F391303

General Info

Members Datasets Scaffolds Average Seq Length
293 180 586 122

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10043191|Ga0065712_100431912
Length 130
Sequence MTIKLKMKLFTVEEANEALTDVAPRLRKILRLYAEIGELRESANAAAXASNFGGGMIGGSNYVEALYNVGKLTTELNDEGVQLKDYTRGLIDFPSMRDDRVVLLCWQLGEPEHIEWWHEVEAGFGGRQPL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
145 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
152 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
153 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
154 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
155 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
156 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
157 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
158 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
159 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
160 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
161 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
162 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
163 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
164 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
165 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
166 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
167 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
168 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
169 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
170 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
171 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
172 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
173 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
174 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
175 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.68
Nodule 0
Rhizoplane 1.37
Rhizosphere 96.93
Stem 0
Stem Tuber 0
Unclassified 34.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10043191 3300005290 Bacteria 866
2 MBSR1b_contig_5830832 2162886012 Bacteria 818
3 LJQas_1001122 3300000549 Bacteria 4058
4 JGI25406J46586_10002315 3300003203 Bacteria 8996
5 rootL2_10274651 3300003322 Bacteria 1185
6 Ga0065704_10158147 3300005289 Bacteria 1367
7 Ga0070658_10074737 3300005327 Unclassified 2779
8 Ga0070676_10086704 3300005328 Unclassified 1910
9 Ga0070676_10696628 3300005328 Unclassified 741
10 Ga0070683_100310202 3300005329 Unclassified 1501
11 Ga0070683_101284545 3300005329 Unclassified 703
12 Ga0070670_100244146 3300005331 Unclassified 1564
13 Ga0070670_100285484 3300005331 Bacteria 1441
14 Ga0070670_100625433 3300005331 Unclassified 964
15 Ga0070670_101180896 3300005331 Bacteria 699
16 Ga0070677_10061826 3300005333 Unclassified 1547
17 Ga0068869_100338343 3300005334 Bacteria 1224
18 Ga0068869_100427411 3300005334 Unclassified 1094
19 Ga0070666_10027943 3300005335 Bacteria 3699
20 Ga0070680_100178117 3300005336 Bacteria 1790
21 Ga0070682_100154241 3300005337 Bacteria 1579
22 Ga0068868_100006213 3300005338 Bacteria 8449
23 Ga0070689_100013711 3300005340 Bacteria 5871
24 Ga0070689_100031764 3300005340 Bacteria 4013
25 Ga0070689_100532074 3300005340 Bacteria 1010
26 Ga0070687_100182088 3300005343 Bacteria 1259
27 Ga0070661_100278705 3300005344 Bacteria 1296
28 Ga0070661_101370831 3300005344 Unclassified 594
29 Ga0070668_100010711 3300005347 Bacteria 6818
30 Ga0070669_100717429 3300005353 Bacteria 845
31 Ga0070669_101062367 3300005353 Unclassified 696
32 Ga0070675_100200227 3300005354 Unclassified 1733
33 Ga0070675_100259209 3300005354 Bacteria 1523
34 Ga0070675_101171168 3300005354 Unclassified 707
35 Ga0070671_100009010 3300005355 Bacteria 8009
36 Ga0070674_100002173 3300005356 Bacteria 10783
37 Ga0070674_100193819 3300005356 Unclassified 1565
38 Ga0070673_101829920 3300005364 Bacteria 575
39 Ga0070673_102310875 3300005364 Unclassified 511
40 Ga0070688_100287157 3300005365 Unclassified 1184
41 Ga0070667_100030490 3300005367 Bacteria 4498
42 Ga0070701_10802837 3300005438 Unclassified 642
43 Ga0070708_100615850 3300005445 Bacteria 1023
44 Ga0070663_100032066 3300005455 Bacteria 3618
45 Ga0070678_100375344 3300005456 Unclassified 1229
46 Ga0070662_100137674 3300005457 Bacteria 1889
47 Ga0070681_10063017 3300005458 Unclassified 3680
48 Ga0068867_100222699 3300005459 Bacteria 1521
49 Ga0070685_10306924 3300005466 Bacteria 1071
50 Ga0070685_10522032 3300005466 Unclassified 843
51 Ga0070706_100184375 3300005467 Unclassified 1949
52 Ga0070698_100477612 3300005471 Unclassified 1183
53 Ga0070679_100382791 3300005530 Bacteria 1353
54 Ga0068853_100242847 3300005539 Bacteria 1651
55 Ga0068853_100389359 3300005539 Unclassified 1303
56 Ga0068853_100841878 3300005539 Bacteria 879
57 Ga0070672_100682962 3300005543 Unclassified 898
58 Ga0070672_100705583 3300005543 Bacteria 884
59 Ga0070686_100302560 3300005544 Bacteria 1186
60 Ga0070686_100836677 3300005544 Unclassified 744
61 Ga0070686_100843998 3300005544 Unclassified 741
62 Ga0070693_100210459 3300005547 Bacteria 1268
63 Ga0070665_102453087 3300005548 Unclassified 523
64 Ga0070704_100007280 3300005549 Bacteria 6582
65 Ga0070664_100026657 3300005564 Bacteria 4796
66 Ga0070664_100284655 3300005564 Bacteria 1491
67 Ga0070664_100478879 3300005564 Bacteria 1145
68 Ga0068857_100674765 3300005577 Bacteria 981
69 Ga0068857_101031239 3300005577 Unclassified 793
70 Ga0070702_100027029 3300005615 Bacteria 3092
71 Ga0068852_100044530 3300005616 Bacteria 3769
72 Ga0068852_100109011 3300005616 Bacteria 2514
73 Ga0068859_100010974 3300005617 Bacteria 9116
74 Ga0068859_100015136 3300005617 Bacteria 7742
75 Ga0068864_100013672 3300005618 Bacteria 6730
76 Ga0068864_100265622 3300005618 Unclassified 1597
77 Ga0068864_100534637 3300005618 Unclassified 1131
78 Ga0068864_100736175 3300005618 Bacteria 965
79 Ga0068861_100489159 3300005719 Bacteria 1110
80 Ga0068861_102158851 3300005719 Unclassified 557
81 Ga0068851_10022691 3300005834 Bacteria 3061
82 Ga0068870_10033066 3300005840 Bacteria 2636
83 Ga0068870_10203301 3300005840 Bacteria 1202
84 Ga0068863_100055377 3300005841 Bacteria 3756
85 Ga0068863_100090982 3300005841 Unclassified 2893
86 Ga0068862_100497220 3300005844 Bacteria 1157
87 Ga0081539_10000073 3300005985 Bacteria 231470
88 Ga0070715_10000081 3300006163 Bacteria 26482
89 Ga0097621_100100237 3300006237 Unclassified 2436
90 Ga0068871_100061323 3300006358 Bacteria 3071
91 Ga0075429_101114959 3300006880 Bacteria 689
92 Ga0068865_100026436 3300006881 Unclassified 3827
93 Ga0097620_100010974 3300006931 Bacteria 9116
94 Ga0097620_100015138 3300006931 Bacteria 7742
95 Ga0105240_10361045 3300009093 Unclassified 1645
96 Ga0111539_10056292 3300009094 Unclassified 4674
97 Ga0105247_10016777 3300009101 Bacteria 4391
98 Ga0114129_11556722 3300009147 Bacteria 811
99 Ga0114129_12072410 3300009147 Unclassified 687
100 Ga0105248_10537909 3300009177 Unclassified 1318
101 Ga0105249_10000082 3300009553 Bacteria 137479
102 Ga0105249_10095528 3300009553 Unclassified 2787
103 Ga0105249_10345004 3300009553 Bacteria 1507
104 Ga0105249_10738529 3300009553 Bacteria 1046
105 Ga0105239_11659805 3300010375 Unclassified 739
106 Ga0157373_10586457 3300013100 Unclassified 811
107 Ga0157371_10304010 3300013102 Bacteria 1155
108 Ga0157370_10392618 3300013104 Unclassified 1278
109 Ga0157369_10287678 3300013105 Bacteria 1711
110 Ga0157374_10113281 3300013296 Unclassified 2610
111 Ga0157378_11937979 3300013297 Unclassified 639
112 Ga0163162_10000002 3300013306 Bacteria 717331
113 Ga0163162_10034315 3300013306 Bacteria 5049
114 Ga0163162_10108488 3300013306 Bacteria 2872
115 Ga0163162_10232239 3300013306 Bacteria 1975
116 Ga0163162_10650525 3300013306 Bacteria 1178
117 Ga0157372_10175445 3300013307 Bacteria 2481
118 Ga0157372_11549883 3300013307 Unclassified 763
119 Ga0157375_10069968 3300013308 Bacteria 3517
120 Ga0157375_10300593 3300013308 Bacteria 1768
121 Ga0157375_11165037 3300013308 Unclassified 903
122 Ga0157375_13799887 3300013308 Unclassified 501
123 Ga0163163_10035895 3300014325 Bacteria 4813
124 Ga0163163_10145557 3300014325 Bacteria 2413
125 Ga0163163_10444595 3300014325 Bacteria 1356
126 Ga0163163_10703375 3300014325 Bacteria 1074
127 Ga0157380_10018181 3300014326 Bacteria 5216
128 Ga0157380_10062976 3300014326 Bacteria 2973
129 Ga0157380_10941875 3300014326 Bacteria 893
130 Ga0157380_11430023 3300014326 Unclassified 743
131 Ga0157377_10179148 3300014745 Bacteria 1331
132 Ga0157379_10015222 3300014968 Bacteria 6745
133 Ga0157376_10043588 3300014969 Bacteria 3683
134 Ga0163161_10008646 3300017792 Bacteria 7039
135 Ga0207656_10311801 3300025321 Unclassified 780
136 Ga0207682_10432999 3300025893 Unclassified 622
137 Ga0207710_10078757 3300025900 Bacteria 1525
138 Ga0207685_10000023 3300025905 Bacteria 115280
139 Ga0207705_10123336 3300025909 Unclassified 1924
140 Ga0207684_10171987 3300025910 Unclassified 1867
141 Ga0207707_10273948 3300025912 Bacteria 1462
142 Ga0207660_10703043 3300025917 Unclassified 824
143 Ga0207662_10065551 3300025918 Bacteria 2187
144 Ga0207649_10093270 3300025920 Bacteria 1975
145 Ga0207652_11465021 3300025921 Bacteria 586
146 Ga0207646_10194872 3300025922 Bacteria 1830
147 Ga0207650_10088125 3300025925 Bacteria 2366
148 Ga0207659_10107723 3300025926 Unclassified 2113
149 Ga0207644_10227417 3300025931 Unclassified 1481
150 Ga0207644_11229922 3300025931 Unclassified 629
151 Ga0207686_10063425 3300025934 Bacteria 2350
152 Ga0207670_10014397 3300025936 Unclassified 4694
153 Ga0207670_10036802 3300025936 Bacteria 3186
154 Ga0207670_10083393 3300025936 Bacteria 2242
155 Ga0207670_11180391 3300025936 Bacteria 647
156 Ga0207669_10359756 3300025937 Unclassified 1127
157 Ga0207704_10484015 3300025938 Unclassified 994
158 Ga0207691_10063654 3300025940 Bacteria 3344
159 Ga0207691_10843694 3300025940 Bacteria 769
160 Ga0207711_10001730 3300025941 Bacteria 20037
161 Ga0207689_10724586 3300025942 Bacteria 839
162 Ga0207679_10581584 3300025945 Bacteria 1007
163 Ga0207667_10233239 3300025949 Bacteria 1884
164 Ga0207712_10000075 3300025961 Bacteria 120693
165 Ga0207712_11099319 3300025961 Bacteria 708
166 Ga0207712_11322718 3300025961 Unclassified 644
167 Ga0207668_10094155 3300025972 Bacteria 2208
168 Ga0207658_10130465 3300025986 Bacteria 2018
169 Ga0207677_10008072 3300026023 Bacteria 5860
170 Ga0207703_10004879 3300026035 Bacteria 10907
171 Ga0207639_10001530 3300026041 Bacteria 15528
172 Ga0207639_10023012 3300026041 Bacteria 4494
173 Ga0207639_10213362 3300026041 Bacteria 1663
174 Ga0207678_10093542 3300026067 Bacteria 2568
175 Ga0207702_11467874 3300026078 Unclassified 676
176 Ga0207641_10012463 3300026088 Bacteria 6969
177 Ga0207641_10758126 3300026088 Bacteria 958
178 Ga0207648_10406047 3300026089 Unclassified 1235
179 Ga0207676_10003482 3300026095 Bacteria 11141
180 Ga0207676_10764504 3300026095 Unclassified 940
181 Ga0207676_11263829 3300026095 Unclassified 732
182 Ga0207674_10240437 3300026116 Bacteria 1757
183 Ga0207674_10340469 3300026116 Bacteria 1450
184 Ga0207675_100167272 3300026118 Bacteria 2100
185 Ga0207675_100959185 3300026118 Bacteria 873
186 Ga0207675_101870839 3300026118 Unclassified 619
187 Ga0207683_10062475 3300026121 Bacteria 3280
188 Ga0207683_10140084 3300026121 Bacteria 2179
189 Ga0207698_10058605 3300026142 Bacteria 2985
190 Ga0207698_10424056 3300026142 Bacteria 1277
191 Ga0207428_10564303 3300027907 Bacteria 822
192 Ga0268266_11202692 3300028379 Bacteria 733
193 Ga0268265_10239855 3300028380 Bacteria 1599
194 Ga0268265_10565745 3300028380 Bacteria 1081
195 Ga0307408_100047090 3300031548 Bacteria 3086
196 Ga0307408_100322864 3300031548 Bacteria 1301
197 Ga0307405_10014484 3300031731 Bacteria 4241
198 Ga0307413_10000749 3300031824 Bacteria 11211
199 Ga0307413_10039458 3300031824 Unclassified 2746
200 Ga0307413_10279221 3300031824 Bacteria 1255
201 Ga0307413_10378309 3300031824 Bacteria 1102
202 Ga0307413_10467207 3300031824 Bacteria 1005
203 Ga0307413_11173090 3300031824 Unclassified 667
204 Ga0307413_11725044 3300031824 Unclassified 559
205 Ga0307410_10054830 3300031852 Bacteria 2703
206 Ga0307410_10057723 3300031852 Unclassified 2644
207 Ga0307410_10358899 3300031852 Unclassified 1167
208 Ga0307410_10362983 3300031852 Bacteria 1160
209 Ga0307410_10501252 3300031852 Bacteria 999
210 Ga0307410_10561525 3300031852 Bacteria 947
211 Ga0307410_10995735 3300031852 Bacteria 722
212 Ga0307410_11044880 3300031852 Bacteria 706
213 Ga0307406_10028829 3300031901 Bacteria 3356
214 Ga0307406_10264902 3300031901 Bacteria 1302
215 Ga0307406_10468195 3300031901 Bacteria 1015
216 Ga0307406_10941004 3300031901 Bacteria 738
217 Ga0307406_11021251 3300031901 Bacteria 710
218 Ga0307406_11093356 3300031901 Bacteria 688
219 Ga0307406_12092518 3300031901 Unclassified 507
220 Ga0307407_10070884 3300031903 Unclassified 2073
221 Ga0307407_10101967 3300031903 Bacteria 1783
222 Ga0307407_10130536 3300031903 Unclassified 1607
223 Ga0307407_10351702 3300031903 Bacteria 1044
224 Ga0307407_10566270 3300031903 Unclassified 842
225 Ga0307412_10093340 3300031911 Bacteria 2111
226 Ga0307412_11291443 3300031911 Bacteria 657
227 Ga0307412_11475909 3300031911 Bacteria 617
228 Ga0307409_100015429 3300031995 Bacteria 5015
229 Ga0307409_100047574 3300031995 Unclassified 3257
230 Ga0307409_100696707 3300031995 Bacteria 1014
231 Ga0307409_100847524 3300031995 Bacteria 925
232 Ga0307416_100005423 3300032002 Bacteria 7831
233 Ga0307416_100813302 3300032002 Unclassified 1031
234 Ga0307416_100956506 3300032002 Bacteria 958
235 Ga0307416_103575261 3300032002 Unclassified 520
236 Ga0307414_10020095 3300032004 Bacteria 4154
237 Ga0307414_10050809 3300032004 Bacteria 2874
238 Ga0307414_11311746 3300032004 Unclassified 672
239 Ga0307411_10015586 3300032005 Unclassified 4274
240 Ga0307411_10172824 3300032005 Bacteria 1631
241 Ga0307411_10193244 3300032005 Unclassified 1556
242 Ga0307411_10202035 3300032005 Unclassified 1527
243 Ga0307411_10539846 3300032005 Bacteria 993
244 Ga0307411_11248390 3300032005 Bacteria 675
245 Ga0307411_11720448 3300032005 Bacteria 581
246 Ga0307415_100008665 3300032126 Bacteria 5655
247 Ga0307415_100483571 3300032126 Unclassified 1078
248 Ga0307415_101114789 3300032126 Bacteria 739
249 Ga0307415_101237518 3300032126 Bacteria 705
250 Ga0373957_0184677 3300035120 Unclassified 865
251 Ga0373955_0682147 3300035172 Unclassified 630
252 Ga0436364_0309528 3300037853 Bacteria 1590
253 Ga0439466_0086525 3300041411 Bacteria 985
254 Ga0451853_2062671 3300041512 Unclassified 1242
255 Ga0495598_0055140 3300046537 Unclassified 1209
256 Ga0495615_0078046 3300048090 Bacteria 904
257 Ga0496100_0415936 3300048903 Bacteria 1026
258 Ga0496101_0404454 3300048904 Bacteria 1075
259 Ga0496109_0192092 3300048912 Bacteria 1919
260 Ga0496111_0211950 3300048914 Bacteria 1439
261 Ga0501072_0184289 3300049588 Bacteria 1665
262 Ga0501198_046712 3300049649 Unclassified 762
263 Ga0501217_082922 3300049661 Unclassified 890
264 Ga0501233_071223 3300049668 Unclassified 881
265 Ga0501235_006941 3300049669 Bacteria 2464
266 Ga0501239_004394 3300049672 Unclassified 1381
267 Ga0501242_030015 3300049674 Bacteria 732
268 Ga0501247_002085 3300049677 Bacteria 2042
269 Ga0501249_003212 3300049679 Bacteria 3293
270 Ga0501249_077291 3300049679 Bacteria 781
271 Ga0501250_009156 3300049680 Unclassified 1108
272 Ga0501251_011961 3300049681 Unclassified 1042
273 Ga0501256_006627 3300049685 Unclassified 1049
274 Ga0501257_011297 3300049686 Bacteria 2037
275 Ga0501258_002824 3300049687 Unclassified 1553
276 Ga0501260_019085 3300049689 Unclassified 734
277 Ga0501221_041389 3300049704 Unclassified 1006
278 Ga0501225_0016454 3300049705 Bacteria 2057
279 Ga0501225_0142460 3300049705 Bacteria 726
280 Ga0501229_008630 3300049706 Bacteria 1275
281 Ga0501245_021758 3300049708 Unclassified 1008
282 Ga0501263_005208 3300049760 Unclassified 1460
283 Ga0501266_005432 3300049763 Bacteria 1583
284 Ga0501267_001687 3300049764 Bacteria 1923
285 Ga0501268_001550 3300049765 Bacteria 2886
286 Ga0501270_002135 3300049767 Bacteria 1994
287 Ga0501271_032438 3300049768 Unclassified 651
288 Ga0501273_001899 3300049770 Bacteria 2065
289 nmdc:mga08y16_45408_c1 3300050511 Unclassified 4603
290 Ga0500651_0356428 3300053093 Bacteria 829
291 Ga0500577_0002411 3300053142 Bacteria 4776
292 Ga0501084_0266257 3300054114 Bacteria 1447
293 Ga0501082_0204549 3300060353 Bacteria 1718
294 Ga0065712_10043191
295 MBSR1b_contig_5830832
296 LJQas_1001122
297 JGI25406J46586_10002315
298 rootL2_10274651
299 Ga0065704_10158147
300 Ga0070658_10074737
301 Ga0070676_10086704
302 Ga0070676_10696628
303 Ga0070683_100310202
304 Ga0070683_101284545
305 Ga0070670_100244146
306 Ga0070670_100285484
307 Ga0070670_100625433
308 Ga0070670_101180896
309 Ga0070677_10061826
310 Ga0068869_100338343
311 Ga0068869_100427411
312 Ga0070666_10027943
313 Ga0070680_100178117
314 Ga0070682_100154241
315 Ga0068868_100006213
316 Ga0070689_100013711
317 Ga0070689_100031764
318 Ga0070689_100532074
319 Ga0070687_100182088
320 Ga0070661_100278705
321 Ga0070661_101370831
322 Ga0070668_100010711
323 Ga0070669_100717429
324 Ga0070669_101062367
325 Ga0070675_100200227
326 Ga0070675_100259209
327 Ga0070675_101171168
328 Ga0070671_100009010
329 Ga0070674_100002173
330 Ga0070674_100193819
331 Ga0070673_101829920
332 Ga0070673_102310875
333 Ga0070688_100287157
334 Ga0070667_100030490
335 Ga0070701_10802837
336 Ga0070708_100615850
337 Ga0070663_100032066
338 Ga0070678_100375344
339 Ga0070662_100137674
340 Ga0070681_10063017
341 Ga0068867_100222699
342 Ga0070685_10306924
343 Ga0070685_10522032
344 Ga0070706_100184375
345 Ga0070698_100477612
346 Ga0070679_100382791
347 Ga0068853_100242847
348 Ga0068853_100389359
349 Ga0068853_100841878
350 Ga0070672_100682962
351 Ga0070672_100705583
352 Ga0070686_100302560
353 Ga0070686_100836677
354 Ga0070686_100843998
355 Ga0070693_100210459
356 Ga0070665_102453087
357 Ga0070704_100007280
358 Ga0070664_100026657
359 Ga0070664_100284655
360 Ga0070664_100478879
361 Ga0068857_100674765
362 Ga0068857_101031239
363 Ga0070702_100027029
364 Ga0068852_100044530
365 Ga0068852_100109011
366 Ga0068859_100010974
367 Ga0068859_100015136
368 Ga0068864_100013672
369 Ga0068864_100265622
370 Ga0068864_100534637
371 Ga0068864_100736175
372 Ga0068861_100489159
373 Ga0068861_102158851
374 Ga0068851_10022691
375 Ga0068870_10033066
376 Ga0068870_10203301
377 Ga0068863_100055377
378 Ga0068863_100090982
379 Ga0068862_100497220
380 Ga0081539_10000073
381 Ga0070715_10000081
382 Ga0097621_100100237
383 Ga0068871_100061323
384 Ga0075429_101114959
385 Ga0068865_100026436
386 Ga0097620_100010974
387 Ga0097620_100015138
388 Ga0105240_10361045
389 Ga0111539_10056292
390 Ga0105247_10016777
391 Ga0114129_11556722
392 Ga0114129_12072410
393 Ga0105248_10537909
394 Ga0105249_10000082
395 Ga0105249_10095528
396 Ga0105249_10345004
397 Ga0105249_10738529
398 Ga0105239_11659805
399 Ga0157373_10586457
400 Ga0157371_10304010
401 Ga0157370_10392618
402 Ga0157369_10287678
403 Ga0157374_10113281
404 Ga0157378_11937979
405 Ga0163162_10000002
406 Ga0163162_10034315
407 Ga0163162_10108488
408 Ga0163162_10232239
409 Ga0163162_10650525
410 Ga0157372_10175445
411 Ga0157372_11549883
412 Ga0157375_10069968
413 Ga0157375_10300593
414 Ga0157375_11165037
415 Ga0157375_13799887
416 Ga0163163_10035895
417 Ga0163163_10145557
418 Ga0163163_10444595
419 Ga0163163_10703375
420 Ga0157380_10018181
421 Ga0157380_10062976
422 Ga0157380_10941875
423 Ga0157380_11430023
424 Ga0157377_10179148
425 Ga0157379_10015222
426 Ga0157376_10043588
427 Ga0163161_10008646
428 Ga0207656_10311801
429 Ga0207682_10432999
430 Ga0207710_10078757
431 Ga0207685_10000023
432 Ga0207705_10123336
433 Ga0207684_10171987
434 Ga0207707_10273948
435 Ga0207660_10703043
436 Ga0207662_10065551
437 Ga0207649_10093270
438 Ga0207652_11465021
439 Ga0207646_10194872
440 Ga0207650_10088125
441 Ga0207659_10107723
442 Ga0207644_10227417
443 Ga0207644_11229922
444 Ga0207686_10063425
445 Ga0207670_10014397
446 Ga0207670_10036802
447 Ga0207670_10083393
448 Ga0207670_11180391
449 Ga0207669_10359756
450 Ga0207704_10484015
451 Ga0207691_10063654
452 Ga0207691_10843694
453 Ga0207711_10001730
454 Ga0207689_10724586
455 Ga0207679_10581584
456 Ga0207667_10233239
457 Ga0207712_10000075
458 Ga0207712_11099319
459 Ga0207712_11322718
460 Ga0207668_10094155
461 Ga0207658_10130465
462 Ga0207677_10008072
463 Ga0207703_10004879
464 Ga0207639_10001530
465 Ga0207639_10023012
466 Ga0207639_10213362
467 Ga0207678_10093542
468 Ga0207702_11467874
469 Ga0207641_10012463
470 Ga0207641_10758126
471 Ga0207648_10406047
472 Ga0207676_10003482
473 Ga0207676_10764504
474 Ga0207676_11263829
475 Ga0207674_10240437
476 Ga0207674_10340469
477 Ga0207675_100167272
478 Ga0207675_100959185
479 Ga0207675_101870839
480 Ga0207683_10062475
481 Ga0207683_10140084
482 Ga0207698_10058605
483 Ga0207698_10424056
484 Ga0207428_10564303
485 Ga0268266_11202692
486 Ga0268265_10239855
487 Ga0268265_10565745
488 Ga0307408_100047090
489 Ga0307408_100322864
490 Ga0307405_10014484
491 Ga0307413_10000749
492 Ga0307413_10039458
493 Ga0307413_10279221
494 Ga0307413_10378309
495 Ga0307413_10467207
496 Ga0307413_11173090
497 Ga0307413_11725044
498 Ga0307410_10054830
499 Ga0307410_10057723
500 Ga0307410_10358899
501 Ga0307410_10362983
502 Ga0307410_10501252
503 Ga0307410_10561525
504 Ga0307410_10995735
505 Ga0307410_11044880
506 Ga0307406_10028829
507 Ga0307406_10264902
508 Ga0307406_10468195
509 Ga0307406_10941004
510 Ga0307406_11021251
511 Ga0307406_11093356
512 Ga0307406_12092518
513 Ga0307407_10070884
514 Ga0307407_10101967
515 Ga0307407_10130536
516 Ga0307407_10351702
517 Ga0307407_10566270
518 Ga0307412_10093340
519 Ga0307412_11291443
520 Ga0307412_11475909
521 Ga0307409_100015429
522 Ga0307409_100047574
523 Ga0307409_100696707
524 Ga0307409_100847524
525 Ga0307416_100005423
526 Ga0307416_100813302
527 Ga0307416_100956506
528 Ga0307416_103575261
529 Ga0307414_10020095
530 Ga0307414_10050809
531 Ga0307414_11311746
532 Ga0307411_10015586
533 Ga0307411_10172824
534 Ga0307411_10193244
535 Ga0307411_10202035
536 Ga0307411_10539846
537 Ga0307411_11248390
538 Ga0307411_11720448
539 Ga0307415_100008665
540 Ga0307415_100483571
541 Ga0307415_101114789
542 Ga0307415_101237518
543 Ga0373957_0184677
544 Ga0373955_0682147
545 Ga0436364_0309528
546 Ga0439466_0086525
547 Ga0451853_2062671
548 Ga0495598_0055140
549 Ga0495615_0078046
550 Ga0496100_0415936
551 Ga0496101_0404454
552 Ga0496109_0192092
553 Ga0496111_0211950
554 Ga0501072_0184289
555 Ga0501198_046712
556 Ga0501217_082922
557 Ga0501233_071223
558 Ga0501235_006941
559 Ga0501239_004394
560 Ga0501242_030015
561 Ga0501247_002085
562 Ga0501249_003212
563 Ga0501249_077291
564 Ga0501250_009156
565 Ga0501251_011961
566 Ga0501256_006627
567 Ga0501257_011297
568 Ga0501258_002824
569 Ga0501260_019085
570 Ga0501221_041389
571 Ga0501225_0016454
572 Ga0501225_0142460
573 Ga0501229_008630
574 Ga0501245_021758
575 Ga0501263_005208
576 Ga0501266_005432
577 Ga0501267_001687
578 Ga0501268_001550
579 Ga0501270_002135
580 Ga0501271_032438
581 Ga0501273_001899
582 nmdc:mga08y16_45408_c1
583 Ga0500651_0356428
584 Ga0500577_0002411
585 Ga0501084_0266257
586 Ga0501082_0204549

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09969

DUF2203

Uncharacterized conserved protein (DUF2203)

8

130

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7upo-assembly1.cif.gz_A crystal structure of designed heterotrimeric assembly dht03 0.7471 14 73
8jax-assembly1.cif.gz_A cryo-em structure of holo form of scbfr with o symmetry 0.7339 16 74
3b2e-assembly1.cif.gz_F crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain 0.7294 21 74
3b2e-assembly1.cif.gz_E crystal structure of s. cerevisiae get3 in the open conformation in complex with get1 cytosolic domain 0.724 21 74
8px9-assembly1.cif.gz_A structure of the antibacterial peptide abc transporter mcjd, solved at wavelength 2.75 a 0.7103 10 74
ID Description Score Start End Superfamily
af_C6THU9_33_162_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.7741 10 72 1.20.58.70
af_P92166_1_80_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7318 15 72 1.20.1070.10
3b2eF00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.7294 21 74 1.10.287.660
3b2eH00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.7269 21 74 1.10.287.660
3b2eE00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.724 21 74 1.10.287.660
ID Description Score Start End GO Terms
AF-A0A521PGK8-F1-model_v4 DUF2203 family protein 0.9871 57 124
AF-A0A536AUS5-F1-model_v4 DUF2203 family protein 0.9824 74 124
AF-A0A535D9P8-F1-model_v4 DUF2203 family protein 0.9657 54 124
AF-T0Y9K2-F1-model_v4 DUF2203 family protein 0.9627 54 124
AF-A0A349M567-F1-model_v4 DUF2203 domain-containing protein 0.9564 61 124

Map