F392073
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 294 | 154 | 283 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300013105|Ga0157369_10000772|Ga0157369_1000077223 |
| Length | 284 |
| Sequence | MHLYIFQLLINNFAKKINYLIMSEFKQTFNSSLGKKLIMALTGLFLCTFLIVHVAGNLQLFKNDNGYGFNVYANFLAHFPPIEVVAYILYICIIVHTIYAIIVTTNNRKARPIGYAVSPKSPTSWSSQNMGLLGSILFLFIVIHMGDFWFTYKFNHALAFKEYRTNLLTGEQTVSAFTPPNADFDRSLSYDGNTEVMRVKDLHARVAESFSHLWYVVLYVIAMVALAYHLVHGFQSAFRSLGWVHRKWTPIVEFIGTWFFAVIIPLLFAAMPIAYYIMSSNKQL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 2 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 3 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 4 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 5 | 2896317667 | Sphingobacterium sp. SGR-19 | Isolate | Rhizosphere |
| 6 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 7 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 8 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 9 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 10 | 2977232053 | Mucilaginibacter terrae SORGH_AS 422 | Isolate | Unclassified |
| 11 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 12 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 13 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 17 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 25 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 42 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 43 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 44 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 69 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 99 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 102 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 103 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 104 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 105 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 106 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 107 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 108 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 115 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 116 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 117 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 118 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 119 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 120 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 147 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 148 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 149 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 150 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 151 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 152 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 153 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 154 | 8055588893 | Parapedobacter lycopersici KACC 18788 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.26 |
| Metatranscriptomes | 0 |
| Isolates | 3.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.2 |
| Nodule | 0 |
| Rhizoplane | 0.68 |
| Rhizosphere | 81.97 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.14 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1010957 | 3300001915 | Bacteria | 1601 |
| 2 | JGI24740J21852_10028752 | 3300001979 | Bacteria | 1833 |
| 3 | JGI24739J22299_10014096 | 3300001989 | Bacteria | 2911 |
| 4 | JGI24737J22298_10000677 | 3300001990 | Bacteria | 12067 |
| 5 | JGI24737J22298_10001647 | 3300001990 | Bacteria | 7970 |
| 6 | JGI24737J22298_10027593 | 3300001990 | Bacteria | 1789 |
| 7 | JGI24735J21928_10000007 | 3300002067 | Bacteria | 333510 |
| 8 | JGI24735J21928_10003440 | 3300002067 | Bacteria | 5389 |
| 9 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 10 | JGI25162J39368_1000097 | 3300002737 | Bacteria | 96520 |
| 11 | JGI25162J39368_1000793 | 3300002737 | Bacteria | 21112 |
| 12 | JGI25157J39369_1007634 | 3300002741 | Bacteria | 1551 |
| 13 | JGI25164J39214_1002837 | 3300002772 | Bacteria | 2428 |
| 14 | JGI25165J46597_1000990 | 3300003214 | Bacteria | 18944 |
| 15 | rootH1_10042091 | 3300003316 | Bacteria | 7507 |
| 16 | rootH1_10116130 | 3300003316 | Bacteria | 1028 |
| 17 | rootH2_10004419 | 3300003320 | Bacteria | 46013 |
| 18 | rootH2_10027438 | 3300003320 | Bacteria | 13342 |
| 19 | rootL2_10145639 | 3300003322 | Bacteria | 1299 |
| 20 | rootH1_10017777 | 3300003323 | Bacteria | 31426 |
| 21 | rootH1_10065749 | 3300003323 | Bacteria | 3264 |
| 22 | Ga0065714_10007943 | 3300005288 | Bacteria | 4768 |
| 23 | Ga0065714_10018417 | 3300005288 | Bacteria | 1465 |
| 24 | Ga0070658_10000113 | 3300005327 | Bacteria | 72221 |
| 25 | Ga0070658_10155213 | 3300005327 | Bacteria | 1918 |
| 26 | Ga0070658_10208575 | 3300005327 | Bacteria | 1650 |
| 27 | Ga0070658_10468962 | 3300005327 | Bacteria | 1086 |
| 28 | Ga0070676_10006402 | 3300005328 | Bacteria | 6290 |
| 29 | Ga0070680_100047212 | 3300005336 | Bacteria | 3505 |
| 30 | Ga0070660_100012437 | 3300005339 | Bacteria | 6077 |
| 31 | Ga0070660_100090733 | 3300005339 | Bacteria | 2409 |
| 32 | Ga0070660_100142187 | 3300005339 | Bacteria | 1926 |
| 33 | Ga0070671_100076051 | 3300005355 | Bacteria | 2805 |
| 34 | Ga0070673_100024422 | 3300005364 | Bacteria | 4432 |
| 35 | Ga0070659_100000076 | 3300005366 | Bacteria | 77320 |
| 36 | Ga0070659_100029764 | 3300005366 | Bacteria | 4221 |
| 37 | Ga0070662_100000186 | 3300005457 | Bacteria | 36051 |
| 38 | Ga0068867_100002700 | 3300005459 | Bacteria | 12519 |
| 39 | Ga0068853_100066440 | 3300005539 | Bacteria | 3132 |
| 40 | Ga0068853_100128346 | 3300005539 | Bacteria | 2267 |
| 41 | Ga0068853_100140811 | 3300005539 | Bacteria | 2165 |
| 42 | Ga0070672_100407395 | 3300005543 | Bacteria | 1166 |
| 43 | Ga0070665_100000017 | 3300005548 | Bacteria | 448013 |
| 44 | Ga0068855_100000033 | 3300005563 | Bacteria | 167299 |
| 45 | Ga0068855_100031030 | 3300005563 | Bacteria | 6387 |
| 46 | Ga0068855_100082425 | 3300005563 | Bacteria | 3728 |
| 47 | Ga0068855_100165701 | 3300005563 | Bacteria | 2505 |
| 48 | Ga0068857_100003153 | 3300005577 | Bacteria | 13663 |
| 49 | Ga0068856_100001331 | 3300005614 | Bacteria | 26020 |
| 50 | Ga0068856_100003123 | 3300005614 | Bacteria | 16901 |
| 51 | Ga0068856_100195293 | 3300005614 | Bacteria | 2038 |
| 52 | Ga0068856_100544993 | 3300005614 | Bacteria | 1181 |
| 53 | Ga0068852_100000477 | 3300005616 | Bacteria | 26260 |
| 54 | Ga0068852_100088612 | 3300005616 | Bacteria | 2764 |
| 55 | Ga0068858_100194800 | 3300005842 | Bacteria | 1915 |
| 56 | Ga0075369_10173081 | 3300006186 | Bacteria | 992 |
| 57 | Ga0075366_10000325 | 3300006195 | Bacteria | 21814 |
| 58 | Ga0075366_10001994 | 3300006195 | Bacteria | 10347 |
| 59 | Ga0075366_10006432 | 3300006195 | Bacteria | 6437 |
| 60 | Ga0097621_100079841 | 3300006237 | Bacteria | 2720 |
| 61 | Ga0075370_10061620 | 3300006353 | Bacteria | 2137 |
| 62 | Ga0075370_10148805 | 3300006353 | Bacteria | 1372 |
| 63 | Ga0068871_100000286 | 3300006358 | Bacteria | 35207 |
| 64 | Ga0068865_100261820 | 3300006881 | Bacteria | 1369 |
| 65 | Ga0105240_10000277 | 3300009093 | Bacteria | 101646 |
| 66 | Ga0105240_10042543 | 3300009093 | Bacteria | 5788 |
| 67 | Ga0105240_10083896 | 3300009093 | Bacteria | 3908 |
| 68 | Ga0105240_10272498 | 3300009093 | Bacteria | 1948 |
| 69 | Ga0105240_10308042 | 3300009093 | Bacteria | 1809 |
| 70 | Ga0105240_10444983 | 3300009093 | Bacteria | 1451 |
| 71 | Ga0105240_10521190 | 3300009093 | Bacteria | 1319 |
| 72 | Ga0105240_10701359 | 3300009093 | Bacteria | 1105 |
| 73 | Ga0105240_10747570 | 3300009093 | Bacteria | 1063 |
| 74 | Ga0105240_10930389 | 3300009093 | Bacteria | 933 |
| 75 | Ga0105245_10181456 | 3300009098 | Bacteria | 2011 |
| 76 | Ga0105241_10003969 | 3300009174 | Bacteria | 10940 |
| 77 | Ga0105241_10007967 | 3300009174 | Bacteria | 7793 |
| 78 | Ga0105241_10038428 | 3300009174 | Bacteria | 3608 |
| 79 | Ga0105241_10598241 | 3300009174 | Bacteria | 996 |
| 80 | Ga0105242_10123536 | 3300009176 | Bacteria | 2225 |
| 81 | Ga0105242_10601443 | 3300009176 | Bacteria | 1062 |
| 82 | Ga0105237_10000671 | 3300009545 | Bacteria | 47262 |
| 83 | Ga0105237_10001295 | 3300009545 | Bacteria | 33282 |
| 84 | Ga0105237_10005528 | 3300009545 | Bacteria | 14248 |
| 85 | Ga0105237_10030627 | 3300009545 | Bacteria | 5464 |
| 86 | Ga0105237_10113238 | 3300009545 | Bacteria | 2705 |
| 87 | Ga0105237_10601179 | 3300009545 | Bacteria | 1107 |
| 88 | Ga0105237_10926963 | 3300009545 | Bacteria | 878 |
| 89 | Ga0105238_10009449 | 3300009551 | Bacteria | 9760 |
| 90 | Ga0105239_10000017 | 3300010375 | Bacteria | 290760 |
| 91 | Ga0105239_10000026 | 3300010375 | Bacteria | 248302 |
| 92 | Ga0105239_10000821 | 3300010375 | Bacteria | 44186 |
| 93 | Ga0105239_10001174 | 3300010375 | Bacteria | 35994 |
| 94 | Ga0105239_10012043 | 3300010375 | Bacteria | 9644 |
| 95 | Ga0105239_10022087 | 3300010375 | Bacteria | 7014 |
| 96 | Ga0105239_10044049 | 3300010375 | Bacteria | 4892 |
| 97 | Ga0105239_10088697 | 3300010375 | Bacteria | 3410 |
| 98 | Ga0105239_10159386 | 3300010375 | Bacteria | 2520 |
| 99 | Ga0105239_10293554 | 3300010375 | Bacteria | 1830 |
| 100 | Ga0157373_10000254 | 3300013100 | Bacteria | 43477 |
| 101 | Ga0157373_10005072 | 3300013100 | Bacteria | 9896 |
| 102 | Ga0157373_10007230 | 3300013100 | Bacteria | 8279 |
| 103 | Ga0157371_10000121 | 3300013102 | Bacteria | 118793 |
| 104 | Ga0157371_10011466 | 3300013102 | Bacteria | 6823 |
| 105 | Ga0157370_10012704 | 3300013104 | Bacteria | 8714 |
| 106 | Ga0157370_10013250 | 3300013104 | Bacteria | 8497 |
| 107 | Ga0157370_10424417 | 3300013104 | Bacteria | 1223 |
| 108 | Ga0157369_10000772 | 3300013105 | Bacteria | 41301 |
| 109 | Ga0157369_10059779 | 3300013105 | Bacteria | 4110 |
| 110 | Ga0157369_10203380 | 3300013105 | Bacteria | 2078 |
| 111 | Ga0157374_10000907 | 3300013296 | Bacteria | 25765 |
| 112 | Ga0157374_10005978 | 3300013296 | Bacteria | 10295 |
| 113 | Ga0157374_10233075 | 3300013296 | Bacteria | 1809 |
| 114 | Ga0157374_10482350 | 3300013296 | Bacteria | 1243 |
| 115 | Ga0157374_10485626 | 3300013296 | Bacteria | 1239 |
| 116 | Ga0157378_10294494 | 3300013297 | Bacteria | 1568 |
| 117 | Ga0163162_10000051 | 3300013306 | Bacteria | 117695 |
| 118 | Ga0163162_10005275 | 3300013306 | Bacteria | 12468 |
| 119 | Ga0163162_10006492 | 3300013306 | Bacteria | 11324 |
| 120 | Ga0157372_10000009 | 3300013307 | Bacteria | 302051 |
| 121 | Ga0157372_10000075 | 3300013307 | Bacteria | 105528 |
| 122 | Ga0157372_10007570 | 3300013307 | Bacteria | 11548 |
| 123 | Ga0157372_10008881 | 3300013307 | Bacteria | 10673 |
| 124 | Ga0157372_10095527 | 3300013307 | Bacteria | 3387 |
| 125 | Ga0157372_10457777 | 3300013307 | Bacteria | 1487 |
| 126 | Ga0157372_10607566 | 3300013307 | Unclassified | 1275 |
| 127 | Ga0157375_10499707 | 3300013308 | Bacteria | 1380 |
| 128 | Ga0163161_10050827 | 3300017792 | Bacteria | 3001 |
| 129 | Ga0209563_105422 | 3300025230 | Bacteria | 2316 |
| 130 | Ga0207427_100066 | 3300025231 | Bacteria | 165770 |
| 131 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 132 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 133 | Ga0209026_1000243 | 3300025250 | Bacteria | 69921 |
| 134 | Ga0209026_1001098 | 3300025250 | Bacteria | 12954 |
| 135 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 136 | Ga0209233_1001377 | 3300025261 | Bacteria | 9643 |
| 137 | Ga0209233_1019799 | 3300025261 | Bacteria | 1780 |
| 138 | Ga0209455_1005189 | 3300025272 | Bacteria | 4081 |
| 139 | Ga0207642_10052681 | 3300025899 | Bacteria | 1847 |
| 140 | Ga0207647_10000036 | 3300025904 | Bacteria | 98204 |
| 141 | Ga0207647_10001699 | 3300025904 | Bacteria | 16954 |
| 142 | Ga0207647_10014496 | 3300025904 | Bacteria | 5432 |
| 143 | Ga0207645_10077757 | 3300025907 | Bacteria | 2126 |
| 144 | Ga0207705_10000160 | 3300025909 | Bacteria | 72235 |
| 145 | Ga0207705_10099354 | 3300025909 | Bacteria | 2139 |
| 146 | Ga0207705_10131924 | 3300025909 | Bacteria | 1860 |
| 147 | Ga0207705_10603765 | 3300025909 | Bacteria | 853 |
| 148 | Ga0207654_10003367 | 3300025911 | Bacteria | 8097 |
| 149 | Ga0207654_10006638 | 3300025911 | Bacteria | 5821 |
| 150 | Ga0207654_10020216 | 3300025911 | Bacteria | 3526 |
| 151 | Ga0207707_10087926 | 3300025912 | Bacteria | 2715 |
| 152 | Ga0207695_10000375 | 3300025913 | Bacteria | 101654 |
| 153 | Ga0207695_10007163 | 3300025913 | Bacteria | 14274 |
| 154 | Ga0207695_10018287 | 3300025913 | Bacteria | 8108 |
| 155 | Ga0207695_10019425 | 3300025913 | Bacteria | 7826 |
| 156 | Ga0207695_10067960 | 3300025913 | Bacteria | 3653 |
| 157 | Ga0207695_10289691 | 3300025913 | Bacteria | 1530 |
| 158 | Ga0207695_10294962 | 3300025913 | Bacteria | 1513 |
| 159 | Ga0207695_10555815 | 3300025913 | Bacteria | 1029 |
| 160 | Ga0207671_10001112 | 3300025914 | Bacteria | 32446 |
| 161 | Ga0207671_10003264 | 3300025914 | Bacteria | 16311 |
| 162 | Ga0207671_10003856 | 3300025914 | Bacteria | 14663 |
| 163 | Ga0207671_10013362 | 3300025914 | Bacteria | 6541 |
| 164 | Ga0207671_10064377 | 3300025914 | Bacteria | 2726 |
| 165 | Ga0207671_10123786 | 3300025914 | Bacteria | 1978 |
| 166 | Ga0207657_10054143 | 3300025919 | Bacteria | 3472 |
| 167 | Ga0207657_10058920 | 3300025919 | Bacteria | 3303 |
| 168 | Ga0207657_10079358 | 3300025919 | Bacteria | 2761 |
| 169 | Ga0207652_10014722 | 3300025921 | Bacteria | 6339 |
| 170 | Ga0207694_10036225 | 3300025924 | Bacteria | 3786 |
| 171 | Ga0207687_10035120 | 3300025927 | Bacteria | 3409 |
| 172 | Ga0207644_10058278 | 3300025931 | Bacteria | 2791 |
| 173 | Ga0207690_10000049 | 3300025932 | Bacteria | 113589 |
| 174 | Ga0207706_10000125 | 3300025933 | Bacteria | 83075 |
| 175 | Ga0207704_10000043 | 3300025938 | Bacteria | 88714 |
| 176 | Ga0207667_10000046 | 3300025949 | Bacteria | 245420 |
| 177 | Ga0207667_10001087 | 3300025949 | Bacteria | 34483 |
| 178 | Ga0207667_10141869 | 3300025949 | Bacteria | 2474 |
| 179 | Ga0207667_10267190 | 3300025949 | Bacteria | 1749 |
| 180 | Ga0207667_10610435 | 3300025949 | Bacteria | 1099 |
| 181 | Ga0207667_10828716 | 3300025949 | Bacteria | 920 |
| 182 | Ga0207651_10190490 | 3300025960 | Bacteria | 1635 |
| 183 | Ga0207640_10043496 | 3300025981 | Bacteria | 2871 |
| 184 | Ga0207677_10009563 | 3300026023 | Bacteria | 5456 |
| 185 | Ga0207703_10178029 | 3300026035 | Bacteria | 1875 |
| 186 | Ga0207639_10181476 | 3300026041 | Bacteria | 1791 |
| 187 | Ga0207702_10000184 | 3300026078 | Bacteria | 74950 |
| 188 | Ga0207702_10038507 | 3300026078 | Bacteria | 4004 |
| 189 | Ga0207702_10085834 | 3300026078 | Bacteria | 2743 |
| 190 | Ga0207648_10000961 | 3300026089 | Bacteria | 32589 |
| 191 | Ga0207674_10006576 | 3300026116 | Bacteria | 13663 |
| 192 | Ga0207674_10235067 | 3300026116 | Bacteria | 1780 |
| 193 | Ga0207698_10013089 | 3300026142 | Bacteria | 5462 |
| 194 | Ga0268266_10000037 | 3300028379 | Bacteria | 342368 |
| 195 | Ga0307517_10001881 | 3300028786 | Bacteria | 34355 |
| 196 | Ga0307515_10000427 | 3300028794 | Bacteria | 101325 |
| 197 | Ga0307515_10145561 | 3300028794 | Bacteria | 2512 |
| 198 | Ga0307515_10184483 | 3300028794 | Bacteria | 2022 |
| 199 | Ga0265338_10140907 | 3300028800 | Bacteria | 1889 |
| 200 | Ga0316177_1086545 | 3300030731 | Bacteria | 2720 |
| 201 | Ga0316176_1102297 | 3300030732 | Bacteria | 14584 |
| 202 | Ga0316183_1003890 | 3300030742 | Bacteria | 25813 |
| 203 | Ga0316181_1187430 | 3300030744 | Bacteria | 4170 |
| 204 | Ga0307509_10196238 | 3300031507 | Bacteria | 1862 |
| 205 | Ga0307507_10000034 | 3300033179 | Bacteria | 188697 |
| 206 | Ga0307510_10000149 | 3300033180 | Bacteria | 58176 |
| 207 | Ga0373941_0001528 | 3300035115 | Bacteria | 4900 |
| 208 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 209 | Ga0395899_0000220 | 3300037312 | Bacteria | 78900 |
| 210 | Ga0395899_0000999 | 3300037312 | Bacteria | 25966 |
| 211 | Ga0395899_0003043 | 3300037312 | Bacteria | 13394 |
| 212 | Ga0395900_0000523 | 3300037418 | Bacteria | 54244 |
| 213 | Ga0395900_0010424 | 3300037418 | Bacteria | 9504 |
| 214 | Ga0395900_0046061 | 3300037418 | Bacteria | 4491 |
| 215 | Ga0395900_0256715 | 3300037418 | Bacteria | 1747 |
| 216 | Ga0395900_0282951 | 3300037418 | Bacteria | 1650 |
| 217 | Ga0395898_0077573 | 3300037466 | Bacteria | 3207 |
| 218 | Ga0395898_0157793 | 3300037466 | Bacteria | 2170 |
| 219 | Ga0395905_0000579 | 3300037471 | Bacteria | 49357 |
| 220 | Ga0395905_0059840 | 3300037471 | Bacteria | 3561 |
| 221 | Ga0395901_0001854 | 3300038443 | Bacteria | 21864 |
| 222 | Ga0395901_0037889 | 3300038443 | Bacteria | 4985 |
| 223 | Ga0451793_1069912 | 3300041452 | Bacteria | 1322 |
| 224 | Ga0439448_0001769 | 3300042005 | Bacteria | 5707 |
| 225 | Ga0466966_0237706 | 3300044684 | Bacteria | 1098 |
| 226 | Ga0466961_0004455 | 3300044693 | Bacteria | 8773 |
| 227 | Ga0466959_0058351 | 3300045049 | Bacteria | 2811 |
| 228 | Ga0466959_0139962 | 3300045049 | Bacteria | 1711 |
| 229 | Ga0466958_0014198 | 3300045836 | Bacteria | 4547 |
| 230 | Ga0495638_0061903 | 3300046460 | Bacteria | 2311 |
| 231 | Ga0495650_0000268 | 3300046471 | Bacteria | 99891 |
| 232 | Ga0495650_0027203 | 3300046471 | Bacteria | 2647 |
| 233 | Ga0495585_0000034 | 3300046492 | Bacteria | 143120 |
| 234 | Ga0495596_0005458 | 3300046500 | Bacteria | 6007 |
| 235 | Ga0495607_0126450 | 3300046501 | Bacteria | 1336 |
| 236 | Ga0495583_0137132 | 3300046506 | Bacteria | 1021 |
| 237 | Ga0495606_0000450 | 3300046507 | Bacteria | 67219 |
| 238 | Ga0495606_0005978 | 3300046507 | Bacteria | 11414 |
| 239 | Ga0495606_0026586 | 3300046507 | Bacteria | 4123 |
| 240 | Ga0495606_0037216 | 3300046507 | Bacteria | 3306 |
| 241 | Ga0495610_0003230 | 3300046512 | Bacteria | 12887 |
| 242 | Ga0495616_0003747 | 3300046513 | Bacteria | 9698 |
| 243 | Ga0495631_0007261 | 3300046518 | Bacteria | 5646 |
| 244 | Ga0495632_0045983 | 3300046519 | Bacteria | 2171 |
| 245 | Ga0495637_0021632 | 3300046520 | Bacteria | 2947 |
| 246 | Ga0495648_0019092 | 3300046524 | Bacteria | 4833 |
| 247 | Ga0495633_0000072 | 3300046558 | Bacteria | 131197 |
| 248 | Ga0495633_0002781 | 3300046558 | Bacteria | 12096 |
| 249 | Ga0495668_0000009 | 3300046616 | Bacteria | 492623 |
| 250 | Ga0495611_0111214 | 3300046648 | Bacteria | 1275 |
| 251 | Ga0495625_0000007 | 3300046660 | Bacteria | 565749 |
| 252 | Ga0495625_0001804 | 3300046660 | Bacteria | 24594 |
| 253 | Ga0495625_0019611 | 3300046660 | Bacteria | 5240 |
| 254 | Ga0495625_0047902 | 3300046660 | Bacteria | 3081 |
| 255 | Ga0495625_0095196 | 3300046660 | Bacteria | 2053 |
| 256 | Ga0495661_0002324 | 3300046665 | Bacteria | 14664 |
| 257 | Ga0495661_0012016 | 3300046665 | Bacteria | 5859 |
| 258 | Ga0495661_0039422 | 3300046665 | Bacteria | 2936 |
| 259 | Ga0495661_0229927 | 3300046665 | Bacteria | 957 |
| 260 | Ga0495649_0000007 | 3300046694 | Bacteria | 518037 |
| 261 | Ga0495649_0214446 | 3300046694 | Bacteria | 997 |
| 262 | Ga0495660_0010425 | 3300046810 | Bacteria | 5406 |
| 263 | Ga0495683_0030988 | 3300047323 | Bacteria | 2726 |
| 264 | Ga0495687_005184 | 3300047443 | Bacteria | 8427 |
| 265 | Ga0495687_005410 | 3300047443 | Bacteria | 8150 |
| 266 | Ga0495677_0042265 | 3300047445 | Bacteria | 1669 |
| 267 | Ga0495673_0057262 | 3300047469 | Bacteria | 1683 |
| 268 | Ga0495686_0000490 | 3300047472 | Bacteria | 58423 |
| 269 | Ga0495686_0003879 | 3300047472 | Bacteria | 12620 |
| 270 | Ga0495686_0171233 | 3300047472 | Bacteria | 1263 |
| 271 | Ga0495686_0398658 | 3300047472 | Bacteria | 739 |
| 272 | Ga0495678_031139 | 3300049459 | Bacteria | 2227 |
| 273 | nmdc:mga0k408_296_c1 | 3300050493 | Bacteria | 27045 |
| 274 | nmdc:mga0k408_32313_c1 | 3300050493 | Bacteria | 2990 |
| 275 | nmdc:mga0k408_323_c1 | 3300050493 | Bacteria | 26051 |
| 276 | nmdc:mga07m45_250914_c1 | 3300050496 | Bacteria | 1029 |
| 277 | nmdc:mga07m45_6634_c1 | 3300050496 | Bacteria | 5867 |
| 278 | Ga0500635_0001622 | 3300053080 | Bacteria | 5427 |
| 279 | Ga0500608_001665 | 3300053122 | Bacteria | 7966 |
| 280 | Ga0500618_019343 | 3300053125 | Bacteria | 1677 |
| 281 | Ga0500642_0016489 | 3300053130 | Bacteria | 2808 |
| 282 | Ga0500622_0006204 | 3300053156 | Bacteria | 6996 |
| 283 | Ga0500624_000688 | 3300053157 | Bacteria | 8589 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0046061 | Ga0395900_0046061_3775_4470 | 229 |
| 2 | 3300047472 | Ga0495686_0398658 | Ga0495686_0398658_19_711 | 230 |
| 3 | 3300009545 | Ga0105237_10926963 | Ga0105237_109269631 | 234 |
| 4 | 3300046665 | Ga0495661_0039422 | Ga0495661_0039422_2176_2907 | 243 |
| 5 | 3300047472 | Ga0495686_0171233 | Ga0495686_0171233_442_1221 | 243 |
| 6 | 3300046665 | Ga0495661_0002324 | Ga0495661_0002324_13901_14635 | 244 |
| 7 | 3300005327 | Ga0070658_10000113 | Ga0070658_1000011317 | 247 |
| 8 | 3300025909 | Ga0207705_10000160 | Ga0207705_1000016060 | 247 |
| 9 | 3300013104 | Ga0157370_10424417 | Ga0157370_104244171 | 248 |
| 10 | 3300025949 | Ga0207667_10610435 | Ga0207667_106104352 | 248 |
| 11 | iso_pu_bacteria | 2842903701 | 2842904978 | 251 |
| 12 | iso_pu_bacteria | 2896317667 | 2896320800 | 251 |
| 13 | iso_pu_bacteria | 8055588893 | 8055590975 | 251 |
| 14 | 3300006353 | Ga0075370_10061620 | Ga0075370_100616202 | 252 |
| 15 | 3300028794 | Ga0307515_10000427 | Ga0307515_1000042711 | 252 |
| 16 | 3300050496 | nmdc:mga07m45_6634_c1 | nmdc:mga07m45_6634_c1_801_1592 | 252 |
| 17 | 3300003323 | rootH1_10017777 | rootH1_1001777726 | 253 |
| 18 | 3300013104 | Ga0157370_10012704 | Ga0157370_100127042 | 254 |
| 19 | 3300002737 | JGI25162J39368_1000793 | JGI25162J39368_10007934 | 255 |
| 20 | 3300002772 | JGI25164J39214_1002837 | JGI25164J39214_10028372 | 255 |
| 21 | 3300003214 | JGI25165J46597_1000990 | JGI25165J46597_10009905 | 255 |
| 22 | 3300009545 | Ga0105237_10000671 | Ga0105237_1000067110 | 255 |
| 23 | 3300010375 | Ga0105239_10000017 | Ga0105239_10000017144 | 255 |
| 24 | 3300025230 | Ga0209563_105422 | Ga0209563_1054222 | 255 |
| 25 | 3300025231 | Ga0207427_100066 | Ga0207427_10006641 | 255 |
| 26 | 3300025233 | Ga0209437_100010 | Ga0209437_100010156 | 255 |
| 27 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017169 | 255 |
| 28 | 3300025914 | Ga0207671_10003856 | Ga0207671_100038563 | 255 |
| 29 | 3300030731 | Ga0316177_1086545 | Ga0316177_10865452 | 255 |
| 30 | 3300030732 | Ga0316176_1102297 | Ga0316176_110229711 | 255 |
| 31 | 3300030742 | Ga0316183_1003890 | Ga0316183_100389018 | 255 |
| 32 | 3300030744 | Ga0316181_1187430 | Ga0316181_11874302 | 255 |
| 33 | 3300037466 | Ga0395898_0157793 | Ga0395898_0157793_1234_2010 | 256 |
| 34 | 3300050496 | nmdc:mga07m45_250914_c1 | nmdc:mga07m45_250914_c1_100_882 | 256 |
| 35 | iso_pu_bacteria | 2852623160 | 2852626693 | 256 |
| 36 | iso_pu_bacteria | 2884933994 | 2884935123 | 256 |
| 37 | iso_pu_bacteria | 2919437846 | 2919439756 | 256 |
| 38 | iso_pu_bacteria | 2977232053 | 2977234469 | 256 |
| 39 | 3300001979 | JGI24740J21852_10028752 | JGI24740J21852_100287521 | 258 |
| 40 | 3300001990 | JGI24737J22298_10001647 | JGI24737J22298_100016472 | 258 |
| 41 | 3300002067 | JGI24735J21928_10003440 | JGI24735J21928_100034402 | 258 |
| 42 | 3300003316 | rootH1_10116130 | rootH1_101161301 | 258 |
| 43 | 3300005339 | Ga0070660_100090733 | Ga0070660_1000907332 | 258 |
| 44 | 3300005366 | Ga0070659_100029764 | Ga0070659_1000297642 | 258 |
| 45 | 3300005539 | Ga0068853_100066440 | Ga0068853_1000664402 | 258 |
| 46 | 3300005577 | Ga0068857_100003153 | Ga0068857_10000315310 | 258 |
| 47 | 3300009093 | Ga0105240_10747570 | Ga0105240_107475702 | 258 |
| 48 | 3300009545 | Ga0105237_10601179 | Ga0105237_106011791 | 258 |
| 49 | 3300010375 | Ga0105239_10044049 | Ga0105239_100440491 | 258 |
| 50 | 3300013100 | Ga0157373_10007230 | Ga0157373_100072303 | 258 |
| 51 | 3300013102 | Ga0157371_10000121 | Ga0157371_1000012135 | 258 |
| 52 | 3300013104 | Ga0157370_10013250 | Ga0157370_100132505 | 258 |
| 53 | 3300013307 | Ga0157372_10000075 | Ga0157372_1000007522 | 258 |
| 54 | 3300013307 | Ga0157372_10607566 | Ga0157372_106075662 | 258 |
| 55 | 3300025261 | Ga0209233_1001377 | Ga0209233_10013778 | 258 |
| 56 | 3300025904 | Ga0207647_10001699 | Ga0207647_100016998 | 258 |
| 57 | 3300025909 | Ga0207705_10603765 | Ga0207705_106037651 | 258 |
| 58 | 3300025913 | Ga0207695_10555815 | Ga0207695_105558151 | 258 |
| 59 | 3300025919 | Ga0207657_10054143 | Ga0207657_100541433 | 258 |
| 60 | 3300026116 | Ga0207674_10006576 | Ga0207674_1000657610 | 258 |
| 61 | 3300035115 | Ga0373941_0001528 | Ga0373941_0001528_3258_4034 | 258 |
| 62 | 3300037312 | Ga0395899_0000034 | Ga0395899_0000034_136194_136970 | 258 |
| 63 | 3300037418 | Ga0395900_0000523 | Ga0395900_0000523_21018_21794 | 258 |
| 64 | 3300037418 | Ga0395900_0282951 | Ga0395900_0282951_223_999 | 258 |
| 65 | 3300047472 | Ga0495686_0003879 | Ga0495686_0003879_5147_5923 | 258 |
| 66 | 3300053080 | Ga0500635_0001622 | Ga0500635_0001622_1075_1851 | 258 |
| 67 | 3300001990 | JGI24737J22298_10027593 | JGI24737J22298_100275932 | 259 |
| 68 | 3300003320 | rootH2_10004419 | rootH2_1000441931 | 259 |
| 69 | 3300005288 | Ga0065714_10007943 | Ga0065714_100079433 | 259 |
| 70 | 3300005288 | Ga0065714_10018417 | Ga0065714_100184172 | 259 |
| 71 | 3300005327 | Ga0070658_10155213 | Ga0070658_101552132 | 259 |
| 72 | 3300005327 | Ga0070658_10208575 | Ga0070658_102085752 | 259 |
| 73 | 3300005328 | Ga0070676_10006402 | Ga0070676_100064022 | 259 |
| 74 | 3300005336 | Ga0070680_100047212 | Ga0070680_1000472122 | 259 |
| 75 | 3300005339 | Ga0070660_100012437 | Ga0070660_1000124374 | 259 |
| 76 | 3300005339 | Ga0070660_100142187 | Ga0070660_1001421872 | 259 |
| 77 | 3300005355 | Ga0070671_100076051 | Ga0070671_1000760513 | 259 |
| 78 | 3300005364 | Ga0070673_100024422 | Ga0070673_1000244222 | 259 |
| 79 | 3300005366 | Ga0070659_100000076 | Ga0070659_10000007630 | 259 |
| 80 | 3300005457 | Ga0070662_100000186 | Ga0070662_10000018630 | 259 |
| 81 | 3300005459 | Ga0068867_100002700 | Ga0068867_1000027004 | 259 |
| 82 | 3300005539 | Ga0068853_100128346 | Ga0068853_1001283461 | 259 |
| 83 | 3300005539 | Ga0068853_100140811 | Ga0068853_1001408112 | 259 |
| 84 | 3300005543 | Ga0070672_100407395 | Ga0070672_1004073952 | 259 |
| 85 | 3300005548 | Ga0070665_100000017 | Ga0070665_100000017167 | 259 |
| 86 | 3300005563 | Ga0068855_100000033 | Ga0068855_1000000336 | 259 |
| 87 | 3300005563 | Ga0068855_100082425 | Ga0068855_1000824252 | 259 |
| 88 | 3300005563 | Ga0068855_100165701 | Ga0068855_1001657014 | 259 |
| 89 | 3300005616 | Ga0068852_100000477 | Ga0068852_10000047722 | 259 |
| 90 | 3300005842 | Ga0068858_100194800 | Ga0068858_1001948003 | 259 |
| 91 | 3300006195 | Ga0075366_10001994 | Ga0075366_100019942 | 259 |
| 92 | 3300006237 | Ga0097621_100079841 | Ga0097621_1000798412 | 259 |
| 93 | 3300006358 | Ga0068871_100000286 | Ga0068871_10000028634 | 259 |
| 94 | 3300006881 | Ga0068865_100261820 | Ga0068865_1002618202 | 259 |
| 95 | 3300009093 | Ga0105240_10083896 | Ga0105240_100838963 | 259 |
| 96 | 3300009093 | Ga0105240_10272498 | Ga0105240_102724982 | 259 |
| 97 | 3300009093 | Ga0105240_10521190 | Ga0105240_105211902 | 259 |
| 98 | 3300009093 | Ga0105240_10930389 | Ga0105240_109303891 | 259 |
| 99 | 3300009098 | Ga0105245_10181456 | Ga0105245_101814562 | 259 |
| 100 | 3300009174 | Ga0105241_10003969 | Ga0105241_100039697 | 259 |
| 101 | 3300009174 | Ga0105241_10007967 | Ga0105241_100079676 | 259 |
| 102 | 3300009176 | Ga0105242_10601443 | Ga0105242_106014432 | 259 |
| 103 | 3300009545 | Ga0105237_10005528 | Ga0105237_1000552812 | 259 |
| 104 | 3300009545 | Ga0105237_10030627 | Ga0105237_100306272 | 259 |
| 105 | 3300009551 | Ga0105238_10009449 | Ga0105238_100094494 | 259 |
| 106 | 3300010375 | Ga0105239_10088697 | Ga0105239_100886973 | 259 |
| 107 | 3300010375 | Ga0105239_10293554 | Ga0105239_102935542 | 259 |
| 108 | 3300013100 | Ga0157373_10005072 | Ga0157373_100050726 | 259 |
| 109 | 3300013105 | Ga0157369_10203380 | Ga0157369_102033802 | 259 |
| 110 | 3300013296 | Ga0157374_10000907 | Ga0157374_1000090717 | 259 |
| 111 | 3300013296 | Ga0157374_10005978 | Ga0157374_100059782 | 259 |
| 112 | 3300013296 | Ga0157374_10233075 | Ga0157374_102330751 | 259 |
| 113 | 3300013296 | Ga0157374_10482350 | Ga0157374_104823502 | 259 |
| 114 | 3300013306 | Ga0163162_10000051 | Ga0163162_10000051119 | 259 |
| 115 | 3300013307 | Ga0157372_10095527 | Ga0157372_100955273 | 259 |
| 116 | 3300013307 | Ga0157372_10457777 | Ga0157372_104577772 | 259 |
| 117 | 3300013308 | Ga0157375_10499707 | Ga0157375_104997071 | 259 |
| 118 | 3300025899 | Ga0207642_10052681 | Ga0207642_100526812 | 259 |
| 119 | 3300025904 | Ga0207647_10000036 | Ga0207647_1000003647 | 259 |
| 120 | 3300025907 | Ga0207645_10077757 | Ga0207645_100777572 | 259 |
| 121 | 3300025909 | Ga0207705_10099354 | Ga0207705_100993542 | 259 |
| 122 | 3300025911 | Ga0207654_10003367 | Ga0207654_100033675 | 259 |
| 123 | 3300025911 | Ga0207654_10006638 | Ga0207654_100066384 | 259 |
| 124 | 3300025912 | Ga0207707_10087926 | Ga0207707_100879262 | 259 |
| 125 | 3300025913 | Ga0207695_10007163 | Ga0207695_100071632 | 259 |
| 126 | 3300025913 | Ga0207695_10067960 | Ga0207695_100679605 | 259 |
| 127 | 3300025914 | Ga0207671_10003264 | Ga0207671_100032642 | 259 |
| 128 | 3300025914 | Ga0207671_10013362 | Ga0207671_100133625 | 259 |
| 129 | 3300025919 | Ga0207657_10058920 | Ga0207657_100589202 | 259 |
| 130 | 3300025919 | Ga0207657_10079358 | Ga0207657_100793583 | 259 |
| 131 | 3300025921 | Ga0207652_10014722 | Ga0207652_100147225 | 259 |
| 132 | 3300025924 | Ga0207694_10036225 | Ga0207694_100362253 | 259 |
| 133 | 3300025927 | Ga0207687_10035120 | Ga0207687_100351203 | 259 |
| 134 | 3300025931 | Ga0207644_10058278 | Ga0207644_100582782 | 259 |
| 135 | 3300025932 | Ga0207690_10000049 | Ga0207690_1000004927 | 259 |
| 136 | 3300025933 | Ga0207706_10000125 | Ga0207706_1000012528 | 259 |
| 137 | 3300025938 | Ga0207704_10000043 | Ga0207704_1000004375 | 259 |
| 138 | 3300025949 | Ga0207667_10000046 | Ga0207667_1000004685 | 259 |
| 139 | 3300025949 | Ga0207667_10001087 | Ga0207667_100010872 | 259 |
| 140 | 3300025949 | Ga0207667_10141869 | Ga0207667_101418693 | 259 |
| 141 | 3300025949 | Ga0207667_10267190 | Ga0207667_102671902 | 259 |
| 142 | 3300025949 | Ga0207667_10828716 | Ga0207667_108287161 | 259 |
| 143 | 3300025960 | Ga0207651_10190490 | Ga0207651_101904902 | 259 |
| 144 | 3300026023 | Ga0207677_10009563 | Ga0207677_100095635 | 259 |
| 145 | 3300026035 | Ga0207703_10178029 | Ga0207703_101780291 | 259 |
| 146 | 3300026089 | Ga0207648_10000961 | Ga0207648_100009611 | 259 |
| 147 | 3300026142 | Ga0207698_10013089 | Ga0207698_100130892 | 259 |
| 148 | 3300028379 | Ga0268266_10000037 | Ga0268266_10000037150 | 259 |
| 149 | 3300028786 | Ga0307517_10001881 | Ga0307517_1000188130 | 259 |
| 150 | 3300033180 | Ga0307510_10000149 | Ga0307510_1000014938 | 259 |
| 151 | 3300037312 | Ga0395899_0000999 | Ga0395899_0000999_13110_13889 | 259 |
| 152 | 3300037418 | Ga0395900_0010424 | Ga0395900_0010424_4077_4856 | 259 |
| 153 | 3300037466 | Ga0395898_0077573 | Ga0395898_0077573_1646_2425 | 259 |
| 154 | 3300037471 | Ga0395905_0059840 | Ga0395905_0059840_1972_2751 | 259 |
| 155 | 3300038443 | Ga0395901_0037889 | Ga0395901_0037889_3608_4387 | 259 |
| 156 | 3300041452 | Ga0451793_1069912 | Ga0451793_1069912_154_933 | 259 |
| 157 | 3300042005 | Ga0439448_0001769 | Ga0439448_0001769_2914_3693 | 259 |
| 158 | 3300045049 | Ga0466959_0058351 | Ga0466959_0058351_1250_2029 | 259 |
| 159 | 3300046471 | Ga0495650_0027203 | Ga0495650_0027203_1305_2087 | 259 |
| 160 | 3300046500 | Ga0495596_0005458 | Ga0495596_0005458_1326_2105 | 259 |
| 161 | 3300046518 | Ga0495631_0007261 | Ga0495631_0007261_2220_2999 | 259 |
| 162 | 3300046524 | Ga0495648_0019092 | Ga0495648_0019092_1965_2744 | 259 |
| 163 | 3300046660 | Ga0495625_0047902 | Ga0495625_0047902_2015_2794 | 259 |
| 164 | 3300046694 | Ga0495649_0214446 | Ga0495649_0214446_131_910 | 259 |
| 165 | 3300047443 | Ga0495687_005184 | Ga0495687_005184_6324_7103 | 259 |
| 166 | 3300049459 | Ga0495678_031139 | Ga0495678_031139_798_1577 | 259 |
| 167 | 3300050493 | nmdc:mga0k408_323_c1 | nmdc:mga0k408_323_c1_24855_25634 | 259 |
| 168 | 3300053122 | Ga0500608_001665 | Ga0500608_001665_6280_7059 | 259 |
| 169 | 3300053156 | Ga0500622_0006204 | Ga0500622_0006204_3852_4631 | 259 |
| 170 | iso_pu_bacteria | 2599185184 | 2599479847 | 259 |
| 171 | iso_pu_bacteria | 2928078545 | 2928080977 | 259 |
| 172 | iso_pu_bacteria | 2928147474 | 2928152607 | 259 |
| 173 | iso_pu_bacteria | 2932082852 | 2932087344 | 259 |
| 174 | 3300002737 | JGI25162J39368_1000008 | JGI25162J39368_1000008402 | 260 |
| 175 | 3300002737 | JGI25162J39368_1000097 | JGI25162J39368_100009757 | 260 |
| 176 | 3300005614 | Ga0068856_100195293 | Ga0068856_1001952932 | 260 |
| 177 | 3300006186 | Ga0075369_10173081 | Ga0075369_101730812 | 260 |
| 178 | 3300009093 | Ga0105240_10042543 | Ga0105240_100425435 | 260 |
| 179 | 3300009093 | Ga0105240_10308042 | Ga0105240_103080421 | 260 |
| 180 | 3300009093 | Ga0105240_10444983 | Ga0105240_104449832 | 260 |
| 181 | 3300009176 | Ga0105242_10123536 | Ga0105242_101235361 | 260 |
| 182 | 3300010375 | Ga0105239_10000821 | Ga0105239_1000082126 | 260 |
| 183 | 3300010375 | Ga0105239_10022087 | Ga0105239_100220877 | 260 |
| 184 | 3300013306 | Ga0163162_10006492 | Ga0163162_1000649211 | 260 |
| 185 | 3300017792 | Ga0163161_10050827 | Ga0163161_100508272 | 260 |
| 186 | 3300025233 | Ga0209437_100030 | Ga0209437_10003047 | 260 |
| 187 | 3300025913 | Ga0207695_10018287 | Ga0207695_100182874 | 260 |
| 188 | 3300025913 | Ga0207695_10289691 | Ga0207695_102896911 | 260 |
| 189 | 3300025913 | Ga0207695_10294962 | Ga0207695_102949621 | 260 |
| 190 | 3300025981 | Ga0207640_10043496 | Ga0207640_100434962 | 260 |
| 191 | 3300026078 | Ga0207702_10085834 | Ga0207702_100858342 | 260 |
| 192 | 3300028794 | Ga0307515_10145561 | Ga0307515_101455611 | 260 |
| 193 | 3300031507 | Ga0307509_10196238 | Ga0307509_101962382 | 260 |
| 194 | 3300046501 | Ga0495607_0126450 | Ga0495607_0126450_342_1124 | 260 |
| 195 | 3300046506 | Ga0495583_0137132 | Ga0495583_0137132_56_838 | 260 |
| 196 | 3300046558 | Ga0495633_0000072 | Ga0495633_0000072_102086_102868 | 260 |
| 197 | 3300046616 | Ga0495668_0000009 | Ga0495668_0000009_10336_11118 | 260 |
| 198 | 3300046660 | Ga0495625_0019611 | Ga0495625_0019611_938_1720 | 260 |
| 199 | 3300053130 | Ga0500642_0016489 | Ga0500642_0016489_1669_2451 | 260 |
| 200 | 3300053157 | Ga0500624_000688 | Ga0500624_000688_2308_3090 | 260 |
| 201 | 3300002741 | JGI25157J39369_1007634 | JGI25157J39369_10076342 | 261 |
| 202 | 3300003320 | rootH2_10027438 | rootH2_100274383 | 261 |
| 203 | 3300005327 | Ga0070658_10468962 | Ga0070658_104689621 | 261 |
| 204 | 3300005614 | Ga0068856_100001331 | Ga0068856_10000133121 | 261 |
| 205 | 3300005614 | Ga0068856_100003123 | Ga0068856_1000031234 | 261 |
| 206 | 3300005614 | Ga0068856_100544993 | Ga0068856_1005449931 | 261 |
| 207 | 3300005616 | Ga0068852_100088612 | Ga0068852_1000886123 | 261 |
| 208 | 3300006195 | Ga0075366_10000325 | Ga0075366_100003257 | 261 |
| 209 | 3300009093 | Ga0105240_10000277 | Ga0105240_100002772 | 261 |
| 210 | 3300009093 | Ga0105240_10701359 | Ga0105240_107013592 | 261 |
| 211 | 3300009174 | Ga0105241_10038428 | Ga0105241_100384283 | 261 |
| 212 | 3300009174 | Ga0105241_10598241 | Ga0105241_105982411 | 261 |
| 213 | 3300009545 | Ga0105237_10001295 | Ga0105237_1000129529 | 261 |
| 214 | 3300009545 | Ga0105237_10113238 | Ga0105237_101132382 | 261 |
| 215 | 3300010375 | Ga0105239_10000026 | Ga0105239_100000262 | 261 |
| 216 | 3300010375 | Ga0105239_10001174 | Ga0105239_1000117423 | 261 |
| 217 | 3300010375 | Ga0105239_10012043 | Ga0105239_100120432 | 261 |
| 218 | 3300013100 | Ga0157373_10000254 | Ga0157373_1000025425 | 261 |
| 219 | 3300013296 | Ga0157374_10485626 | Ga0157374_104856262 | 261 |
| 220 | 3300013297 | Ga0157378_10294494 | Ga0157378_102944941 | 261 |
| 221 | 3300013307 | Ga0157372_10007570 | Ga0157372_100075705 | 261 |
| 222 | 3300025250 | Ga0209026_1000243 | Ga0209026_100024340 | 261 |
| 223 | 3300025250 | Ga0209026_1001098 | Ga0209026_100109813 | 261 |
| 224 | 3300025261 | Ga0209233_1019799 | Ga0209233_10197991 | 261 |
| 225 | 3300025272 | Ga0209455_1005189 | Ga0209455_10051892 | 261 |
| 226 | 3300025909 | Ga0207705_10131924 | Ga0207705_101319242 | 261 |
| 227 | 3300025911 | Ga0207654_10020216 | Ga0207654_100202162 | 261 |
| 228 | 3300025913 | Ga0207695_10000375 | Ga0207695_100003752 | 261 |
| 229 | 3300025913 | Ga0207695_10019425 | Ga0207695_100194257 | 261 |
| 230 | 3300025914 | Ga0207671_10001112 | Ga0207671_100011123 | 261 |
| 231 | 3300025914 | Ga0207671_10064377 | Ga0207671_100643772 | 261 |
| 232 | 3300025914 | Ga0207671_10123786 | Ga0207671_101237862 | 261 |
| 233 | 3300026041 | Ga0207639_10181476 | Ga0207639_101814762 | 261 |
| 234 | 3300026078 | Ga0207702_10000184 | Ga0207702_1000018466 | 261 |
| 235 | 3300026078 | Ga0207702_10038507 | Ga0207702_100385074 | 261 |
| 236 | 3300028794 | Ga0307515_10184483 | Ga0307515_101844832 | 261 |
| 237 | 3300028800 | Ga0265338_10140907 | Ga0265338_101409071 | 261 |
| 238 | 3300033179 | Ga0307507_10000034 | Ga0307507_10000034143 | 261 |
| 239 | 3300037312 | Ga0395899_0003043 | Ga0395899_0003043_3834_4625 | 261 |
| 240 | 3300037471 | Ga0395905_0000579 | Ga0395905_0000579_12398_13189 | 261 |
| 241 | 3300038443 | Ga0395901_0001854 | Ga0395901_0001854_18970_19761 | 261 |
| 242 | 3300046507 | Ga0495606_0026586 | Ga0495606_0026586_1513_2298 | 261 |
| 243 | 3300046507 | Ga0495606_0037216 | Ga0495606_0037216_2464_3249 | 261 |
| 244 | 3300046648 | Ga0495611_0111214 | Ga0495611_0111214_175_960 | 261 |
| 245 | 3300046660 | Ga0495625_0001804 | Ga0495625_0001804_12854_13639 | 261 |
| 246 | 3300046660 | Ga0495625_0095196 | Ga0495625_0095196_1239_2024 | 261 |
| 247 | 3300046665 | Ga0495661_0229927 | Ga0495661_0229927_77_862 | 261 |
| 248 | 3300047445 | Ga0495677_0042265 | Ga0495677_0042265_496_1281 | 261 |
| 249 | 3300047472 | Ga0495686_0000490 | Ga0495686_0000490_31159_31944 | 261 |
| 250 | 3300050493 | nmdc:mga0k408_296_c1 | nmdc:mga0k408_296_c1_22958_23743 | 261 |
| 251 | 3300001915 | JGI24741J21665_1010957 | JGI24741J21665_10109572 | 263 |
| 252 | 3300001989 | JGI24739J22299_10014096 | JGI24739J22299_100140961 | 263 |
| 253 | 3300001990 | JGI24737J22298_10000677 | JGI24737J22298_100006772 | 263 |
| 254 | 3300002067 | JGI24735J21928_10000007 | JGI24735J21928_10000007114 | 263 |
| 255 | 3300003316 | rootH1_10042091 | rootH1_100420917 | 263 |
| 256 | 3300003322 | rootL2_10145639 | rootL2_101456392 | 263 |
| 257 | 3300003323 | rootH1_10065749 | rootH1_100657492 | 263 |
| 258 | 3300005563 | Ga0068855_100031030 | Ga0068855_1000310302 | 263 |
| 259 | 3300006195 | Ga0075366_10006432 | Ga0075366_100064322 | 263 |
| 260 | 3300006353 | Ga0075370_10148805 | Ga0075370_101488052 | 263 |
| 261 | 3300010375 | Ga0105239_10159386 | Ga0105239_101593863 | 263 |
| 262 | 3300013102 | Ga0157371_10011466 | Ga0157371_100114664 | 263 |
| 263 | 3300013105 | Ga0157369_10000772 | Ga0157369_1000077223 | 263 |
| 264 | 3300013105 | Ga0157369_10059779 | Ga0157369_100597795 | 263 |
| 265 | 3300013306 | Ga0163162_10005275 | Ga0163162_100052751 | 263 |
| 266 | 3300013307 | Ga0157372_10000009 | Ga0157372_10000009139 | 263 |
| 267 | 3300013307 | Ga0157372_10008881 | Ga0157372_100088816 | 263 |
| 268 | 3300025904 | Ga0207647_10014496 | Ga0207647_100144962 | 263 |
| 269 | 3300026116 | Ga0207674_10235067 | Ga0207674_102350672 | 263 |
| 270 | 3300037312 | Ga0395899_0000220 | Ga0395899_0000220_2041_2832 | 263 |
| 271 | 3300037418 | Ga0395900_0256715 | Ga0395900_0256715_504_1295 | 263 |
| 272 | 3300044684 | Ga0466966_0237706 | Ga0466966_0237706_290_1081 | 263 |
| 273 | 3300044693 | Ga0466961_0004455 | Ga0466961_0004455_457_1248 | 263 |
| 274 | 3300045049 | Ga0466959_0139962 | Ga0466959_0139962_218_1009 | 263 |
| 275 | 3300045836 | Ga0466958_0014198 | Ga0466958_0014198_1104_1895 | 263 |
| 276 | 3300046460 | Ga0495638_0061903 | Ga0495638_0061903_674_1465 | 263 |
| 277 | 3300046471 | Ga0495650_0000268 | Ga0495650_0000268_62205_62996 | 263 |
| 278 | 3300046492 | Ga0495585_0000034 | Ga0495585_0000034_134385_135176 | 263 |
| 279 | 3300046507 | Ga0495606_0000450 | Ga0495606_0000450_34598_35389 | 263 |
| 280 | 3300046507 | Ga0495606_0005978 | Ga0495606_0005978_10414_11205 | 263 |
| 281 | 3300046512 | Ga0495610_0003230 | Ga0495610_0003230_8996_9787 | 263 |
| 282 | 3300046513 | Ga0495616_0003747 | Ga0495616_0003747_1357_2148 | 263 |
| 283 | 3300046519 | Ga0495632_0045983 | Ga0495632_0045983_462_1253 | 263 |
| 284 | 3300046520 | Ga0495637_0021632 | Ga0495637_0021632_1160_1951 | 263 |
| 285 | 3300046558 | Ga0495633_0002781 | Ga0495633_0002781_9894_10685 | 263 |
| 286 | 3300046660 | Ga0495625_0000007 | Ga0495625_0000007_391785_392576 | 263 |
| 287 | 3300046665 | Ga0495661_0012016 | Ga0495661_0012016_373_1164 | 263 |
| 288 | 3300046694 | Ga0495649_0000007 | Ga0495649_0000007_44906_45697 | 263 |
| 289 | 3300046810 | Ga0495660_0010425 | Ga0495660_0010425_711_1502 | 263 |
| 290 | 3300047323 | Ga0495683_0030988 | Ga0495683_0030988_86_877 | 263 |
| 291 | 3300047443 | Ga0495687_005410 | Ga0495687_005410_2606_3397 | 263 |
| 292 | 3300047469 | Ga0495673_0057262 | Ga0495673_0057262_520_1311 | 263 |
| 293 | 3300050493 | nmdc:mga0k408_32313_c1 | nmdc:mga0k408_32313_c1_1816_2607 | 263 |
| 294 | 3300053125 | Ga0500618_019343 | Ga0500618_019343_287_1078 | 263 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2acz-assembly1.cif.gz_D | complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site | 0.6885 | 93 | 250 |
| 6e7k-assembly2.cif.gz_D | structure of the lipoprotein lipase gpihbp1 complex that mediates plasma triglyceride hydrolysis | 0.6818 | 137 | 179 |
| 2wdq-assembly3.cif.gz_H | e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound | 0.68 | 106 | 255 |
| 2wu5-assembly1.cif.gz_H | crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant | 0.6742 | 106 | 255 |
| 2acz-assembly1.cif.gz_D | complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site | 0.6574 | 93 | 250 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2aczD01 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.7441 | 106 | 250 | 1.20.1300.10 |
| af_Q2FZC9_1_204_1.20.1300.10 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.7308 | 1 | 254 | 1.20.1300.10 |
| af_Q2FZC9_1_204_1.20.1300.10 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.7184 | 1 | 254 | 1.20.1300.10 |
| 2ws3H00 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.7063 | 106 | 255 | 1.20.1300.10 |
| 2aczD01 | Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit | 0.6899 | 106 | 250 | 1.20.1300.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A556MTI2-F1-model_v4 | Succinate dehydrogenase cytochrome b subunit | 0.8951 | 1 | 260 |
GO:0016020
|
| AF-A0A556MTI2-F1-model_v4 | Succinate dehydrogenase cytochrome b subunit | 0.8886 | 1 | 260 |
GO:0016020
|
| AF-A0A257ISH7-F1-model_v4 | Succinate dehydrogenase | 0.8654 | 1 | 255 |
GO:0016020
|
| AF-A0A258KUH8-F1-model_v4 | Succinate dehydrogenase | 0.8613 | 110 | 256 |
GO:0016020
|
| AF-A0A1T5FRV3-F1-model_v4 | Succinate dehydrogenase / fumarate reductase cytochrome b subunit | 0.8596 | 2 | 258 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar