F392073

General Info

Members Datasets Scaffolds Average Seq Length
294 154 283 259

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10000772|Ga0157369_1000077223
Length 284
Sequence MHLYIFQLLINNFAKKINYLIMSEFKQTFNSSLGKKLIMALTGLFLCTFLIVHVAGNLQLFKNDNGYGFNVYANFLAHFPPIEVVAYILYICIIVHTIYAIIVTTNNRKARPIGYAVSPKSPTSWSSQNMGLLGSILFLFIVIHMGDFWFTYKFNHALAFKEYRTNLLTGEQTVSAFTPPNADFDRSLSYDGNTEVMRVKDLHARVAESFSHLWYVVLYVIAMVALAYHLVHGFQSAFRSLGWVHRKWTPIVEFIGTWFFAVIIPLLFAAMPIAYYIMSSNKQL

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
3 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
4 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
5 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
25 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
26 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
67 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
102 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
103 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
104 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
121 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
128 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
131 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
132 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
133 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
139 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
149 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
150 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
151 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
152 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
153 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
154 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.26
Metatranscriptomes 0
Isolates 3.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.2
Nodule 0
Rhizoplane 0.68
Rhizosphere 81.97
Stem 0
Stem Tuber 0
Unclassified 7.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1010957 3300001915 Bacteria 1601
2 JGI24740J21852_10028752 3300001979 Bacteria 1833
3 JGI24739J22299_10014096 3300001989 Bacteria 2911
4 JGI24737J22298_10000677 3300001990 Bacteria 12067
5 JGI24737J22298_10001647 3300001990 Bacteria 7970
6 JGI24737J22298_10027593 3300001990 Bacteria 1789
7 JGI24735J21928_10000007 3300002067 Bacteria 333510
8 JGI24735J21928_10003440 3300002067 Bacteria 5389
9 JGI25162J39368_1000008 3300002737 Bacteria 397212
10 JGI25162J39368_1000097 3300002737 Bacteria 96520
11 JGI25162J39368_1000793 3300002737 Bacteria 21112
12 JGI25157J39369_1007634 3300002741 Bacteria 1551
13 JGI25164J39214_1002837 3300002772 Bacteria 2428
14 JGI25165J46597_1000990 3300003214 Bacteria 18944
15 rootH1_10042091 3300003316 Bacteria 7507
16 rootH1_10116130 3300003316 Bacteria 1028
17 rootH2_10004419 3300003320 Bacteria 46013
18 rootH2_10027438 3300003320 Bacteria 13342
19 rootL2_10145639 3300003322 Bacteria 1299
20 rootH1_10017777 3300003323 Bacteria 31426
21 rootH1_10065749 3300003323 Bacteria 3264
22 Ga0065714_10007943 3300005288 Bacteria 4768
23 Ga0065714_10018417 3300005288 Bacteria 1465
24 Ga0070658_10000113 3300005327 Bacteria 72221
25 Ga0070658_10155213 3300005327 Bacteria 1918
26 Ga0070658_10208575 3300005327 Bacteria 1650
27 Ga0070658_10468962 3300005327 Bacteria 1086
28 Ga0070676_10006402 3300005328 Bacteria 6290
29 Ga0070680_100047212 3300005336 Bacteria 3505
30 Ga0070660_100012437 3300005339 Bacteria 6077
31 Ga0070660_100090733 3300005339 Bacteria 2409
32 Ga0070660_100142187 3300005339 Bacteria 1926
33 Ga0070671_100076051 3300005355 Bacteria 2805
34 Ga0070673_100024422 3300005364 Bacteria 4432
35 Ga0070659_100000076 3300005366 Bacteria 77320
36 Ga0070659_100029764 3300005366 Bacteria 4221
37 Ga0070662_100000186 3300005457 Bacteria 36051
38 Ga0068867_100002700 3300005459 Bacteria 12519
39 Ga0068853_100066440 3300005539 Bacteria 3132
40 Ga0068853_100128346 3300005539 Bacteria 2267
41 Ga0068853_100140811 3300005539 Bacteria 2165
42 Ga0070672_100407395 3300005543 Bacteria 1166
43 Ga0070665_100000017 3300005548 Bacteria 448013
44 Ga0068855_100000033 3300005563 Bacteria 167299
45 Ga0068855_100031030 3300005563 Bacteria 6387
46 Ga0068855_100082425 3300005563 Bacteria 3728
47 Ga0068855_100165701 3300005563 Bacteria 2505
48 Ga0068857_100003153 3300005577 Bacteria 13663
49 Ga0068856_100001331 3300005614 Bacteria 26020
50 Ga0068856_100003123 3300005614 Bacteria 16901
51 Ga0068856_100195293 3300005614 Bacteria 2038
52 Ga0068856_100544993 3300005614 Bacteria 1181
53 Ga0068852_100000477 3300005616 Bacteria 26260
54 Ga0068852_100088612 3300005616 Bacteria 2764
55 Ga0068858_100194800 3300005842 Bacteria 1915
56 Ga0075369_10173081 3300006186 Bacteria 992
57 Ga0075366_10000325 3300006195 Bacteria 21814
58 Ga0075366_10001994 3300006195 Bacteria 10347
59 Ga0075366_10006432 3300006195 Bacteria 6437
60 Ga0097621_100079841 3300006237 Bacteria 2720
61 Ga0075370_10061620 3300006353 Bacteria 2137
62 Ga0075370_10148805 3300006353 Bacteria 1372
63 Ga0068871_100000286 3300006358 Bacteria 35207
64 Ga0068865_100261820 3300006881 Bacteria 1369
65 Ga0105240_10000277 3300009093 Bacteria 101646
66 Ga0105240_10042543 3300009093 Bacteria 5788
67 Ga0105240_10083896 3300009093 Bacteria 3908
68 Ga0105240_10272498 3300009093 Bacteria 1948
69 Ga0105240_10308042 3300009093 Bacteria 1809
70 Ga0105240_10444983 3300009093 Bacteria 1451
71 Ga0105240_10521190 3300009093 Bacteria 1319
72 Ga0105240_10701359 3300009093 Bacteria 1105
73 Ga0105240_10747570 3300009093 Bacteria 1063
74 Ga0105240_10930389 3300009093 Bacteria 933
75 Ga0105245_10181456 3300009098 Bacteria 2011
76 Ga0105241_10003969 3300009174 Bacteria 10940
77 Ga0105241_10007967 3300009174 Bacteria 7793
78 Ga0105241_10038428 3300009174 Bacteria 3608
79 Ga0105241_10598241 3300009174 Bacteria 996
80 Ga0105242_10123536 3300009176 Bacteria 2225
81 Ga0105242_10601443 3300009176 Bacteria 1062
82 Ga0105237_10000671 3300009545 Bacteria 47262
83 Ga0105237_10001295 3300009545 Bacteria 33282
84 Ga0105237_10005528 3300009545 Bacteria 14248
85 Ga0105237_10030627 3300009545 Bacteria 5464
86 Ga0105237_10113238 3300009545 Bacteria 2705
87 Ga0105237_10601179 3300009545 Bacteria 1107
88 Ga0105237_10926963 3300009545 Bacteria 878
89 Ga0105238_10009449 3300009551 Bacteria 9760
90 Ga0105239_10000017 3300010375 Bacteria 290760
91 Ga0105239_10000026 3300010375 Bacteria 248302
92 Ga0105239_10000821 3300010375 Bacteria 44186
93 Ga0105239_10001174 3300010375 Bacteria 35994
94 Ga0105239_10012043 3300010375 Bacteria 9644
95 Ga0105239_10022087 3300010375 Bacteria 7014
96 Ga0105239_10044049 3300010375 Bacteria 4892
97 Ga0105239_10088697 3300010375 Bacteria 3410
98 Ga0105239_10159386 3300010375 Bacteria 2520
99 Ga0105239_10293554 3300010375 Bacteria 1830
100 Ga0157373_10000254 3300013100 Bacteria 43477
101 Ga0157373_10005072 3300013100 Bacteria 9896
102 Ga0157373_10007230 3300013100 Bacteria 8279
103 Ga0157371_10000121 3300013102 Bacteria 118793
104 Ga0157371_10011466 3300013102 Bacteria 6823
105 Ga0157370_10012704 3300013104 Bacteria 8714
106 Ga0157370_10013250 3300013104 Bacteria 8497
107 Ga0157370_10424417 3300013104 Bacteria 1223
108 Ga0157369_10000772 3300013105 Bacteria 41301
109 Ga0157369_10059779 3300013105 Bacteria 4110
110 Ga0157369_10203380 3300013105 Bacteria 2078
111 Ga0157374_10000907 3300013296 Bacteria 25765
112 Ga0157374_10005978 3300013296 Bacteria 10295
113 Ga0157374_10233075 3300013296 Bacteria 1809
114 Ga0157374_10482350 3300013296 Bacteria 1243
115 Ga0157374_10485626 3300013296 Bacteria 1239
116 Ga0157378_10294494 3300013297 Bacteria 1568
117 Ga0163162_10000051 3300013306 Bacteria 117695
118 Ga0163162_10005275 3300013306 Bacteria 12468
119 Ga0163162_10006492 3300013306 Bacteria 11324
120 Ga0157372_10000009 3300013307 Bacteria 302051
121 Ga0157372_10000075 3300013307 Bacteria 105528
122 Ga0157372_10007570 3300013307 Bacteria 11548
123 Ga0157372_10008881 3300013307 Bacteria 10673
124 Ga0157372_10095527 3300013307 Bacteria 3387
125 Ga0157372_10457777 3300013307 Bacteria 1487
126 Ga0157372_10607566 3300013307 Unclassified 1275
127 Ga0157375_10499707 3300013308 Bacteria 1380
128 Ga0163161_10050827 3300017792 Bacteria 3001
129 Ga0209563_105422 3300025230 Bacteria 2316
130 Ga0207427_100066 3300025231 Bacteria 165770
131 Ga0209437_100010 3300025233 Bacteria 838447
132 Ga0209437_100030 3300025233 Bacteria 532466
133 Ga0209026_1000243 3300025250 Bacteria 69921
134 Ga0209026_1001098 3300025250 Bacteria 12954
135 Ga0209233_1000017 3300025261 Bacteria 898076
136 Ga0209233_1001377 3300025261 Bacteria 9643
137 Ga0209233_1019799 3300025261 Bacteria 1780
138 Ga0209455_1005189 3300025272 Bacteria 4081
139 Ga0207642_10052681 3300025899 Bacteria 1847
140 Ga0207647_10000036 3300025904 Bacteria 98204
141 Ga0207647_10001699 3300025904 Bacteria 16954
142 Ga0207647_10014496 3300025904 Bacteria 5432
143 Ga0207645_10077757 3300025907 Bacteria 2126
144 Ga0207705_10000160 3300025909 Bacteria 72235
145 Ga0207705_10099354 3300025909 Bacteria 2139
146 Ga0207705_10131924 3300025909 Bacteria 1860
147 Ga0207705_10603765 3300025909 Bacteria 853
148 Ga0207654_10003367 3300025911 Bacteria 8097
149 Ga0207654_10006638 3300025911 Bacteria 5821
150 Ga0207654_10020216 3300025911 Bacteria 3526
151 Ga0207707_10087926 3300025912 Bacteria 2715
152 Ga0207695_10000375 3300025913 Bacteria 101654
153 Ga0207695_10007163 3300025913 Bacteria 14274
154 Ga0207695_10018287 3300025913 Bacteria 8108
155 Ga0207695_10019425 3300025913 Bacteria 7826
156 Ga0207695_10067960 3300025913 Bacteria 3653
157 Ga0207695_10289691 3300025913 Bacteria 1530
158 Ga0207695_10294962 3300025913 Bacteria 1513
159 Ga0207695_10555815 3300025913 Bacteria 1029
160 Ga0207671_10001112 3300025914 Bacteria 32446
161 Ga0207671_10003264 3300025914 Bacteria 16311
162 Ga0207671_10003856 3300025914 Bacteria 14663
163 Ga0207671_10013362 3300025914 Bacteria 6541
164 Ga0207671_10064377 3300025914 Bacteria 2726
165 Ga0207671_10123786 3300025914 Bacteria 1978
166 Ga0207657_10054143 3300025919 Bacteria 3472
167 Ga0207657_10058920 3300025919 Bacteria 3303
168 Ga0207657_10079358 3300025919 Bacteria 2761
169 Ga0207652_10014722 3300025921 Bacteria 6339
170 Ga0207694_10036225 3300025924 Bacteria 3786
171 Ga0207687_10035120 3300025927 Bacteria 3409
172 Ga0207644_10058278 3300025931 Bacteria 2791
173 Ga0207690_10000049 3300025932 Bacteria 113589
174 Ga0207706_10000125 3300025933 Bacteria 83075
175 Ga0207704_10000043 3300025938 Bacteria 88714
176 Ga0207667_10000046 3300025949 Bacteria 245420
177 Ga0207667_10001087 3300025949 Bacteria 34483
178 Ga0207667_10141869 3300025949 Bacteria 2474
179 Ga0207667_10267190 3300025949 Bacteria 1749
180 Ga0207667_10610435 3300025949 Bacteria 1099
181 Ga0207667_10828716 3300025949 Bacteria 920
182 Ga0207651_10190490 3300025960 Bacteria 1635
183 Ga0207640_10043496 3300025981 Bacteria 2871
184 Ga0207677_10009563 3300026023 Bacteria 5456
185 Ga0207703_10178029 3300026035 Bacteria 1875
186 Ga0207639_10181476 3300026041 Bacteria 1791
187 Ga0207702_10000184 3300026078 Bacteria 74950
188 Ga0207702_10038507 3300026078 Bacteria 4004
189 Ga0207702_10085834 3300026078 Bacteria 2743
190 Ga0207648_10000961 3300026089 Bacteria 32589
191 Ga0207674_10006576 3300026116 Bacteria 13663
192 Ga0207674_10235067 3300026116 Bacteria 1780
193 Ga0207698_10013089 3300026142 Bacteria 5462
194 Ga0268266_10000037 3300028379 Bacteria 342368
195 Ga0307517_10001881 3300028786 Bacteria 34355
196 Ga0307515_10000427 3300028794 Bacteria 101325
197 Ga0307515_10145561 3300028794 Bacteria 2512
198 Ga0307515_10184483 3300028794 Bacteria 2022
199 Ga0265338_10140907 3300028800 Bacteria 1889
200 Ga0316177_1086545 3300030731 Bacteria 2720
201 Ga0316176_1102297 3300030732 Bacteria 14584
202 Ga0316183_1003890 3300030742 Bacteria 25813
203 Ga0316181_1187430 3300030744 Bacteria 4170
204 Ga0307509_10196238 3300031507 Bacteria 1862
205 Ga0307507_10000034 3300033179 Bacteria 188697
206 Ga0307510_10000149 3300033180 Bacteria 58176
207 Ga0373941_0001528 3300035115 Bacteria 4900
208 Ga0395899_0000034 3300037312 Bacteria 302623
209 Ga0395899_0000220 3300037312 Bacteria 78900
210 Ga0395899_0000999 3300037312 Bacteria 25966
211 Ga0395899_0003043 3300037312 Bacteria 13394
212 Ga0395900_0000523 3300037418 Bacteria 54244
213 Ga0395900_0010424 3300037418 Bacteria 9504
214 Ga0395900_0046061 3300037418 Bacteria 4491
215 Ga0395900_0256715 3300037418 Bacteria 1747
216 Ga0395900_0282951 3300037418 Bacteria 1650
217 Ga0395898_0077573 3300037466 Bacteria 3207
218 Ga0395898_0157793 3300037466 Bacteria 2170
219 Ga0395905_0000579 3300037471 Bacteria 49357
220 Ga0395905_0059840 3300037471 Bacteria 3561
221 Ga0395901_0001854 3300038443 Bacteria 21864
222 Ga0395901_0037889 3300038443 Bacteria 4985
223 Ga0451793_1069912 3300041452 Bacteria 1322
224 Ga0439448_0001769 3300042005 Bacteria 5707
225 Ga0466966_0237706 3300044684 Bacteria 1098
226 Ga0466961_0004455 3300044693 Bacteria 8773
227 Ga0466959_0058351 3300045049 Bacteria 2811
228 Ga0466959_0139962 3300045049 Bacteria 1711
229 Ga0466958_0014198 3300045836 Bacteria 4547
230 Ga0495638_0061903 3300046460 Bacteria 2311
231 Ga0495650_0000268 3300046471 Bacteria 99891
232 Ga0495650_0027203 3300046471 Bacteria 2647
233 Ga0495585_0000034 3300046492 Bacteria 143120
234 Ga0495596_0005458 3300046500 Bacteria 6007
235 Ga0495607_0126450 3300046501 Bacteria 1336
236 Ga0495583_0137132 3300046506 Bacteria 1021
237 Ga0495606_0000450 3300046507 Bacteria 67219
238 Ga0495606_0005978 3300046507 Bacteria 11414
239 Ga0495606_0026586 3300046507 Bacteria 4123
240 Ga0495606_0037216 3300046507 Bacteria 3306
241 Ga0495610_0003230 3300046512 Bacteria 12887
242 Ga0495616_0003747 3300046513 Bacteria 9698
243 Ga0495631_0007261 3300046518 Bacteria 5646
244 Ga0495632_0045983 3300046519 Bacteria 2171
245 Ga0495637_0021632 3300046520 Bacteria 2947
246 Ga0495648_0019092 3300046524 Bacteria 4833
247 Ga0495633_0000072 3300046558 Bacteria 131197
248 Ga0495633_0002781 3300046558 Bacteria 12096
249 Ga0495668_0000009 3300046616 Bacteria 492623
250 Ga0495611_0111214 3300046648 Bacteria 1275
251 Ga0495625_0000007 3300046660 Bacteria 565749
252 Ga0495625_0001804 3300046660 Bacteria 24594
253 Ga0495625_0019611 3300046660 Bacteria 5240
254 Ga0495625_0047902 3300046660 Bacteria 3081
255 Ga0495625_0095196 3300046660 Bacteria 2053
256 Ga0495661_0002324 3300046665 Bacteria 14664
257 Ga0495661_0012016 3300046665 Bacteria 5859
258 Ga0495661_0039422 3300046665 Bacteria 2936
259 Ga0495661_0229927 3300046665 Bacteria 957
260 Ga0495649_0000007 3300046694 Bacteria 518037
261 Ga0495649_0214446 3300046694 Bacteria 997
262 Ga0495660_0010425 3300046810 Bacteria 5406
263 Ga0495683_0030988 3300047323 Bacteria 2726
264 Ga0495687_005184 3300047443 Bacteria 8427
265 Ga0495687_005410 3300047443 Bacteria 8150
266 Ga0495677_0042265 3300047445 Bacteria 1669
267 Ga0495673_0057262 3300047469 Bacteria 1683
268 Ga0495686_0000490 3300047472 Bacteria 58423
269 Ga0495686_0003879 3300047472 Bacteria 12620
270 Ga0495686_0171233 3300047472 Bacteria 1263
271 Ga0495686_0398658 3300047472 Bacteria 739
272 Ga0495678_031139 3300049459 Bacteria 2227
273 nmdc:mga0k408_296_c1 3300050493 Bacteria 27045
274 nmdc:mga0k408_32313_c1 3300050493 Bacteria 2990
275 nmdc:mga0k408_323_c1 3300050493 Bacteria 26051
276 nmdc:mga07m45_250914_c1 3300050496 Bacteria 1029
277 nmdc:mga07m45_6634_c1 3300050496 Bacteria 5867
278 Ga0500635_0001622 3300053080 Bacteria 5427
279 Ga0500608_001665 3300053122 Bacteria 7966
280 Ga0500618_019343 3300053125 Bacteria 1677
281 Ga0500642_0016489 3300053130 Bacteria 2808
282 Ga0500622_0006204 3300053156 Bacteria 6996
283 Ga0500624_000688 3300053157 Bacteria 8589

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0046061 Ga0395900_0046061_3775_4470 229
2 3300047472 Ga0495686_0398658 Ga0495686_0398658_19_711 230
3 3300009545 Ga0105237_10926963 Ga0105237_109269631 234
4 3300046665 Ga0495661_0039422 Ga0495661_0039422_2176_2907 243
5 3300047472 Ga0495686_0171233 Ga0495686_0171233_442_1221 243
6 3300046665 Ga0495661_0002324 Ga0495661_0002324_13901_14635 244
7 3300005327 Ga0070658_10000113 Ga0070658_1000011317 247
8 3300025909 Ga0207705_10000160 Ga0207705_1000016060 247
9 3300013104 Ga0157370_10424417 Ga0157370_104244171 248
10 3300025949 Ga0207667_10610435 Ga0207667_106104352 248
11 iso_pu_bacteria 2842903701 2842904978 251
12 iso_pu_bacteria 2896317667 2896320800 251
13 iso_pu_bacteria 8055588893 8055590975 251
14 3300006353 Ga0075370_10061620 Ga0075370_100616202 252
15 3300028794 Ga0307515_10000427 Ga0307515_1000042711 252
16 3300050496 nmdc:mga07m45_6634_c1 nmdc:mga07m45_6634_c1_801_1592 252
17 3300003323 rootH1_10017777 rootH1_1001777726 253
18 3300013104 Ga0157370_10012704 Ga0157370_100127042 254
19 3300002737 JGI25162J39368_1000793 JGI25162J39368_10007934 255
20 3300002772 JGI25164J39214_1002837 JGI25164J39214_10028372 255
21 3300003214 JGI25165J46597_1000990 JGI25165J46597_10009905 255
22 3300009545 Ga0105237_10000671 Ga0105237_1000067110 255
23 3300010375 Ga0105239_10000017 Ga0105239_10000017144 255
24 3300025230 Ga0209563_105422 Ga0209563_1054222 255
25 3300025231 Ga0207427_100066 Ga0207427_10006641 255
26 3300025233 Ga0209437_100010 Ga0209437_100010156 255
27 3300025261 Ga0209233_1000017 Ga0209233_1000017169 255
28 3300025914 Ga0207671_10003856 Ga0207671_100038563 255
29 3300030731 Ga0316177_1086545 Ga0316177_10865452 255
30 3300030732 Ga0316176_1102297 Ga0316176_110229711 255
31 3300030742 Ga0316183_1003890 Ga0316183_100389018 255
32 3300030744 Ga0316181_1187430 Ga0316181_11874302 255
33 3300037466 Ga0395898_0157793 Ga0395898_0157793_1234_2010 256
34 3300050496 nmdc:mga07m45_250914_c1 nmdc:mga07m45_250914_c1_100_882 256
35 iso_pu_bacteria 2852623160 2852626693 256
36 iso_pu_bacteria 2884933994 2884935123 256
37 iso_pu_bacteria 2919437846 2919439756 256
38 iso_pu_bacteria 2977232053 2977234469 256
39 3300001979 JGI24740J21852_10028752 JGI24740J21852_100287521 258
40 3300001990 JGI24737J22298_10001647 JGI24737J22298_100016472 258
41 3300002067 JGI24735J21928_10003440 JGI24735J21928_100034402 258
42 3300003316 rootH1_10116130 rootH1_101161301 258
43 3300005339 Ga0070660_100090733 Ga0070660_1000907332 258
44 3300005366 Ga0070659_100029764 Ga0070659_1000297642 258
45 3300005539 Ga0068853_100066440 Ga0068853_1000664402 258
46 3300005577 Ga0068857_100003153 Ga0068857_10000315310 258
47 3300009093 Ga0105240_10747570 Ga0105240_107475702 258
48 3300009545 Ga0105237_10601179 Ga0105237_106011791 258
49 3300010375 Ga0105239_10044049 Ga0105239_100440491 258
50 3300013100 Ga0157373_10007230 Ga0157373_100072303 258
51 3300013102 Ga0157371_10000121 Ga0157371_1000012135 258
52 3300013104 Ga0157370_10013250 Ga0157370_100132505 258
53 3300013307 Ga0157372_10000075 Ga0157372_1000007522 258
54 3300013307 Ga0157372_10607566 Ga0157372_106075662 258
55 3300025261 Ga0209233_1001377 Ga0209233_10013778 258
56 3300025904 Ga0207647_10001699 Ga0207647_100016998 258
57 3300025909 Ga0207705_10603765 Ga0207705_106037651 258
58 3300025913 Ga0207695_10555815 Ga0207695_105558151 258
59 3300025919 Ga0207657_10054143 Ga0207657_100541433 258
60 3300026116 Ga0207674_10006576 Ga0207674_1000657610 258
61 3300035115 Ga0373941_0001528 Ga0373941_0001528_3258_4034 258
62 3300037312 Ga0395899_0000034 Ga0395899_0000034_136194_136970 258
63 3300037418 Ga0395900_0000523 Ga0395900_0000523_21018_21794 258
64 3300037418 Ga0395900_0282951 Ga0395900_0282951_223_999 258
65 3300047472 Ga0495686_0003879 Ga0495686_0003879_5147_5923 258
66 3300053080 Ga0500635_0001622 Ga0500635_0001622_1075_1851 258
67 3300001990 JGI24737J22298_10027593 JGI24737J22298_100275932 259
68 3300003320 rootH2_10004419 rootH2_1000441931 259
69 3300005288 Ga0065714_10007943 Ga0065714_100079433 259
70 3300005288 Ga0065714_10018417 Ga0065714_100184172 259
71 3300005327 Ga0070658_10155213 Ga0070658_101552132 259
72 3300005327 Ga0070658_10208575 Ga0070658_102085752 259
73 3300005328 Ga0070676_10006402 Ga0070676_100064022 259
74 3300005336 Ga0070680_100047212 Ga0070680_1000472122 259
75 3300005339 Ga0070660_100012437 Ga0070660_1000124374 259
76 3300005339 Ga0070660_100142187 Ga0070660_1001421872 259
77 3300005355 Ga0070671_100076051 Ga0070671_1000760513 259
78 3300005364 Ga0070673_100024422 Ga0070673_1000244222 259
79 3300005366 Ga0070659_100000076 Ga0070659_10000007630 259
80 3300005457 Ga0070662_100000186 Ga0070662_10000018630 259
81 3300005459 Ga0068867_100002700 Ga0068867_1000027004 259
82 3300005539 Ga0068853_100128346 Ga0068853_1001283461 259
83 3300005539 Ga0068853_100140811 Ga0068853_1001408112 259
84 3300005543 Ga0070672_100407395 Ga0070672_1004073952 259
85 3300005548 Ga0070665_100000017 Ga0070665_100000017167 259
86 3300005563 Ga0068855_100000033 Ga0068855_1000000336 259
87 3300005563 Ga0068855_100082425 Ga0068855_1000824252 259
88 3300005563 Ga0068855_100165701 Ga0068855_1001657014 259
89 3300005616 Ga0068852_100000477 Ga0068852_10000047722 259
90 3300005842 Ga0068858_100194800 Ga0068858_1001948003 259
91 3300006195 Ga0075366_10001994 Ga0075366_100019942 259
92 3300006237 Ga0097621_100079841 Ga0097621_1000798412 259
93 3300006358 Ga0068871_100000286 Ga0068871_10000028634 259
94 3300006881 Ga0068865_100261820 Ga0068865_1002618202 259
95 3300009093 Ga0105240_10083896 Ga0105240_100838963 259
96 3300009093 Ga0105240_10272498 Ga0105240_102724982 259
97 3300009093 Ga0105240_10521190 Ga0105240_105211902 259
98 3300009093 Ga0105240_10930389 Ga0105240_109303891 259
99 3300009098 Ga0105245_10181456 Ga0105245_101814562 259
100 3300009174 Ga0105241_10003969 Ga0105241_100039697 259
101 3300009174 Ga0105241_10007967 Ga0105241_100079676 259
102 3300009176 Ga0105242_10601443 Ga0105242_106014432 259
103 3300009545 Ga0105237_10005528 Ga0105237_1000552812 259
104 3300009545 Ga0105237_10030627 Ga0105237_100306272 259
105 3300009551 Ga0105238_10009449 Ga0105238_100094494 259
106 3300010375 Ga0105239_10088697 Ga0105239_100886973 259
107 3300010375 Ga0105239_10293554 Ga0105239_102935542 259
108 3300013100 Ga0157373_10005072 Ga0157373_100050726 259
109 3300013105 Ga0157369_10203380 Ga0157369_102033802 259
110 3300013296 Ga0157374_10000907 Ga0157374_1000090717 259
111 3300013296 Ga0157374_10005978 Ga0157374_100059782 259
112 3300013296 Ga0157374_10233075 Ga0157374_102330751 259
113 3300013296 Ga0157374_10482350 Ga0157374_104823502 259
114 3300013306 Ga0163162_10000051 Ga0163162_10000051119 259
115 3300013307 Ga0157372_10095527 Ga0157372_100955273 259
116 3300013307 Ga0157372_10457777 Ga0157372_104577772 259
117 3300013308 Ga0157375_10499707 Ga0157375_104997071 259
118 3300025899 Ga0207642_10052681 Ga0207642_100526812 259
119 3300025904 Ga0207647_10000036 Ga0207647_1000003647 259
120 3300025907 Ga0207645_10077757 Ga0207645_100777572 259
121 3300025909 Ga0207705_10099354 Ga0207705_100993542 259
122 3300025911 Ga0207654_10003367 Ga0207654_100033675 259
123 3300025911 Ga0207654_10006638 Ga0207654_100066384 259
124 3300025912 Ga0207707_10087926 Ga0207707_100879262 259
125 3300025913 Ga0207695_10007163 Ga0207695_100071632 259
126 3300025913 Ga0207695_10067960 Ga0207695_100679605 259
127 3300025914 Ga0207671_10003264 Ga0207671_100032642 259
128 3300025914 Ga0207671_10013362 Ga0207671_100133625 259
129 3300025919 Ga0207657_10058920 Ga0207657_100589202 259
130 3300025919 Ga0207657_10079358 Ga0207657_100793583 259
131 3300025921 Ga0207652_10014722 Ga0207652_100147225 259
132 3300025924 Ga0207694_10036225 Ga0207694_100362253 259
133 3300025927 Ga0207687_10035120 Ga0207687_100351203 259
134 3300025931 Ga0207644_10058278 Ga0207644_100582782 259
135 3300025932 Ga0207690_10000049 Ga0207690_1000004927 259
136 3300025933 Ga0207706_10000125 Ga0207706_1000012528 259
137 3300025938 Ga0207704_10000043 Ga0207704_1000004375 259
138 3300025949 Ga0207667_10000046 Ga0207667_1000004685 259
139 3300025949 Ga0207667_10001087 Ga0207667_100010872 259
140 3300025949 Ga0207667_10141869 Ga0207667_101418693 259
141 3300025949 Ga0207667_10267190 Ga0207667_102671902 259
142 3300025949 Ga0207667_10828716 Ga0207667_108287161 259
143 3300025960 Ga0207651_10190490 Ga0207651_101904902 259
144 3300026023 Ga0207677_10009563 Ga0207677_100095635 259
145 3300026035 Ga0207703_10178029 Ga0207703_101780291 259
146 3300026089 Ga0207648_10000961 Ga0207648_100009611 259
147 3300026142 Ga0207698_10013089 Ga0207698_100130892 259
148 3300028379 Ga0268266_10000037 Ga0268266_10000037150 259
149 3300028786 Ga0307517_10001881 Ga0307517_1000188130 259
150 3300033180 Ga0307510_10000149 Ga0307510_1000014938 259
151 3300037312 Ga0395899_0000999 Ga0395899_0000999_13110_13889 259
152 3300037418 Ga0395900_0010424 Ga0395900_0010424_4077_4856 259
153 3300037466 Ga0395898_0077573 Ga0395898_0077573_1646_2425 259
154 3300037471 Ga0395905_0059840 Ga0395905_0059840_1972_2751 259
155 3300038443 Ga0395901_0037889 Ga0395901_0037889_3608_4387 259
156 3300041452 Ga0451793_1069912 Ga0451793_1069912_154_933 259
157 3300042005 Ga0439448_0001769 Ga0439448_0001769_2914_3693 259
158 3300045049 Ga0466959_0058351 Ga0466959_0058351_1250_2029 259
159 3300046471 Ga0495650_0027203 Ga0495650_0027203_1305_2087 259
160 3300046500 Ga0495596_0005458 Ga0495596_0005458_1326_2105 259
161 3300046518 Ga0495631_0007261 Ga0495631_0007261_2220_2999 259
162 3300046524 Ga0495648_0019092 Ga0495648_0019092_1965_2744 259
163 3300046660 Ga0495625_0047902 Ga0495625_0047902_2015_2794 259
164 3300046694 Ga0495649_0214446 Ga0495649_0214446_131_910 259
165 3300047443 Ga0495687_005184 Ga0495687_005184_6324_7103 259
166 3300049459 Ga0495678_031139 Ga0495678_031139_798_1577 259
167 3300050493 nmdc:mga0k408_323_c1 nmdc:mga0k408_323_c1_24855_25634 259
168 3300053122 Ga0500608_001665 Ga0500608_001665_6280_7059 259
169 3300053156 Ga0500622_0006204 Ga0500622_0006204_3852_4631 259
170 iso_pu_bacteria 2599185184 2599479847 259
171 iso_pu_bacteria 2928078545 2928080977 259
172 iso_pu_bacteria 2928147474 2928152607 259
173 iso_pu_bacteria 2932082852 2932087344 259
174 3300002737 JGI25162J39368_1000008 JGI25162J39368_1000008402 260
175 3300002737 JGI25162J39368_1000097 JGI25162J39368_100009757 260
176 3300005614 Ga0068856_100195293 Ga0068856_1001952932 260
177 3300006186 Ga0075369_10173081 Ga0075369_101730812 260
178 3300009093 Ga0105240_10042543 Ga0105240_100425435 260
179 3300009093 Ga0105240_10308042 Ga0105240_103080421 260
180 3300009093 Ga0105240_10444983 Ga0105240_104449832 260
181 3300009176 Ga0105242_10123536 Ga0105242_101235361 260
182 3300010375 Ga0105239_10000821 Ga0105239_1000082126 260
183 3300010375 Ga0105239_10022087 Ga0105239_100220877 260
184 3300013306 Ga0163162_10006492 Ga0163162_1000649211 260
185 3300017792 Ga0163161_10050827 Ga0163161_100508272 260
186 3300025233 Ga0209437_100030 Ga0209437_10003047 260
187 3300025913 Ga0207695_10018287 Ga0207695_100182874 260
188 3300025913 Ga0207695_10289691 Ga0207695_102896911 260
189 3300025913 Ga0207695_10294962 Ga0207695_102949621 260
190 3300025981 Ga0207640_10043496 Ga0207640_100434962 260
191 3300026078 Ga0207702_10085834 Ga0207702_100858342 260
192 3300028794 Ga0307515_10145561 Ga0307515_101455611 260
193 3300031507 Ga0307509_10196238 Ga0307509_101962382 260
194 3300046501 Ga0495607_0126450 Ga0495607_0126450_342_1124 260
195 3300046506 Ga0495583_0137132 Ga0495583_0137132_56_838 260
196 3300046558 Ga0495633_0000072 Ga0495633_0000072_102086_102868 260
197 3300046616 Ga0495668_0000009 Ga0495668_0000009_10336_11118 260
198 3300046660 Ga0495625_0019611 Ga0495625_0019611_938_1720 260
199 3300053130 Ga0500642_0016489 Ga0500642_0016489_1669_2451 260
200 3300053157 Ga0500624_000688 Ga0500624_000688_2308_3090 260
201 3300002741 JGI25157J39369_1007634 JGI25157J39369_10076342 261
202 3300003320 rootH2_10027438 rootH2_100274383 261
203 3300005327 Ga0070658_10468962 Ga0070658_104689621 261
204 3300005614 Ga0068856_100001331 Ga0068856_10000133121 261
205 3300005614 Ga0068856_100003123 Ga0068856_1000031234 261
206 3300005614 Ga0068856_100544993 Ga0068856_1005449931 261
207 3300005616 Ga0068852_100088612 Ga0068852_1000886123 261
208 3300006195 Ga0075366_10000325 Ga0075366_100003257 261
209 3300009093 Ga0105240_10000277 Ga0105240_100002772 261
210 3300009093 Ga0105240_10701359 Ga0105240_107013592 261
211 3300009174 Ga0105241_10038428 Ga0105241_100384283 261
212 3300009174 Ga0105241_10598241 Ga0105241_105982411 261
213 3300009545 Ga0105237_10001295 Ga0105237_1000129529 261
214 3300009545 Ga0105237_10113238 Ga0105237_101132382 261
215 3300010375 Ga0105239_10000026 Ga0105239_100000262 261
216 3300010375 Ga0105239_10001174 Ga0105239_1000117423 261
217 3300010375 Ga0105239_10012043 Ga0105239_100120432 261
218 3300013100 Ga0157373_10000254 Ga0157373_1000025425 261
219 3300013296 Ga0157374_10485626 Ga0157374_104856262 261
220 3300013297 Ga0157378_10294494 Ga0157378_102944941 261
221 3300013307 Ga0157372_10007570 Ga0157372_100075705 261
222 3300025250 Ga0209026_1000243 Ga0209026_100024340 261
223 3300025250 Ga0209026_1001098 Ga0209026_100109813 261
224 3300025261 Ga0209233_1019799 Ga0209233_10197991 261
225 3300025272 Ga0209455_1005189 Ga0209455_10051892 261
226 3300025909 Ga0207705_10131924 Ga0207705_101319242 261
227 3300025911 Ga0207654_10020216 Ga0207654_100202162 261
228 3300025913 Ga0207695_10000375 Ga0207695_100003752 261
229 3300025913 Ga0207695_10019425 Ga0207695_100194257 261
230 3300025914 Ga0207671_10001112 Ga0207671_100011123 261
231 3300025914 Ga0207671_10064377 Ga0207671_100643772 261
232 3300025914 Ga0207671_10123786 Ga0207671_101237862 261
233 3300026041 Ga0207639_10181476 Ga0207639_101814762 261
234 3300026078 Ga0207702_10000184 Ga0207702_1000018466 261
235 3300026078 Ga0207702_10038507 Ga0207702_100385074 261
236 3300028794 Ga0307515_10184483 Ga0307515_101844832 261
237 3300028800 Ga0265338_10140907 Ga0265338_101409071 261
238 3300033179 Ga0307507_10000034 Ga0307507_10000034143 261
239 3300037312 Ga0395899_0003043 Ga0395899_0003043_3834_4625 261
240 3300037471 Ga0395905_0000579 Ga0395905_0000579_12398_13189 261
241 3300038443 Ga0395901_0001854 Ga0395901_0001854_18970_19761 261
242 3300046507 Ga0495606_0026586 Ga0495606_0026586_1513_2298 261
243 3300046507 Ga0495606_0037216 Ga0495606_0037216_2464_3249 261
244 3300046648 Ga0495611_0111214 Ga0495611_0111214_175_960 261
245 3300046660 Ga0495625_0001804 Ga0495625_0001804_12854_13639 261
246 3300046660 Ga0495625_0095196 Ga0495625_0095196_1239_2024 261
247 3300046665 Ga0495661_0229927 Ga0495661_0229927_77_862 261
248 3300047445 Ga0495677_0042265 Ga0495677_0042265_496_1281 261
249 3300047472 Ga0495686_0000490 Ga0495686_0000490_31159_31944 261
250 3300050493 nmdc:mga0k408_296_c1 nmdc:mga0k408_296_c1_22958_23743 261
251 3300001915 JGI24741J21665_1010957 JGI24741J21665_10109572 263
252 3300001989 JGI24739J22299_10014096 JGI24739J22299_100140961 263
253 3300001990 JGI24737J22298_10000677 JGI24737J22298_100006772 263
254 3300002067 JGI24735J21928_10000007 JGI24735J21928_10000007114 263
255 3300003316 rootH1_10042091 rootH1_100420917 263
256 3300003322 rootL2_10145639 rootL2_101456392 263
257 3300003323 rootH1_10065749 rootH1_100657492 263
258 3300005563 Ga0068855_100031030 Ga0068855_1000310302 263
259 3300006195 Ga0075366_10006432 Ga0075366_100064322 263
260 3300006353 Ga0075370_10148805 Ga0075370_101488052 263
261 3300010375 Ga0105239_10159386 Ga0105239_101593863 263
262 3300013102 Ga0157371_10011466 Ga0157371_100114664 263
263 3300013105 Ga0157369_10000772 Ga0157369_1000077223 263
264 3300013105 Ga0157369_10059779 Ga0157369_100597795 263
265 3300013306 Ga0163162_10005275 Ga0163162_100052751 263
266 3300013307 Ga0157372_10000009 Ga0157372_10000009139 263
267 3300013307 Ga0157372_10008881 Ga0157372_100088816 263
268 3300025904 Ga0207647_10014496 Ga0207647_100144962 263
269 3300026116 Ga0207674_10235067 Ga0207674_102350672 263
270 3300037312 Ga0395899_0000220 Ga0395899_0000220_2041_2832 263
271 3300037418 Ga0395900_0256715 Ga0395900_0256715_504_1295 263
272 3300044684 Ga0466966_0237706 Ga0466966_0237706_290_1081 263
273 3300044693 Ga0466961_0004455 Ga0466961_0004455_457_1248 263
274 3300045049 Ga0466959_0139962 Ga0466959_0139962_218_1009 263
275 3300045836 Ga0466958_0014198 Ga0466958_0014198_1104_1895 263
276 3300046460 Ga0495638_0061903 Ga0495638_0061903_674_1465 263
277 3300046471 Ga0495650_0000268 Ga0495650_0000268_62205_62996 263
278 3300046492 Ga0495585_0000034 Ga0495585_0000034_134385_135176 263
279 3300046507 Ga0495606_0000450 Ga0495606_0000450_34598_35389 263
280 3300046507 Ga0495606_0005978 Ga0495606_0005978_10414_11205 263
281 3300046512 Ga0495610_0003230 Ga0495610_0003230_8996_9787 263
282 3300046513 Ga0495616_0003747 Ga0495616_0003747_1357_2148 263
283 3300046519 Ga0495632_0045983 Ga0495632_0045983_462_1253 263
284 3300046520 Ga0495637_0021632 Ga0495637_0021632_1160_1951 263
285 3300046558 Ga0495633_0002781 Ga0495633_0002781_9894_10685 263
286 3300046660 Ga0495625_0000007 Ga0495625_0000007_391785_392576 263
287 3300046665 Ga0495661_0012016 Ga0495661_0012016_373_1164 263
288 3300046694 Ga0495649_0000007 Ga0495649_0000007_44906_45697 263
289 3300046810 Ga0495660_0010425 Ga0495660_0010425_711_1502 263
290 3300047323 Ga0495683_0030988 Ga0495683_0030988_86_877 263
291 3300047443 Ga0495687_005410 Ga0495687_005410_2606_3397 263
292 3300047469 Ga0495673_0057262 Ga0495673_0057262_520_1311 263
293 3300050493 nmdc:mga0k408_32313_c1 nmdc:mga0k408_32313_c1_1816_2607 263
294 3300053125 Ga0500618_019343 Ga0500618_019343_287_1078 263

Structural Annotation

Top 5 Hits

ID Description Score Start End
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.6885 93 250
6e7k-assembly2.cif.gz_D structure of the lipoprotein lipase gpihbp1 complex that mediates plasma triglyceride hydrolysis 0.6818 137 179
2wdq-assembly3.cif.gz_H e. coli succinate:quinone oxidoreductase (sqr) with carboxin bound 0.68 106 255
2wu5-assembly1.cif.gz_H crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhd his71met mutant 0.6742 106 255
2acz-assembly1.cif.gz_D complex ii (succinate dehydrogenase) from e. coli with atpenin a5 inhibitor co-crystallized at the ubiquinone binding site 0.6574 93 250
ID Description Score Start End Superfamily
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7441 106 250 1.20.1300.10
af_Q2FZC9_1_204_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7308 1 254 1.20.1300.10
af_Q2FZC9_1_204_1.20.1300.10 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7184 1 254 1.20.1300.10
2ws3H00 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.7063 106 255 1.20.1300.10
2aczD01 Mainly Alpha;Up-down Bundle;3 helical TM bundles of succinate and fumarate reductases;Fumarate reductase/succinate dehydrogenase, transmembrane subunit 0.6899 106 250 1.20.1300.10
ID Description Score Start End GO Terms
AF-A0A556MTI2-F1-model_v4 Succinate dehydrogenase cytochrome b subunit 0.8951 1 260 GO:0016020
AF-A0A556MTI2-F1-model_v4 Succinate dehydrogenase cytochrome b subunit 0.8886 1 260 GO:0016020
AF-A0A257ISH7-F1-model_v4 Succinate dehydrogenase 0.8654 1 255 GO:0016020
AF-A0A258KUH8-F1-model_v4 Succinate dehydrogenase 0.8613 110 256 GO:0016020
AF-A0A1T5FRV3-F1-model_v4 Succinate dehydrogenase / fumarate reductase cytochrome b subunit 0.8596 2 258 GO:0016020

Feature Viewer

pLDDT pTM Quality
87.09 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map