |
| 216 | Ga0496104_0475510 | 3300048907 | Bacteria | 1161 |
| 217 | Ga0496105_0039516 | 3300048908 | Bacteria | 3889 |
| 218 | Ga0496105_0138882 | 3300048908 | Bacteria | 2001 |
| 219 | Ga0496106_0000009 | 3300048909 | Bacteria | 238601 |
| 220 | Ga0496106_0039051 | 3300048909 | Bacteria | 3555 |
| 221 | Ga0496106_0045545 | 3300048909 | Bacteria | 3295 |
| 222 | Ga0496107_0023334 | 3300048910 | Bacteria | 4375 |
| 223 | Ga0496112_0054792 | 3300048915 | Bacteria | 3919 |
| 224 | Ga0496113_0031770 | 3300048916 | Bacteria | 3834 |
| 225 | Ga0496114_0095880 | 3300048917 | Bacteria | 2525 |
| 226 | Ga0496115_0014374 | 3300048918 | Bacteria | 5993 |
| 227 | Ga0496115_0288298 | 3300048918 | Bacteria | 1347 |
| 228 | Ga0496115_0322936 | 3300048918 | Bacteria | 1262 |
| 229 | Ga0496116_0046225 | 3300048919 | Bacteria | 2940 |
| 230 | Ga0496116_0061572 | 3300048919 | Bacteria | 2429 |
| 231 | Ga0496116_0141474 | 3300048919 | Bacteria | 1353 |
| 232 | Ga0496117_0001089 | 3300048920 | Bacteria | 41030 |
| 233 | Ga0496117_0040949 | 3300048920 | Bacteria | 3401 |
| 234 | Ga0496117_0086284 | 3300048920 | Bacteria | 2040 |
| 235 | Ga0496117_0228553 | 3300048920 | Bacteria | 1030 |
| 236 | Ga0496118_0000827 | 3300048921 | Bacteria | 49185 |
| 237 | Ga0496118_0000897 | 3300048921 | Bacteria | 46751 |
| 238 | Ga0496121_0001393 | 3300048924 | Bacteria | 40899 |
| 239 | Ga0496121_0011704 | 3300048924 | Bacteria | 9687 |
| 240 | Ga0496121_0012132 | 3300048924 | Bacteria | 9459 |
| 241 | Ga0496121_0039432 | 3300048924 | Bacteria | 4163 |
| 242 | Ga0496121_0175036 | 3300048924 | Bacteria | 1554 |
| 243 | Ga0496124_0006141 | 3300048927 | Bacteria | 13179 |
| 244 | Ga0496124_0433259 | 3300048927 | Bacteria | 902 |
| 245 | Ga0496125_0044429 | 3300048928 | Bacteria | 3757 |
| 246 | Ga0496126_0000082 | 3300048929 | Bacteria | 218571 |
| 247 | Ga0496126_0000099 | 3300048929 | Bacteria | 204249 |
| 248 | Ga0496126_0002241 | 3300048929 | Bacteria | 26687 |
| 249 | Ga0496126_0030740 | 3300048929 | Bacteria | 5085 |
| 250 | Ga0496126_0095157 | 3300048929 | Bacteria | 2613 |
| 251 | Ga0495678_002627 | 3300049459 | Bacteria | 11981 |
| 252 | Ga0495678_014003 | 3300049459 | Bacteria | 3743 |
| 253 | Ga0495678_063215 | 3300049459 | Bacteria | 1383 |
| 254 | Ga0495682_0204755 | 3300049460 | Bacteria | 699 |
| 255 | Ga0501034_0064919 | 3300049571 | Bacteria | 3664 |
| 256 | Ga0501034_0767480 | 3300049571 | Bacteria | 859 |
| 257 | Ga0501034_0803571 | 3300049571 | Bacteria | 833 |
| 258 | Ga0501046_0243905 | 3300049580 | Bacteria | 1324 |
| 259 | Ga0501070_0000417 | 3300049586 | Bacteria | 38645 |
| 260 | Ga0501083_0606813 | 3300049744 | Unclassified | 712 |
| 261 | nmdc:mga03n38_2544_c1 | 3300050490 | Bacteria | 5659 |
| 262 | nmdc:mga00v17_3616_c1 | 3300050491 | Bacteria | 7989 |
| 263 | nmdc:mga06z11_82063_c1 | 3300050494 | Bacteria | 1732 |
| 264 | nmdc:mga0sz30_3826_c1 | 3300050516 | Bacteria | 5426 |
| 265 | Ga0500578_0212436 | 3300053086 | Bacteria | 1179 |
| 266 | Ga0500594_0000512 | 3300053118 | Bacteria | 8398 |
| 267 | Ga0500642_0051142 | 3300053130 | Bacteria | 1825 |
| 268 | Ga0500568_0002460 | 3300053139 | Bacteria | 10890 |
| 269 | Ga0500633_0000341 | 3300053160 | Bacteria | 7047 |
| 270 | Ga0500636_0087686 | 3300053177 | Bacteria | 1786 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046513 | Ga0495616_0160155 | Ga0495616_0160155_39_500 | 153 |
| 2 | 3300046459 | Ga0495629_0045325 | Ga0495629_0045325_32_502 | 156 |
| 3 | 3300046536 | Ga0495587_0387604 | Ga0495587_0387604_257_763 | 167 |
| 4 | 3300048924 | Ga0496121_0175036 | Ga0496121_0175036_1027_1539 | 167 |
| 5 | iso_pu_bacteria | 2582581316 | 2585330501 | 167 |
| 6 | 3300005336 | Ga0070680_100025955 | Ga0070680_1000259555 | 169 |
| 7 | 3300005339 | Ga0070660_100022043 | Ga0070660_1000220433 | 169 |
| 8 | 3300005341 | Ga0070691_10013144 | Ga0070691_100131444 | 169 |
| 9 | 3300005563 | Ga0068855_100015331 | Ga0068855_1000153313 | 169 |
| 10 | 3300025919 | Ga0207657_10000114 | Ga0207657_1000011420 | 169 |
| 11 | 3300025924 | Ga0207694_10100601 | Ga0207694_101006011 | 169 |
| 12 | 3300025949 | Ga0207667_10096250 | Ga0207667_100962505 | 169 |
| 13 | 3300031239 | Ga0265328_10089298 | Ga0265328_100892981 | 172 |
| 14 | 3300031240 | Ga0265320_10045309 | Ga0265320_100453092 | 172 |
| 15 | 3300031241 | Ga0265325_10025233 | Ga0265325_100252334 | 172 |
| 16 | 3300031247 | Ga0265340_10141993 | Ga0265340_101419932 | 172 |
| 17 | 3300031249 | Ga0265339_10191995 | Ga0265339_101919952 | 172 |
| 18 | 3300031250 | Ga0265331_10101947 | Ga0265331_101019471 | 172 |
| 19 | 3300031344 | Ga0265316_10122335 | Ga0265316_101223353 | 172 |
| 20 | 3300031595 | Ga0265313_10005141 | Ga0265313_100051415 | 172 |
| 21 | 3300031712 | Ga0265342_10036530 | Ga0265342_100365303 | 172 |
| 22 | iso_pu_bacteria | 2808606384 | 2808971418 | 172 |
| 23 | iso_pu_bacteria | 2808606390 | 2809006198 | 172 |
| 24 | iso_pu_bacteria | 2808606391 | 2809013385 | 172 |
| 25 | 3300002705 | JGI25156J39149_1025751 | JGI25156J39149_10257512 | 176 |
| 26 | 3300003758 | Ga0055532_1000246 | Ga0055532_100024623 | 176 |
| 27 | 3300003760 | Ga0055527_1000184 | Ga0055527_100018424 | 176 |
| 28 | 3300003761 | Ga0055535_1000385 | Ga0055535_100038524 | 176 |
| 29 | 3300003762 | Ga0055542_1001723 | Ga0055542_10017234 | 176 |
| 30 | 3300003763 | Ga0055529_1001537 | Ga0055529_10015375 | 176 |
| 31 | 3300005563 | Ga0068855_100363793 | Ga0068855_1003637932 | 176 |
| 32 | 3300006051 | Ga0075364_10002521 | Ga0075364_100025218 | 176 |
| 33 | 3300006186 | Ga0075369_10001409 | Ga0075369_100014096 | 176 |
| 34 | 3300006353 | Ga0075370_10017950 | Ga0075370_100179505 | 176 |
| 35 | 3300009093 | Ga0105240_10105887 | Ga0105240_101058875 | 176 |
| 36 | 3300009147 | Ga0114129_10449466 | Ga0114129_104494662 | 176 |
| 37 | 3300013104 | Ga0157370_10194813 | Ga0157370_101948132 | 176 |
| 38 | 3300013105 | Ga0157369_10031528 | Ga0157369_100315287 | 176 |
| 39 | 3300045976 | Ga0466967_0158092 | Ga0466967_0158092_1500_2033 | 176 |
| 40 | 3300046474 | Ga0495605_0003508 | Ga0495605_0003508_2220_2777 | 176 |
| 41 | 3300046506 | Ga0495583_0012351 | Ga0495583_0012351_2168_2725 | 176 |
| 42 | 3300046518 | Ga0495631_0002810 | Ga0495631_0002810_2400_2957 | 176 |
| 43 | 3300046519 | Ga0495632_0031510 | Ga0495632_0031510_1032_1589 | 176 |
| 44 | 3300046616 | Ga0495668_0002555 | Ga0495668_0002555_7891_8448 | 176 |
| 45 | 3300046660 | Ga0495625_0010556 | Ga0495625_0010556_6670_7227 | 176 |
| 46 | 3300048918 | Ga0496115_0014374 | Ga0496115_0014374_1523_2062 | 176 |
| 47 | 3300049459 | Ga0495678_063215 | Ga0495678_063215_256_813 | 176 |
| 48 | 3300049571 | Ga0501034_0803571 | Ga0501034_0803571_176_793 | 176 |
| 49 | 3300049580 | Ga0501046_0243905 | Ga0501046_0243905_281_898 | 176 |
| 50 | 3300049586 | Ga0501070_0000417 | Ga0501070_0000417_5639_6256 | 176 |
| 51 | 3300049744 | Ga0501083_0606813 | Ga0501083_0606813_30_647 | 176 |
| 52 | 3300050490 | nmdc:mga03n38_2544_c1 | nmdc:mga03n38_2544_c1_454_987 | 176 |
| 53 | 3300050491 | nmdc:mga00v17_3616_c1 | nmdc:mga00v17_3616_c1_3799_4332 | 176 |
| 54 | 3300050494 | nmdc:mga06z11_82063_c1 | nmdc:mga06z11_82063_c1_1160_1693 | 176 |
| 55 | 3300050516 | nmdc:mga0sz30_3826_c1 | nmdc:mga0sz30_3826_c1_2383_2916 | 176 |
| 56 | 3300053086 | Ga0500578_0212436 | Ga0500578_0212436_306_863 | 176 |
| 57 | 3300053118 | Ga0500594_0000512 | Ga0500594_0000512_5153_5710 | 176 |
| 58 | 3300053130 | Ga0500642_0051142 | Ga0500642_0051142_1138_1695 | 176 |
| 59 | 3300053139 | Ga0500568_0002460 | Ga0500568_0002460_9005_9556 | 176 |
| 60 | 3300053160 | Ga0500633_0000341 | Ga0500633_0000341_3969_4520 | 176 |
| 61 | 3300053177 | Ga0500636_0087686 | Ga0500636_0087686_1064_1609 | 176 |
| 62 | 3300025302 | Ga0207426_1016986 | Ga0207426_10169863 | 177 |
| 63 | 3300048927 | Ga0496124_0006141 | Ga0496124_0006141_1378_1920 | 177 |
| 64 | 3300048928 | Ga0496125_0044429 | Ga0496125_0044429_1486_2028 | 177 |
| 65 | 3300048929 | Ga0496126_0002241 | Ga0496126_0002241_8196_8735 | 177 |
| 66 | iso_pu_bacteria | 2900634093 | 2900634719 | 177 |
| 67 | iso_pu_bacteria | 2921643360 | 2921643384 | 177 |
| 68 | 3300005353 | Ga0070669_100219049 | Ga0070669_1002190492 | 178 |
| 69 | 3300005355 | Ga0070671_100290904 | Ga0070671_1002909041 | 178 |
| 70 | 3300005367 | Ga0070667_100056264 | Ga0070667_1000562642 | 178 |
| 71 | 3300009011 | Ga0105251_10064128 | Ga0105251_100641282 | 178 |
| 72 | 3300009092 | Ga0105250_10079590 | Ga0105250_100795902 | 178 |
| 73 | 3300009148 | Ga0105243_11977258 | Ga0105243_119772581 | 178 |
| 74 | 3300009174 | Ga0105241_10369413 | Ga0105241_103694131 | 178 |
| 75 | 3300009177 | Ga0105248_10081735 | Ga0105248_100817352 | 178 |
| 76 | 3300009553 | Ga0105249_10523192 | Ga0105249_105231921 | 178 |
| 77 | 3300013306 | Ga0163162_10001454 | Ga0163162_1000145410 | 178 |
| 78 | 3300013308 | Ga0157375_10012849 | Ga0157375_100128495 | 178 |
| 79 | 3300025903 | Ga0207680_10072613 | Ga0207680_100726132 | 178 |
| 80 | 3300025941 | Ga0207711_10048083 | Ga0207711_100480833 | 178 |
| 81 | 3300025986 | Ga0207658_10119370 | Ga0207658_101193702 | 178 |
| 82 | 3300046457 | Ga0495590_0010359 | Ga0495590_0010359_705_1241 | 178 |
| 83 | 3300046459 | Ga0495629_0000097 | Ga0495629_0000097_66371_66907 | 178 |
| 84 | 3300046460 | Ga0495638_0004004 | Ga0495638_0004004_10300_10836 | 178 |
| 85 | 3300046463 | Ga0495653_0000802 | Ga0495653_0000802_8898_9434 | 178 |
| 86 | 3300046471 | Ga0495650_0010978 | Ga0495650_0010978_1424_1960 | 178 |
| 87 | 3300046471 | Ga0495650_0016512 | Ga0495650_0016512_2504_3043 | 178 |
| 88 | 3300046471 | Ga0495650_0037470 | Ga0495650_0037470_447_983 | 178 |
| 89 | 3300046472 | Ga0495580_0003314 | Ga0495580_0003314_9445_9981 | 178 |
| 90 | 3300046472 | Ga0495580_0008051 | Ga0495580_0008051_5435_5971 | 178 |
| 91 | 3300046473 | Ga0495582_0194525 | Ga0495582_0194525_142_678 | 178 |
| 92 | 3300046474 | Ga0495605_0002610 | Ga0495605_0002610_6734_7270 | 178 |
| 93 | 3300046474 | Ga0495605_0002937 | Ga0495605_0002937_7350_7886 | 178 |
| 94 | 3300046491 | Ga0495584_0175464 | Ga0495584_0175464_18_554 | 178 |
| 95 | 3300046492 | Ga0495585_0055107 | Ga0495585_0055107_1408_1944 | 178 |
| 96 | 3300046500 | Ga0495596_0156661 | Ga0495596_0156661_307_843 | 178 |
| 97 | 3300046501 | Ga0495607_0018265 | Ga0495607_0018265_308_844 | 178 |
| 98 | 3300046506 | Ga0495583_0093683 | Ga0495583_0093683_405_941 | 178 |
| 99 | 3300046516 | Ga0495628_0005176 | Ga0495628_0005176_5651_6187 | 178 |
| 100 | 3300046517 | Ga0495630_0130003 | Ga0495630_0130003_1277_1813 | 178 |
| 101 | 3300046524 | Ga0495648_0031659 | Ga0495648_0031659_2225_2761 | 178 |
| 102 | 3300046526 | Ga0495666_0054030 | Ga0495666_0054030_531_1067 | 178 |
| 103 | 3300046530 | Ga0495654_0098512 | Ga0495654_0098512_647_1183 | 178 |
| 104 | 3300046531 | Ga0495665_0037949 | Ga0495665_0037949_1425_1961 | 178 |
| 105 | 3300046531 | Ga0495665_0038243 | Ga0495665_0038243_1992_2528 | 178 |
| 106 | 3300046536 | Ga0495587_0446372 | Ga0495587_0446372_106_642 | 178 |
| 107 | 3300046538 | Ga0495609_0065534 | Ga0495609_0065534_747_1283 | 178 |
| 108 | 3300046542 | Ga0495597_0065023 | Ga0495597_0065023_673_1209 | 178 |
| 109 | 3300046648 | Ga0495611_0007032 | Ga0495611_0007032_3649_4185 | 178 |
| 110 | 3300046674 | Ga0495588_0397193 | Ga0495588_0397193_135_671 | 178 |
| 111 | 3300046679 | Ga0495623_0002409 | Ga0495623_0002409_6677_7213 | 178 |
| 112 | 3300046680 | Ga0495646_0001583 | Ga0495646_0001583_3734_4270 | 178 |
| 113 | 3300046684 | Ga0495669_0008904 | Ga0495669_0008904_2730_3266 | 178 |
| 114 | 3300046689 | Ga0495613_0136312 | Ga0495613_0136312_1175_1711 | 178 |
| 115 | 3300046690 | Ga0495624_0007637 | Ga0495624_0007637_5275_5811 | 178 |
| 116 | 3300046690 | Ga0495624_0095201 | Ga0495624_0095201_1170_1706 | 178 |
| 117 | 3300046692 | Ga0495671_0146198 | Ga0495671_0146198_442_978 | 178 |
| 118 | 3300046694 | Ga0495649_0062303 | Ga0495649_0062303_165_701 | 178 |
| 119 | 3300046794 | Ga0495589_0001517 | Ga0495589_0001517_11132_11668 | 178 |
| 120 | 3300046794 | Ga0495589_0037192 | Ga0495589_0037192_1396_1932 | 178 |
| 121 | 3300046810 | Ga0495660_0152205 | Ga0495660_0152205_154_690 | 178 |
| 122 | 3300047317 | Ga0495604_0000652 | Ga0495604_0000652_27248_27784 | 178 |
| 123 | 3300047319 | Ga0495674_0039055 | Ga0495674_0039055_2117_2653 | 178 |
| 124 | 3300047319 | Ga0495674_0070813 | Ga0495674_0070813_874_1410 | 178 |
| 125 | 3300047320 | Ga0495672_0108177 | Ga0495672_0108177_214_750 | 178 |
| 126 | 3300047321 | Ga0495676_0513723 | Ga0495676_0513723_168_704 | 178 |
| 127 | 3300047444 | Ga0495675_0004752 | Ga0495675_0004752_1539_2075 | 178 |
| 128 | 3300047446 | Ga0495679_000008 | Ga0495679_000008_224561_225097 | 178 |
| 129 | 3300047446 | Ga0495679_023811 | Ga0495679_023811_458_994 | 178 |
| 130 | 3300047673 | Ga0495593_0022097 | Ga0495593_0022097_1235_1771 | 178 |
| 131 | 3300047673 | Ga0495593_0075200 | Ga0495593_0075200_635_1171 | 178 |
| 132 | 3300048088 | Ga0495602_0036909 | Ga0495602_0036909_1840_2376 | 178 |
| 133 | 3300048091 | Ga0495626_0095469 | Ga0495626_0095469_290_826 | 178 |
| 134 | 3300048903 | Ga0496100_0709126 | Ga0496100_0709126_218_754 | 178 |
| 135 | 3300048904 | Ga0496101_0304265 | Ga0496101_0304265_665_1201 | 178 |
| 136 | 3300048905 | Ga0496102_0003844 | Ga0496102_0003844_1686_2222 | 178 |
| 137 | 3300048906 | Ga0496103_0074945 | Ga0496103_0074945_187_723 | 178 |
| 138 | 3300048908 | Ga0496105_0039516 | Ga0496105_0039516_2115_2651 | 178 |
| 139 | 3300048909 | Ga0496106_0045545 | Ga0496106_0045545_1111_1647 | 178 |
| 140 | 3300048910 | Ga0496107_0023334 | Ga0496107_0023334_3707_4243 | 178 |
| 141 | 3300048917 | Ga0496114_0095880 | Ga0496114_0095880_808_1344 | 178 |
| 142 | 3300048918 | Ga0496115_0288298 | Ga0496115_0288298_79_615 | 178 |
| 143 | 3300048920 | Ga0496117_0040949 | Ga0496117_0040949_1349_1885 | 178 |
| 144 | 3300048924 | Ga0496121_0039432 | Ga0496121_0039432_996_1532 | 178 |
| 145 | 3300049459 | Ga0495678_014003 | Ga0495678_014003_2714_3250 | 178 |
| 146 | iso_pu_bacteria | 2515154123 | 2515692151 | 178 |
| 147 | 3300003316 | rootH1_10065477 | rootH1_100654774 | 179 |
| 148 | 3300003354 | JGI25160J50197_1000164 | JGI25160J50197_100016431 | 179 |
| 149 | 3300005262 | Ga0065165_1000713 | Ga0065165_100071333 | 179 |
| 150 | 3300005455 | Ga0070663_100301164 | Ga0070663_1003011642 | 179 |
| 151 | 3300009093 | Ga0105240_10124481 | Ga0105240_101244811 | 179 |
| 152 | 3300009551 | Ga0105238_10413691 | Ga0105238_104136912 | 179 |
| 153 | 3300010375 | Ga0105239_10874950 | Ga0105239_108749501 | 179 |
| 154 | 3300010375 | Ga0105239_11932678 | Ga0105239_119326781 | 179 |
| 155 | 3300025284 | Ga0209130_1002845 | Ga0209130_10028457 | 179 |
| 156 | 3300025302 | Ga0207426_1000353 | Ga0207426_100035332 | 179 |
| 157 | 3300025303 | Ga0209051_1002351 | Ga0209051_10023515 | 179 |
| 158 | 3300025904 | Ga0207647_10010851 | Ga0207647_100108512 | 179 |
| 159 | 3300026067 | Ga0207678_10271559 | Ga0207678_102715592 | 179 |
| 160 | 3300026078 | Ga0207702_10318920 | Ga0207702_103189202 | 179 |
| 161 | 3300046472 | Ga0495580_0015580 | Ga0495580_0015580_3191_3730 | 179 |
| 162 | 3300046474 | Ga0495605_0003757 | Ga0495605_0003757_7048_7587 | 179 |
| 163 | 3300046506 | Ga0495583_0014934 | Ga0495583_0014934_620_1159 | 179 |
| 164 | 3300046513 | Ga0495616_0014703 | Ga0495616_0014703_804_1343 | 179 |
| 165 | 3300046524 | Ga0495648_0065410 | Ga0495648_0065410_546_1085 | 179 |
| 166 | 3300046528 | Ga0495642_0093280 | Ga0495642_0093280_18_557 | 179 |
| 167 | 3300046557 | Ga0495622_0048290 | Ga0495622_0048290_1229_1768 | 179 |
| 168 | 3300046648 | Ga0495611_0085846 | Ga0495611_0085846_371_910 | 179 |
| 169 | 3300046660 | Ga0495625_0661263 | Ga0495625_0661263_67_606 | 179 |
| 170 | 3300046794 | Ga0495589_0037626 | Ga0495589_0037626_443_982 | 179 |
| 171 | 3300047319 | Ga0495674_0084696 | Ga0495674_0084696_455_994 | 179 |
| 172 | 3300048091 | Ga0495626_0111117 | Ga0495626_0111117_400_939 | 179 |
| 173 | 3300048903 | Ga0496100_0000135 | Ga0496100_0000135_18141_18680 | 179 |
| 174 | 3300048903 | Ga0496100_0763775 | Ga0496100_0763775_91_630 | 179 |
| 175 | 3300048904 | Ga0496101_0000212 | Ga0496101_0000212_22318_22857 | 179 |
| 176 | 3300048905 | Ga0496102_0000541 | Ga0496102_0000541_22329_22868 | 179 |
| 177 | 3300048906 | Ga0496103_0001322 | Ga0496103_0001322_1623_2162 | 179 |
| 178 | 3300048907 | Ga0496104_0103755 | Ga0496104_0103755_855_1394 | 179 |
| 179 | 3300048908 | Ga0496105_0138882 | Ga0496105_0138882_1113_1652 | 179 |
| 180 | 3300048909 | Ga0496106_0039051 | Ga0496106_0039051_827_1366 | 179 |
| 181 | 3300048915 | Ga0496112_0054792 | Ga0496112_0054792_984_1523 | 179 |
| 182 | 3300048916 | Ga0496113_0031770 | Ga0496113_0031770_1327_1866 | 179 |
| 183 | 3300048918 | Ga0496115_0322936 | Ga0496115_0322936_228_767 | 179 |
| 184 | 3300048919 | Ga0496116_0141474 | Ga0496116_0141474_352_891 | 179 |
| 185 | 3300048920 | Ga0496117_0001089 | Ga0496117_0001089_18141_18680 | 179 |
| 186 | 3300048921 | Ga0496118_0000827 | Ga0496118_0000827_26335_26874 | 179 |
| 187 | 3300048924 | Ga0496121_0001393 | Ga0496121_0001393_22345_22884 | 179 |
| 188 | 3300048924 | Ga0496121_0012132 | Ga0496121_0012132_1405_1944 | 179 |
| 189 | 3300048927 | Ga0496124_0433259 | Ga0496124_0433259_55_594 | 179 |
| 190 | 3300048929 | Ga0496126_0095157 | Ga0496126_0095157_1756_2295 | 179 |
| 191 | 3300049460 | Ga0495682_0204755 | Ga0495682_0204755_92_631 | 179 |
| 192 | 3300003320 | rootH2_10087452 | rootH2_100874526 | 180 |
| 193 | 3300003322 | rootL2_10016645 | rootL2_100166453 | 180 |
| 194 | 3300003323 | rootH1_10146592 | rootH1_101465921 | 180 |
| 195 | 3300005439 | Ga0070711_100042319 | Ga0070711_1000423193 | 180 |
| 196 | 3300013296 | Ga0157374_10027736 | Ga0157374_100277365 | 180 |
| 197 | 3300013297 | Ga0157378_10025076 | Ga0157378_100250763 | 180 |
| 198 | 3300013307 | Ga0157372_11442477 | Ga0157372_114424771 | 180 |
| 199 | 3300014969 | Ga0157376_10256878 | Ga0157376_102568782 | 180 |
| 200 | 3300025916 | Ga0207663_10018203 | Ga0207663_100182032 | 180 |
| 201 | 3300025928 | Ga0207700_10028687 | Ga0207700_100286873 | 180 |
| 202 | 3300026041 | Ga0207639_10025797 | Ga0207639_100257973 | 180 |
| 203 | 3300046460 | Ga0495638_0016905 | Ga0495638_0016905_2938_3480 | 180 |
| 204 | 3300046471 | Ga0495650_0001626 | Ga0495650_0001626_11007_11555 | 180 |
| 205 | 3300046475 | Ga0495639_0011794 | Ga0495639_0011794_1511_2059 | 180 |
| 206 | 3300046506 | Ga0495583_0000148 | Ga0495583_0000148_9678_10226 | 180 |
| 207 | 3300046506 | Ga0495583_0001784 | Ga0495583_0001784_11750_12292 | 180 |
| 208 | 3300046524 | Ga0495648_0000037 | Ga0495648_0000037_185174_185722 | 180 |
| 209 | 3300046528 | Ga0495642_0001252 | Ga0495642_0001252_3019_3567 | 180 |
| 210 | 3300046557 | Ga0495622_0000040 | Ga0495622_0000040_108319_108867 | 180 |
| 211 | 3300046558 | Ga0495633_0000653 | Ga0495633_0000653_5891_6439 | 180 |
| 212 | 3300046615 | Ga0495656_0161214 | Ga0495656_0161214_65_610 | 180 |
| 213 | 3300046660 | Ga0495625_0000023 | Ga0495625_0000023_194254_194802 | 180 |
| 214 | 3300046660 | Ga0495625_0059929 | Ga0495625_0059929_822_1364 | 180 |
| 215 | 3300046694 | Ga0495649_0096769 | Ga0495649_0096769_699_1241 | 180 |
| 216 | 3300047323 | Ga0495683_0010183 | Ga0495683_0010183_1011_1553 | 180 |
| 217 | 3300047443 | Ga0495687_030114 | Ga0495687_030114_572_1114 | 180 |
| 218 | 3300048091 | Ga0495626_0079139 | Ga0495626_0079139_49_591 | 180 |
| 219 | 3300048907 | Ga0496104_0475510 | Ga0496104_0475510_256_798 | 180 |
| 220 | 3300048909 | Ga0496106_0000009 | Ga0496106_0000009_165470_166015 | 180 |
| 221 | 3300048920 | Ga0496117_0228553 | Ga0496117_0228553_461_1003 | 180 |
| 222 | 3300048924 | Ga0496121_0011704 | Ga0496121_0011704_5462_6007 | 180 |
| 223 | 3300048929 | Ga0496126_0000099 | Ga0496126_0000099_65087_65629 | 180 |
| 224 | 3300049459 | Ga0495678_002627 | Ga0495678_002627_6684_7232 | 180 |
| 225 | 3300003322 | rootL2_10027749 | rootL2_1002774913 | 181 |
| 226 | 3300009011 | Ga0105251_10079006 | Ga0105251_100790062 | 181 |
| 227 | 3300010375 | Ga0105239_12047438 | Ga0105239_120474381 | 181 |
| 228 | 3300031249 | Ga0265339_10029158 | Ga0265339_100291583 | 181 |
| 229 | 3300031712 | Ga0265342_10245805 | Ga0265342_102458052 | 181 |
| 230 | 3300031911 | Ga0307412_10004220 | Ga0307412_100042206 | 181 |
| 231 | 3300032002 | Ga0307416_100060503 | Ga0307416_1000605032 | 181 |
| 232 | 3300049571 | Ga0501034_0064919 | Ga0501034_0064919_1784_2329 | 181 |
| 233 | 3300049571 | Ga0501034_0767480 | Ga0501034_0767480_174_719 | 181 |
| 234 | 3300013102 | Ga0157371_10008384 | Ga0157371_100083842 | 182 |
| 235 | 3300013105 | Ga0157369_10000113 | Ga0157369_1000011366 | 182 |
| 236 | 3300025261 | Ga0209233_1003334 | Ga0209233_10033343 | 182 |
| 237 | 3300025924 | Ga0207694_10745159 | Ga0207694_107451592 | 182 |
| 238 | iso_pu_bacteria | 2721755763 | 2723878011 | 182 |
| 239 | 3300003323 | rootH1_10203024 | rootH1_102030243 | 183 |
| 240 | 3300009177 | Ga0105248_10009372 | Ga0105248_100093725 | 183 |
| 241 | 3300009177 | Ga0105248_10052348 | Ga0105248_100523482 | 183 |
| 242 | 3300025941 | Ga0207711_10005463 | Ga0207711_100054637 | 183 |
| 243 | 3300025941 | Ga0207711_10042505 | Ga0207711_100425052 | 183 |
| 244 | 3300047472 | Ga0495686_0122520 | Ga0495686_0122520_956_1510 | 183 |
| 245 | 3300048919 | Ga0496116_0046225 | Ga0496116_0046225_1723_2277 | 183 |
| 246 | iso_pu_bacteria | 2838029111 | 2838029651 | 183 |
| 247 | iso_pu_bacteria | 2842475841 | 2842475919 | 183 |
| 248 | iso_pu_bacteria | 2842502639 | 2842503179 | 183 |
| 249 | iso_pu_bacteria | 2919408235 | 2919408441 | 183 |
| 250 | 3300037471 | Ga0395905_0000020 | Ga0395905_0000020_230955_231509 | 184 |
| 251 | 3300037471 | Ga0395905_1224523 | Ga0395905_1224523_57_611 | 184 |
| 252 | iso_pu_bacteria | 2513237082 | 2513553219 | 184 |
| 253 | iso_pu_bacteria | 2515154189 | 2516017281 | 184 |
| 254 | iso_pu_bacteria | 642555113 | 642621681 | 184 |
| 255 | 3300003756 | Ga0055533_1000493 | Ga0055533_10004934 | 185 |
| 256 | 3300025206 | Ga0209435_104661 | Ga0209435_1046611 | 185 |
| 257 | 3300025226 | Ga0209674_100048 | Ga0209674_100048206 | 185 |
| 258 | 3300025256 | Ga0209759_1000032 | Ga0209759_1000032135 | 185 |
| 259 | 3300047319 | Ga0495674_0009471 | Ga0495674_0009471_5830_6387 | 185 |
| 260 | 3300048929 | Ga0496126_0030740 | Ga0496126_0030740_1278_1844 | 185 |
| 261 | iso_pu_bacteria | 2526164713 | 2527076349 | 185 |
| 262 | 3300005339 | Ga0070660_100100558 | Ga0070660_1001005582 | 186 |
| 263 | 3300005455 | Ga0070663_100066214 | Ga0070663_1000662143 | 186 |
| 264 | 3300005578 | Ga0068854_100081412 | Ga0068854_1000814122 | 186 |
| 265 | 3300009093 | Ga0105240_10295463 | Ga0105240_102954633 | 186 |
| 266 | 3300009551 | Ga0105238_10190870 | Ga0105238_101908702 | 186 |
| 267 | 3300013105 | Ga0157369_10098704 | Ga0157369_100987043 | 186 |
| 268 | 3300013307 | Ga0157372_10041483 | Ga0157372_100414833 | 186 |
| 269 | 3300025909 | Ga0207705_10013692 | Ga0207705_100136923 | 186 |
| 270 | 3300025913 | Ga0207695_10030361 | Ga0207695_100303613 | 186 |
| 271 | 3300025919 | Ga0207657_10031314 | Ga0207657_100313145 | 186 |
| 272 | 3300025949 | Ga0207667_10007308 | Ga0207667_100073085 | 186 |
| 273 | 3300037466 | Ga0395898_0000437 | Ga0395898_0000437_28611_29177 | 186 |
| 274 | 3300038443 | Ga0395901_1025414 | Ga0395901_1025414_11_577 | 186 |
| 275 | 3300048929 | Ga0496126_0000082 | Ga0496126_0000082_93101_93670 | 186 |
| 276 | iso_pu_bacteria | 2513237166 | 2514049269 | 186 |
| 277 | iso_pu_bacteria | 2928108538 | 2928111887 | 187 |
| 278 | iso_pu_bacteria | 2928135762 | 2928139126 | 187 |
| 279 | iso_pu_bacteria | 2928503688 | 2928508825 | 187 |
| 280 | 3300002705 | JGI25156J39149_1003266 | JGI25156J39149_10032664 | 188 |
| 281 | 3300009011 | Ga0105251_10000457 | Ga0105251_100004576 | 188 |
| 282 | 3300015261 | Ga0182006_1045848 | Ga0182006_10458482 | 188 |
| 283 | 3300015262 | Ga0182007_10001499 | Ga0182007_100014999 | 188 |
| 284 | 3300025256 | Ga0209759_1000085 | Ga0209759_1000085147 | 188 |
| 285 | 3300025735 | Ga0207713_1000492 | Ga0207713_10004926 | 188 |
| 286 | 3300025904 | Ga0207647_10000615 | Ga0207647_100006152 | 188 |
| 287 | 3300047319 | Ga0495674_0008531 | Ga0495674_0008531_2660_3400 | 188 |
| 288 | 3300048919 | Ga0496116_0061572 | Ga0496116_0061572_885_1466 | 188 |
| 289 | 3300048920 | Ga0496117_0086284 | Ga0496117_0086284_141_770 | 188 |
| 290 | 3300048921 | Ga0496118_0000897 | Ga0496118_0000897_27148_27777 | 188 |
| 291 | iso_pu_bacteria | 2818991450 | 2819622473 | 188 |
| 292 | iso_pu_bacteria | 2842324504 | 2842325517 | 188 |
| 293 | iso_pu_bacteria | 2842348783 | 2842349796 | 188 |
| 294 | iso_pu_bacteria | 2842454564 | 2842454966 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mwj-assembly1.cif.gz_A | crystal structure of a mug-dna pseudo substrate complex | 0.9739 | 17 | 181 |
| 1mtl-assembly1.cif.gz_B | non-productive mug-dna complex | 0.9624 | 17 | 180 |
| 1mwj-assembly1.cif.gz_A | crystal structure of a mug-dna pseudo substrate complex | 0.9624 | 17 | 181 |
| 3uo7-assembly1.cif.gz_A | crystal structure of human thymine dna glycosylase bound to substrate 5-carboxylcytosine | 0.9583 | 17 | 179 |
| 1mtl-assembly1.cif.gz_A | non-productive mug-dna complex | 0.9569 | 18 | 180 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1mtlA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9569 | 18 | 180 | 3.40.470.10 |
| 3uobA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9565 | 17 | 179 | 3.40.470.10 |
| af_Q9V4D8_761_956_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.954 | 16 | 179 | 3.40.470.10 |
| 1mtlA00 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.9451 | 18 | 180 | 3.40.470.10 |
| af_O59825_127_324_3.40.470.10 | Alpha Beta;3-Layer(aba) Sandwich;Uracil-DNA Glycosylase, subunit E;Uracil-DNA glycosylase-like domain | 0.8935 | 2 | 179 | 3.40.470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6J5G1L6-F1-model_v4 | deleted | 0.9991 | 28 | 178 |
|
| AF-A0A7U6GSL7-F1-model_v4 | deleted | 0.9983 | 13 | 179 |
|
| AF-J3GFQ2-F1-model_v4 | G:T/U mismatch-specific DNA glycosylase | 0.9976 | 16 | 179 |
GO:0004844
GO:0006285 GO:0008263 |
| AF-A0A372KC49-F1-model_v4 | G/U mismatch-specific DNA glycosylase | 0.9968 | 28 | 179 |
GO:0004844
GO:0006285 GO:0008263 |
| AF-Q46SQ2-F1-model_v4 | G/U mismatch-specific uracil-DNA glycosylase (EC 3.2.2.-) | 0.9957 | 16 | 179 |
GO:0004844
GO:0006285 GO:0008263 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar