F391297

General Info

Members Datasets Scaffolds Average Seq Length
293 187 291 94

Family's Representative Sequence

Representative Sequence 3300003762|Ga0055542_1020407|Ga0055542_10204072
Length 102
Sequence MSDSPVNLPAGHKAVRLRIEGRVQGVSYRMWTVAEASARGLTGWVRNRKDGSVEALVIGHSVKVDEVIELCHRGPSLARVTSVTVDPAQGIAADDFREMPTV

Samples

Sample ID Description Type Environment
1 2643221609 Acidovorax sp. Root217 Isolate Unclassified
2 2643221611 Acidovorax sp. Root219 Isolate Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
61 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
129 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
130 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
131 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
142 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
143 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
144 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
145 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
148 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 0.68
Rhizosphere 94.2
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000558 3300002738 Bacteria 18325
2 Ga0055542_1020407 3300003762 Bacteria 972
3 Ga0055529_1006692 3300003763 Bacteria 1596
4 Ga0070658_10000086 3300005327 Bacteria 86563
5 Ga0070658_10014596 3300005327 Bacteria 6304
6 Ga0070658_10062223 3300005327 Bacteria 3041
7 Ga0070658_10077413 3300005327 Bacteria 2728
8 Ga0070658_10830300 3300005327 Bacteria 803
9 Ga0070676_10037876 3300005328 Bacteria 2783
10 Ga0070676_10859773 3300005328 Bacteria 673
11 Ga0070683_102294467 3300005329 Bacteria 518
12 Ga0070670_100006970 3300005331 Bacteria 9579
13 Ga0070670_100190619 3300005331 Bacteria 1781
14 Ga0068869_100623251 3300005334 Bacteria 913
15 Ga0070680_100014665 3300005336 Bacteria 6128
16 Ga0070680_100326625 3300005336 Bacteria 1303
17 Ga0070660_100000251 3300005339 Bacteria 35247
18 Ga0070660_100569851 3300005339 Bacteria 945
19 Ga0070687_100283312 3300005343 Bacteria 1044
20 Ga0070692_10004578 3300005345 Bacteria 5788
21 Ga0070692_10722302 3300005345 Bacteria 672
22 Ga0070692_10997372 3300005345 Bacteria 585
23 Ga0070668_100008699 3300005347 Bacteria 7541
24 Ga0070668_100304207 3300005347 Bacteria 1338
25 Ga0070669_100026313 3300005353 Bacteria 4185
26 Ga0070669_100753520 3300005353 Bacteria 825
27 Ga0070675_100138224 3300005354 Bacteria 2081
28 Ga0070674_100166808 3300005356 Bacteria 1676
29 Ga0070674_100700063 3300005356 Bacteria 866
30 Ga0070673_100054465 3300005364 Bacteria 3146
31 Ga0070673_100059302 3300005364 Bacteria 3029
32 Ga0070673_100113119 3300005364 Bacteria 2254
33 Ga0070659_100117168 3300005366 Bacteria 2154
34 Ga0070714_100034688 3300005435 Bacteria 4226
35 Ga0070663_100514945 3300005455 Bacteria 995
36 Ga0070678_100743077 3300005456 Bacteria 887
37 Ga0070662_100387955 3300005457 Bacteria 1151
38 Ga0070681_10014018 3300005458 Bacteria 7977
39 Ga0068867_100364349 3300005459 Bacteria 1210
40 Ga0068867_100400170 3300005459 Bacteria 1158
41 Ga0070706_100100860 3300005467 Bacteria 2683
42 Ga0070707_100302171 3300005468 Bacteria 1555
43 Ga0070707_101886619 3300005468 Bacteria 565
44 Ga0070679_100172968 3300005530 Bacteria 2132
45 Ga0068853_100491343 3300005539 Bacteria 1158
46 Ga0068853_100656227 3300005539 Bacteria 999
47 Ga0068853_100756654 3300005539 Bacteria 929
48 Ga0070672_100620544 3300005543 Bacteria 943
49 Ga0070665_100123521 3300005548 Bacteria 2591
50 Ga0070665_100159871 3300005548 Bacteria 2255
51 Ga0068855_100496558 3300005563 Bacteria 1326
52 Ga0068855_100783519 3300005563 Bacteria 1014
53 Ga0068854_100701341 3300005578 Bacteria 874
54 Ga0068854_101615682 3300005578 Bacteria 591
55 Ga0068856_101086842 3300005614 Bacteria 817
56 Ga0068856_101313762 3300005614 Bacteria 738
57 Ga0068856_102258916 3300005614 Unclassified 552
58 Ga0068852_100053214 3300005616 Bacteria 3483
59 Ga0068852_101295000 3300005616 Bacteria 750
60 Ga0068852_101795408 3300005616 Bacteria 636
61 Ga0068864_100001133 3300005618 Bacteria 22296
62 Ga0068864_100067620 3300005618 Bacteria 3103
63 Ga0068861_100140000 3300005719 Bacteria 1974
64 Ga0068863_100044880 3300005841 Bacteria 4194
65 Ga0068863_100949849 3300005841 Bacteria 861
66 Ga0068860_100224847 3300005843 Bacteria 1823
67 Ga0068862_100030671 3300005844 Bacteria 4533
68 Ga0068862_100724938 3300005844 Bacteria 965
69 Ga0070717_10513924 3300006028 Bacteria 1083
70 Ga0070716_100406630 3300006173 Bacteria 980
71 Ga0068871_100348104 3300006358 Bacteria 1310
72 Ga0075431_100367607 3300006847 Bacteria 1444
73 Ga0075435_100022369 3300007076 Bacteria 4878
74 Ga0099794_10163519 3300007265 Bacteria 1133
75 Ga0105240_10463310 3300009093 Bacteria 1416
76 Ga0105240_11017131 3300009093 Bacteria 885
77 Ga0105240_12341061 3300009093 Bacteria 553
78 Ga0105248_10313329 3300009177 Bacteria 1767
79 Ga0105248_11038930 3300009177 Bacteria 926
80 Ga0157371_10178729 3300013102 Bacteria 1517
81 Ga0157370_10025047 3300013104 Bacteria 5906
82 Ga0157370_10115050 3300013104 Bacteria 2513
83 Ga0157370_10231228 3300013104 Bacteria 1711
84 Ga0157369_10313856 3300013105 Bacteria 1630
85 Ga0157374_10360602 3300013296 Bacteria 1445
86 Ga0157374_12838201 3300013296 Bacteria 512
87 Ga0163162_10341314 3300013306 Bacteria 1630
88 Ga0157372_10470570 3300013307 Bacteria 1465
89 Ga0157375_10034169 3300013308 Bacteria 4841
90 Ga0157375_12485371 3300013308 Bacteria 618
91 Ga0163163_10010221 3300014325 Bacteria 8427
92 Ga0157376_10082282 3300014969 Bacteria 2766
93 Ga0157376_11413820 3300014969 Bacteria 727
94 Ga0163161_10383294 3300017792 Bacteria 1124
95 Ga0213876_10000163 3300021384 Bacteria 70075
96 Ga0209437_107126 3300025233 Bacteria 1833
97 Ga0209646_1000036 3300025246 Bacteria 358864
98 Ga0209148_1001206 3300025254 Bacteria 14695
99 Ga0209455_1003190 3300025272 Bacteria 5938
100 Ga0207697_10280042 3300025315 Bacteria 739
101 Ga0207645_10116027 3300025907 Bacteria 1736
102 Ga0207705_10000002 3300025909 Bacteria 2046852
103 Ga0207705_10017355 3300025909 Bacteria 5155
104 Ga0207684_10232525 3300025910 Bacteria 1591
105 Ga0207671_10194742 3300025914 Bacteria 1581
106 Ga0207660_10020007 3300025917 Bacteria 4485
107 Ga0207662_10323860 3300025918 Bacteria 1029
108 Ga0207657_10004956 3300025919 Bacteria 14013
109 Ga0207657_10188567 3300025919 Bacteria 1665
110 Ga0207649_11639351 3300025920 Unclassified 509
111 Ga0207652_11525551 3300025921 Bacteria 572
112 Ga0207646_10120726 3300025922 Bacteria 2354
113 Ga0207650_10000838 3300025925 Bacteria 23344
114 Ga0207650_10008063 3300025925 Bacteria 7177
115 Ga0207659_10039712 3300025926 Bacteria 3285
116 Ga0207659_10245918 3300025926 Bacteria 1449
117 Ga0207690_10039018 3300025932 Bacteria 3096
118 Ga0207706_10717028 3300025933 Bacteria 854
119 Ga0207669_10620230 3300025937 Bacteria 881
120 Ga0207691_10083320 3300025940 Bacteria 2871
121 Ga0207691_10565537 3300025940 Bacteria 964
122 Ga0207711_10522734 3300025941 Bacteria 1106
123 Ga0207689_10328087 3300025942 Bacteria 1271
124 Ga0207679_10788745 3300025945 Bacteria 866
125 Ga0207667_10433281 3300025949 Bacteria 1337
126 Ga0207667_11824733 3300025949 Bacteria 572
127 Ga0207651_10391408 3300025960 Bacteria 1180
128 Ga0207668_10079398 3300025972 Bacteria 2373
129 Ga0207668_10660318 3300025972 Bacteria 916
130 Ga0207640_11419959 3300025981 Bacteria 622
131 Ga0207658_11869038 3300025986 Bacteria 547
132 Ga0207677_10061781 3300026023 Bacteria 2596
133 Ga0207639_12029182 3300026041 Unclassified 536
134 Ga0207678_10130748 3300026067 Bacteria 2141
135 Ga0207678_10495960 3300026067 Bacteria 1064
136 Ga0207702_10077267 3300026078 Bacteria 2879
137 Ga0207702_11704793 3300026078 Bacteria 623
138 Ga0207641_10005239 3300026088 Bacteria 11090
139 Ga0207648_10016444 3300026089 Bacteria 6756
140 Ga0207676_10002779 3300026095 Bacteria 12448
141 Ga0207676_10033969 3300026095 Bacteria 3859
142 Ga0207675_100233117 3300026118 Bacteria 1777
143 Ga0207683_11219574 3300026121 Bacteria 697
144 Ga0268266_11140757 3300028379 Bacteria 754
145 Ga0268265_10017460 3300028380 Bacteria 4953
146 Ga0268265_11927558 3300028380 Bacteria 598
147 Ga0268264_10177491 3300028381 Bacteria 1931
148 Ga0268264_10595124 3300028381 Bacteria 1089
149 Ga0265330_10162083 3300031235 Bacteria 949
150 Ga0265332_10105173 3300031238 Bacteria 1190
151 Ga0265328_10041540 3300031239 Bacteria 1693
152 Ga0265320_10075844 3300031240 Bacteria 1576
153 Ga0265340_10073549 3300031247 Bacteria 1617
154 Ga0265331_10321340 3300031250 Bacteria 693
155 Ga0265327_10001257 3300031251 Bacteria 33614
156 Ga0307408_100033785 3300031548 Bacteria 3576
157 Ga0307408_100266508 3300031548 Bacteria 1420
158 Ga0307408_100723928 3300031548 Bacteria 896
159 Ga0265313_10029394 3300031595 Bacteria 2843
160 Ga0265313_10354818 3300031595 Bacteria 581
161 Ga0265313_10419681 3300031595 Bacteria 523
162 Ga0265314_10104647 3300031711 Bacteria 1812
163 Ga0265314_10110060 3300031711 Bacteria 1752
164 Ga0265342_10273883 3300031712 Bacteria 895
165 Ga0307516_10213600 3300031730 Bacteria 1642
166 Ga0307405_10042849 3300031731 Bacteria 2757
167 Ga0307413_11037088 3300031824 Bacteria 705
168 Ga0307410_10597316 3300031852 Bacteria 920
169 Ga0307406_10023225 3300031901 Bacteria 3687
170 Ga0307412_10081556 3300031911 Bacteria 2237
171 Ga0307412_10499489 3300031911 Bacteria 1012
172 Ga0307416_100022132 3300032002 Bacteria 4581
173 Ga0307416_100092728 3300032002 Bacteria 2599
174 Ga0373923_0455450 3300035111 Bacteria 620
175 Ga0373925_0414685 3300037068 Bacteria 1100
176 Ga0395900_0137230 3300037418 Bacteria 2506
177 Ga0395900_1210731 3300037418 Unclassified 670
178 Ga0395898_0708236 3300037466 Unclassified 948
179 Ga0436364_0434533 3300037853 Bacteria 754
180 Ga0436365_1308256 3300039437 Bacteria 63103
181 Ga0436360_0234984 3300039438 Bacteria 1082
182 Ga0436360_0817131 3300039438 Bacteria 961
183 Ga0436363_0908743 3300039450 Unclassified 675
184 Ga0451789_1036236 3300041443 Bacteria 733
185 Ga0466972_0000140 3300044658 Bacteria 59505
186 Ga0466972_0050140 3300044658 Bacteria 2015
187 Ga0466965_0003503 3300044683 Bacteria 6890
188 Ga0466961_0227783 3300044693 Bacteria 1148
189 Ga0466964_0003532 3300044706 Bacteria 5712
190 Ga0466964_0005974 3300044706 Bacteria 4537
191 Ga0466964_0456083 3300044706 Bacteria 679
192 Ga0466968_0042589 3300044735 Bacteria 1920
193 Ga0466968_0049775 3300044735 Bacteria 1786
194 Ga0466957_0812627 3300044842 Bacteria 665
195 Ga0466960_0339921 3300044901 Bacteria 854
196 Ga0466959_0369498 3300045049 Bacteria 977
197 Ga0466967_0477480 3300045976 Bacteria 1221
198 Ga0466967_0645267 3300045976 Bacteria 1047
199 Ga0495607_0473107 3300046501 Bacteria 559
200 Ga0495606_0632670 3300046507 Bacteria 520
201 Ga0495654_0240055 3300046530 Bacteria 759
202 Ga0495668_0028554 3300046616 Bacteria 3155
203 Ga0495625_0299687 3300046660 Bacteria 1029
204 Ga0495671_0137971 3300046692 Bacteria 1189
205 Ga0495649_0009038 3300046694 Bacteria 5950
206 Ga0495649_0053562 3300046694 Bacteria 2184
207 Ga0495589_0021960 3300046794 Bacteria 3261
208 Ga0495660_0008483 3300046810 Bacteria 6019
209 Ga0495683_0410961 3300047323 Bacteria 561
210 Ga0495687_017838 3300047443 Bacteria 3525
211 Ga0495593_0414392 3300047673 Bacteria 674
212 Ga0496115_0503045 3300048918 Bacteria 973
213 Ga0501031_0021438 3300049568 Bacteria 4211
214 Ga0501031_0724094 3300049568 Bacteria 638
215 Ga0501031_0742552 3300049568 Bacteria 630
216 Ga0501032_0084935 3300049569 Bacteria 2104
217 Ga0501032_0121617 3300049569 Bacteria 1725
218 Ga0501033_0014953 3300049570 Bacteria 5890
219 Ga0501034_0041976 3300049571 Bacteria 4629
220 Ga0501034_0062166 3300049571 Bacteria 3749
221 Ga0501034_0097961 3300049571 Bacteria 2928
222 Ga0501034_0452635 3300049571 Bacteria 1201
223 Ga0501034_0602938 3300049571 Bacteria 1003
224 Ga0501034_0807395 3300049571 Bacteria 830
225 Ga0501036_0061843 3300049572 Bacteria 3171
226 Ga0501036_0430465 3300049572 Bacteria 1100
227 Ga0501036_0454277 3300049572 Bacteria 1067
228 Ga0501037_0192065 3300049573 Bacteria 1445
229 Ga0501037_0202908 3300049573 Bacteria 1400
230 Ga0501037_0305600 3300049573 Bacteria 1103
231 Ga0501037_0913401 3300049573 Bacteria 575
232 Ga0501038_0002268 3300049574 Bacteria 17879
233 Ga0501038_0335291 3300049574 Bacteria 1180
234 Ga0501038_0353254 3300049574 Bacteria 1144
235 Ga0501039_0397387 3300049575 Bacteria 1082
236 Ga0501039_0882293 3300049575 Bacteria 696
237 Ga0501040_0044636 3300049576 Bacteria 3022
238 Ga0501040_0875829 3300049576 Bacteria 650
239 Ga0501041_0105603 3300049577 Bacteria 1746
240 Ga0501042_0054057 3300049578 Bacteria 2864
241 Ga0501043_0010117 3300049579 Bacteria 7394
242 Ga0501043_0040615 3300049579 Bacteria 3656
243 Ga0501043_0228031 3300049579 Bacteria 1439
244 Ga0501043_0267703 3300049579 Bacteria 1312
245 Ga0501043_0398760 3300049579 Bacteria 1040
246 Ga0501043_0450039 3300049579 Bacteria 968
247 Ga0501046_0307352 3300049580 Bacteria 1157
248 Ga0501046_0395605 3300049580 Bacteria 999
249 Ga0501046_0914606 3300049580 Bacteria 611
250 Ga0501047_0033517 3300049581 Bacteria 4957
251 Ga0501047_0049063 3300049581 Bacteria 4076
252 Ga0501047_0072382 3300049581 Bacteria 3318
253 Ga0501047_0171600 3300049581 Bacteria 2037
254 Ga0501047_0183880 3300049581 Bacteria 1956
255 Ga0501048_0029184 3300049582 Bacteria 4001
256 Ga0501067_0121476 3300049583 Bacteria 1454
257 Ga0501069_0037876 3300049585 Bacteria 2661
258 Ga0501069_0935115 3300049585 Bacteria 528
259 Ga0501070_0033087 3300049586 Bacteria 4325
260 Ga0501070_0197884 3300049586 Bacteria 1650
261 Ga0501070_0333234 3300049586 Bacteria 1233
262 Ga0501071_0206540 3300049587 Bacteria 1476
263 Ga0501072_0061694 3300049588 Bacteria 2957
264 Ga0501073_0026778 3300049589 Bacteria 4128
265 Ga0501073_0202253 3300049589 Bacteria 1373
266 Ga0501073_0263389 3300049589 Bacteria 1189
267 Ga0501073_0583052 3300049589 Bacteria 772
268 Ga0501074_0958174 3300049590 Bacteria 602
269 Ga0501076_0131892 3300049592 Bacteria 2027
270 Ga0501077_0274530 3300049593 Bacteria 1073
271 Ga0501079_0066235 3300049741 Bacteria 2787
272 Ga0501080_0036838 3300049742 Bacteria 4566
273 Ga0501080_0074016 3300049742 Bacteria 3169
274 Ga0501080_0115933 3300049742 Bacteria 2483
275 Ga0501081_0835588 3300049743 Unclassified 694
276 Ga0501083_0046987 3300049744 Bacteria 2918
277 Ga0501083_0084887 3300049744 Bacteria 2095
278 Ga0501035_0019796 3300049822 Bacteria 6183
279 Ga0501035_0166442 3300049822 Bacteria 1906
280 Ga0501035_0495944 3300049822 Bacteria 1005
281 Ga0501044_0015357 3300049823 Bacteria 8246
282 Ga0501044_0188101 3300049823 Bacteria 2028
283 Ga0501044_0268843 3300049823 Bacteria 1641
284 Ga0501045_0576948 3300049824 Bacteria 833
285 nmdc:mga06r32_565201_c1 3300050510 Bacteria 1110
286 nmdc:mga0rr50_4373_c1 3300050513 Bacteria 8299
287 Ga0495619_0155622 3300053085 Bacteria 1577
288 Ga0500627_0122272 3300053158 Bacteria 1174
289 Ga0501084_0194021 3300054114 Bacteria 1713
290 Ga0501082_0054620 3300060353 Bacteria 3443
291 Ga0501082_0680300 3300060353 Bacteria 900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031730 Ga0307516_10213600 Ga0307516_102136002 77
2 3300005618 Ga0068864_100067620 Ga0068864_1000676204 79
3 3300005719 Ga0068861_100140000 Ga0068861_1001400002 79
4 3300005843 Ga0068860_100224847 Ga0068860_1002248473 79
5 3300017792 Ga0163161_10383294 Ga0163161_103832942 79
6 3300025918 Ga0207662_10323860 Ga0207662_103238602 79
7 3300025926 Ga0207659_10039712 Ga0207659_100397123 79
8 3300025933 Ga0207706_10717028 Ga0207706_107170282 79
9 3300025937 Ga0207669_10620230 Ga0207669_106202302 79
10 3300025940 Ga0207691_10083320 Ga0207691_100833203 79
11 3300025941 Ga0207711_10522734 Ga0207711_105227342 79
12 3300025942 Ga0207689_10328087 Ga0207689_103280872 79
13 3300025972 Ga0207668_10079398 Ga0207668_100793982 79
14 3300026023 Ga0207677_10061781 Ga0207677_100617812 79
15 3300026089 Ga0207648_10016444 Ga0207648_100164442 79
16 3300026095 Ga0207676_10033969 Ga0207676_100339694 79
17 3300026118 Ga0207675_100233117 Ga0207675_1002331172 79
18 3300026121 Ga0207683_11219574 Ga0207683_112195742 79
19 3300028381 Ga0268264_10177491 Ga0268264_101774912 79
20 3300025914 Ga0207671_10194742 Ga0207671_101947422 81
21 3300049583 Ga0501067_0121476 Ga0501067_0121476_1189_1440 82
22 3300039450 Ga0436363_0908743 Ga0436363_0908743_257_514 84
23 3300049590 Ga0501074_0958174 Ga0501074_0958174_11_277 87
24 3300003762 Ga0055542_1020407 Ga0055542_10204072 88
25 3300003763 Ga0055529_1006692 Ga0055529_10066922 88
26 3300005327 Ga0070658_10000086 Ga0070658_1000008687 88
27 3300005327 Ga0070658_10014596 Ga0070658_100145966 88
28 3300005327 Ga0070658_10062223 Ga0070658_100622232 88
29 3300005327 Ga0070658_10077413 Ga0070658_100774132 88
30 3300005327 Ga0070658_10830300 Ga0070658_108303002 88
31 3300005328 Ga0070676_10037876 Ga0070676_100378762 88
32 3300005329 Ga0070683_102294467 Ga0070683_1022944672 88
33 3300005331 Ga0070670_100006970 Ga0070670_1000069707 88
34 3300005331 Ga0070670_100190619 Ga0070670_1001906192 88
35 3300005334 Ga0068869_100623251 Ga0068869_1006232512 88
36 3300005336 Ga0070680_100014665 Ga0070680_1000146656 88
37 3300005336 Ga0070680_100326625 Ga0070680_1003266251 88
38 3300005339 Ga0070660_100000251 Ga0070660_10000025129 88
39 3300005339 Ga0070660_100569851 Ga0070660_1005698512 88
40 3300005343 Ga0070687_100283312 Ga0070687_1002833122 88
41 3300005345 Ga0070692_10004578 Ga0070692_100045782 88
42 3300005345 Ga0070692_10722302 Ga0070692_107223022 88
43 3300005345 Ga0070692_10997372 Ga0070692_109973722 88
44 3300005347 Ga0070668_100008699 Ga0070668_1000086998 88
45 3300005347 Ga0070668_100304207 Ga0070668_1003042072 88
46 3300005353 Ga0070669_100026313 Ga0070669_1000263132 88
47 3300005353 Ga0070669_100753520 Ga0070669_1007535202 88
48 3300005354 Ga0070675_100138224 Ga0070675_1001382243 88
49 3300005356 Ga0070674_100700063 Ga0070674_1007000631 88
50 3300005364 Ga0070673_100054465 Ga0070673_1000544653 88
51 3300005364 Ga0070673_100059302 Ga0070673_1000593022 88
52 3300005364 Ga0070673_100113119 Ga0070673_1001131193 88
53 3300005366 Ga0070659_100117168 Ga0070659_1001171682 88
54 3300005435 Ga0070714_100034688 Ga0070714_1000346883 88
55 3300005456 Ga0070678_100743077 Ga0070678_1007430772 88
56 3300005457 Ga0070662_100387955 Ga0070662_1003879552 88
57 3300005458 Ga0070681_10014018 Ga0070681_100140188 88
58 3300005459 Ga0068867_100364349 Ga0068867_1003643492 88
59 3300005459 Ga0068867_100400170 Ga0068867_1004001701 88
60 3300005467 Ga0070706_100100860 Ga0070706_1001008604 88
61 3300005468 Ga0070707_100302171 Ga0070707_1003021713 88
62 3300005468 Ga0070707_101886619 Ga0070707_1018866192 88
63 3300005530 Ga0070679_100172968 Ga0070679_1001729682 88
64 3300005539 Ga0068853_100491343 Ga0068853_1004913432 88
65 3300005539 Ga0068853_100656227 Ga0068853_1006562272 88
66 3300005539 Ga0068853_100756654 Ga0068853_1007566541 88
67 3300005543 Ga0070672_100620544 Ga0070672_1006205442 88
68 3300005548 Ga0070665_100159871 Ga0070665_1001598712 88
69 3300005563 Ga0068855_100496558 Ga0068855_1004965581 88
70 3300005563 Ga0068855_100783519 Ga0068855_1007835191 88
71 3300005578 Ga0068854_100701341 Ga0068854_1007013412 88
72 3300005578 Ga0068854_101615682 Ga0068854_1016156822 88
73 3300005614 Ga0068856_101086842 Ga0068856_1010868422 88
74 3300005614 Ga0068856_102258916 Ga0068856_1022589161 88
75 3300005616 Ga0068852_100053214 Ga0068852_1000532142 88
76 3300005616 Ga0068852_101295000 Ga0068852_1012950002 88
77 3300005616 Ga0068852_101795408 Ga0068852_1017954081 88
78 3300005618 Ga0068864_100001133 Ga0068864_10000113311 88
79 3300005841 Ga0068863_100044880 Ga0068863_1000448805 88
80 3300005844 Ga0068862_100030671 Ga0068862_1000306713 88
81 3300005844 Ga0068862_100724938 Ga0068862_1007249382 88
82 3300006028 Ga0070717_10513924 Ga0070717_105139242 88
83 3300006173 Ga0070716_100406630 Ga0070716_1004066302 88
84 3300006358 Ga0068871_100348104 Ga0068871_1003481042 88
85 3300006847 Ga0075431_100367607 Ga0075431_1003676072 88
86 3300007076 Ga0075435_100022369 Ga0075435_1000223693 88
87 3300009093 Ga0105240_10463310 Ga0105240_104633101 88
88 3300009093 Ga0105240_11017131 Ga0105240_110171312 88
89 3300009093 Ga0105240_12341061 Ga0105240_123410611 88
90 3300009177 Ga0105248_10313329 Ga0105248_103133292 88
91 3300009177 Ga0105248_11038930 Ga0105248_110389302 88
92 3300013102 Ga0157371_10178729 Ga0157371_101787292 88
93 3300013104 Ga0157370_10025047 Ga0157370_100250474 88
94 3300013104 Ga0157370_10115050 Ga0157370_101150502 88
95 3300013104 Ga0157370_10231228 Ga0157370_102312283 88
96 3300013105 Ga0157369_10313856 Ga0157369_103138562 88
97 3300013296 Ga0157374_10360602 Ga0157374_103606022 88
98 3300013296 Ga0157374_12838201 Ga0157374_128382011 88
99 3300013306 Ga0163162_10341314 Ga0163162_103413142 88
100 3300013307 Ga0157372_10470570 Ga0157372_104705701 88
101 3300013308 Ga0157375_10034169 Ga0157375_100341695 88
102 3300013308 Ga0157375_12485371 Ga0157375_124853712 88
103 3300014325 Ga0163163_10010221 Ga0163163_100102216 88
104 3300014969 Ga0157376_10082282 Ga0157376_100822823 88
105 3300014969 Ga0157376_11413820 Ga0157376_114138202 88
106 3300021384 Ga0213876_10000163 Ga0213876_1000016338 88
107 3300025254 Ga0209148_1001206 Ga0209148_10012066 88
108 3300025272 Ga0209455_1003190 Ga0209455_10031907 88
109 3300025315 Ga0207697_10280042 Ga0207697_102800422 88
110 3300025907 Ga0207645_10116027 Ga0207645_101160273 88
111 3300025909 Ga0207705_10000002 Ga0207705_10000002130 88
112 3300025909 Ga0207705_10017355 Ga0207705_100173557 88
113 3300025910 Ga0207684_10232525 Ga0207684_102325252 88
114 3300025917 Ga0207660_10020007 Ga0207660_100200072 88
115 3300025919 Ga0207657_10004956 Ga0207657_100049566 88
116 3300025920 Ga0207649_11639351 Ga0207649_116393511 88
117 3300025921 Ga0207652_11525551 Ga0207652_115255512 88
118 3300025922 Ga0207646_10120726 Ga0207646_101207262 88
119 3300025925 Ga0207650_10000838 Ga0207650_100008389 88
120 3300025925 Ga0207650_10008063 Ga0207650_100080636 88
121 3300025926 Ga0207659_10245918 Ga0207659_102459182 88
122 3300025932 Ga0207690_10039018 Ga0207690_100390184 88
123 3300025940 Ga0207691_10565537 Ga0207691_105655372 88
124 3300025945 Ga0207679_10788745 Ga0207679_107887452 88
125 3300025949 Ga0207667_10433281 Ga0207667_104332813 88
126 3300025949 Ga0207667_11824733 Ga0207667_118247332 88
127 3300025960 Ga0207651_10391408 Ga0207651_103914082 88
128 3300025972 Ga0207668_10660318 Ga0207668_106603182 88
129 3300025981 Ga0207640_11419959 Ga0207640_114199591 88
130 3300025986 Ga0207658_11869038 Ga0207658_118690382 88
131 3300026041 Ga0207639_12029182 Ga0207639_120291821 88
132 3300026067 Ga0207678_10130748 Ga0207678_101307482 88
133 3300026078 Ga0207702_10077267 Ga0207702_100772672 88
134 3300026088 Ga0207641_10005239 Ga0207641_100052398 88
135 3300026095 Ga0207676_10002779 Ga0207676_100027796 88
136 3300028380 Ga0268265_10017460 Ga0268265_100174606 88
137 3300028380 Ga0268265_11927558 Ga0268265_119275581 88
138 3300028381 Ga0268264_10595124 Ga0268264_105951241 88
139 3300031235 Ga0265330_10162083 Ga0265330_101620831 88
140 3300031238 Ga0265332_10105173 Ga0265332_101051733 88
141 3300031239 Ga0265328_10041540 Ga0265328_100415402 88
142 3300031240 Ga0265320_10075844 Ga0265320_100758441 88
143 3300031247 Ga0265340_10073549 Ga0265340_100735492 88
144 3300031250 Ga0265331_10321340 Ga0265331_103213402 88
145 3300031251 Ga0265327_10001257 Ga0265327_1000125720 88
146 3300031548 Ga0307408_100033785 Ga0307408_1000337853 88
147 3300031548 Ga0307408_100723928 Ga0307408_1007239282 88
148 3300031595 Ga0265313_10029394 Ga0265313_100293944 88
149 3300031595 Ga0265313_10354818 Ga0265313_103548182 88
150 3300031595 Ga0265313_10419681 Ga0265313_104196812 88
151 3300031711 Ga0265314_10104647 Ga0265314_101046474 88
152 3300031711 Ga0265314_10110060 Ga0265314_101100603 88
153 3300031712 Ga0265342_10273883 Ga0265342_102738832 88
154 3300031731 Ga0307405_10042849 Ga0307405_100428494 88
155 3300031824 Ga0307413_11037088 Ga0307413_110370882 88
156 3300031852 Ga0307410_10597316 Ga0307410_105973161 88
157 3300031901 Ga0307406_10023225 Ga0307406_100232252 88
158 3300031911 Ga0307412_10081556 Ga0307412_100815562 88
159 3300032002 Ga0307416_100092728 Ga0307416_1000927283 88
160 3300035111 Ga0373923_0455450 Ga0373923_0455450_312_590 88
161 3300037068 Ga0373925_0414685 Ga0373925_0414685_228_527 88
162 3300037418 Ga0395900_0137230 Ga0395900_0137230_1571_1852 88
163 3300037418 Ga0395900_1210731 Ga0395900_1210731_318_596 88
164 3300037466 Ga0395898_0708236 Ga0395898_0708236_596_874 88
165 3300037853 Ga0436364_0434533 Ga0436364_0434533_213_488 88
166 3300039437 Ga0436365_1308256 Ga0436365_1308256_24207_24488 88
167 3300039438 Ga0436360_0234984 Ga0436360_0234984_115_405 88
168 3300039438 Ga0436360_0817131 Ga0436360_0817131_337_612 88
169 3300044842 Ga0466957_0812627 Ga0466957_0812627_370_651 88
170 3300045976 Ga0466967_0477480 Ga0466967_0477480_885_1175 88
171 3300045976 Ga0466967_0645267 Ga0466967_0645267_190_471 88
172 3300046616 Ga0495668_0028554 Ga0495668_0028554_2806_3084 88
173 3300046692 Ga0495671_0137971 Ga0495671_0137971_176_454 88
174 3300046694 Ga0495649_0009038 Ga0495649_0009038_2286_2564 88
175 3300046694 Ga0495649_0053562 Ga0495649_0053562_384_659 88
176 3300046794 Ga0495589_0021960 Ga0495589_0021960_2684_2962 88
177 3300047323 Ga0495683_0410961 Ga0495683_0410961_121_399 88
178 3300047443 Ga0495687_017838 Ga0495687_017838_397_672 88
179 3300047673 Ga0495593_0414392 Ga0495593_0414392_210_509 88
180 3300048918 Ga0496115_0503045 Ga0496115_0503045_626_907 88
181 3300049571 Ga0501034_0062166 Ga0501034_0062166_1867_2148 88
182 3300049571 Ga0501034_0807395 Ga0501034_0807395_187_468 88
183 3300049572 Ga0501036_0430465 Ga0501036_0430465_131_412 88
184 3300049579 Ga0501043_0398760 Ga0501043_0398760_734_1012 88
185 3300049579 Ga0501043_0450039 Ga0501043_0450039_135_416 88
186 3300049581 Ga0501047_0072382 Ga0501047_0072382_2973_3275 88
187 3300049581 Ga0501047_0183880 Ga0501047_0183880_948_1229 88
188 3300049585 Ga0501069_0935115 Ga0501069_0935115_174_476 88
189 3300049586 Ga0501070_0033087 Ga0501070_0033087_1719_2021 88
190 3300049589 Ga0501073_0026778 Ga0501073_0026778_1727_2029 88
191 3300049593 Ga0501077_0274530 Ga0501077_0274530_366_662 88
192 3300049742 Ga0501080_0036838 Ga0501080_0036838_2378_2680 88
193 3300049743 Ga0501081_0835588 Ga0501081_0835588_193_489 88
194 3300049744 Ga0501083_0046987 Ga0501083_0046987_430_732 88
195 3300049823 Ga0501044_0268843 Ga0501044_0268843_871_1173 88
196 3300050510 nmdc:mga06r32_565201_c1 nmdc:mga06r32_565201_c1_419_712 88
197 3300050513 nmdc:mga0rr50_4373_c1 nmdc:mga0rr50_4373_c1_3133_3429 88
198 3300053085 Ga0495619_0155622 Ga0495619_0155622_588_887 88
199 3300053158 Ga0500627_0122272 Ga0500627_0122272_392_667 88
200 3300054114 Ga0501084_0194021 Ga0501084_0194021_14_316 88
201 3300060353 Ga0501082_0054620 Ga0501082_0054620_1465_1767 88
202 3300049568 Ga0501031_0742552 Ga0501031_0742552_132_440 89
203 3300049570 Ga0501033_0014953 Ga0501033_0014953_3499_3774 89
204 3300049571 Ga0501034_0097961 Ga0501034_0097961_2195_2470 89
205 3300049579 Ga0501043_0267703 Ga0501043_0267703_87_362 89
206 3300049581 Ga0501047_0049063 Ga0501047_0049063_2159_2434 89
207 3300049586 Ga0501070_0333234 Ga0501070_0333234_858_1133 89
208 3300049589 Ga0501073_0263389 Ga0501073_0263389_622_897 89
209 3300049742 Ga0501080_0074016 Ga0501080_0074016_2002_2277 89
210 3300049822 Ga0501035_0019796 Ga0501035_0019796_1541_1816 89
211 3300007265 Ga0099794_10163519 Ga0099794_101635192 90
212 3300031548 Ga0307408_100266508 Ga0307408_1002665083 90
213 3300031911 Ga0307412_10499489 Ga0307412_104994892 90
214 3300032002 Ga0307416_100022132 Ga0307416_1000221325 90
215 iso_pu_bacteria 2643221609 2644058047 90
216 iso_pu_bacteria 2643221611 2644073080 90
217 3300002738 JGI25154J39366_1000558 JGI25154J39366_100055816 91
218 3300005328 Ga0070676_10859773 Ga0070676_108597731 91
219 3300005356 Ga0070674_100166808 Ga0070674_1001668081 91
220 3300005455 Ga0070663_100514945 Ga0070663_1005149452 91
221 3300005548 Ga0070665_100123521 Ga0070665_1001235215 91
222 3300005614 Ga0068856_101313762 Ga0068856_1013137622 91
223 3300005841 Ga0068863_100949849 Ga0068863_1009498492 91
224 3300025233 Ga0209437_107126 Ga0209437_1071262 91
225 3300025246 Ga0209646_1000036 Ga0209646_1000036285 91
226 3300025919 Ga0207657_10188567 Ga0207657_101885672 91
227 3300026067 Ga0207678_10495960 Ga0207678_104959602 91
228 3300026078 Ga0207702_11704793 Ga0207702_117047932 91
229 3300028379 Ga0268266_11140757 Ga0268266_111407571 91
230 3300041443 Ga0451789_1036236 Ga0451789_1036236_207_494 91
231 3300044658 Ga0466972_0000140 Ga0466972_0000140_11044_11334 91
232 3300044658 Ga0466972_0050140 Ga0466972_0050140_518_808 91
233 3300044683 Ga0466965_0003503 Ga0466965_0003503_1452_1742 91
234 3300044693 Ga0466961_0227783 Ga0466961_0227783_826_1116 91
235 3300044706 Ga0466964_0003532 Ga0466964_0003532_4290_4580 91
236 3300044706 Ga0466964_0005974 Ga0466964_0005974_201_491 91
237 3300044706 Ga0466964_0456083 Ga0466964_0456083_84_374 91
238 3300044735 Ga0466968_0042589 Ga0466968_0042589_1520_1810 91
239 3300044735 Ga0466968_0049775 Ga0466968_0049775_1005_1295 91
240 3300044901 Ga0466960_0339921 Ga0466960_0339921_479_769 91
241 3300045049 Ga0466959_0369498 Ga0466959_0369498_320_598 91
242 3300046501 Ga0495607_0473107 Ga0495607_0473107_109_387 91
243 3300046507 Ga0495606_0632670 Ga0495606_0632670_92_370 91
244 3300046530 Ga0495654_0240055 Ga0495654_0240055_15_293 91
245 3300046660 Ga0495625_0299687 Ga0495625_0299687_428_706 91
246 3300046810 Ga0495660_0008483 Ga0495660_0008483_1634_1912 91
247 3300049568 Ga0501031_0021438 Ga0501031_0021438_287_586 91
248 3300049568 Ga0501031_0724094 Ga0501031_0724094_65_376 91
249 3300049569 Ga0501032_0084935 Ga0501032_0084935_686_997 91
250 3300049569 Ga0501032_0121617 Ga0501032_0121617_396_695 91
251 3300049571 Ga0501034_0041976 Ga0501034_0041976_2875_3186 91
252 3300049571 Ga0501034_0452635 Ga0501034_0452635_803_1102 91
253 3300049571 Ga0501034_0602938 Ga0501034_0602938_472_771 91
254 3300049572 Ga0501036_0061843 Ga0501036_0061843_2388_2687 91
255 3300049572 Ga0501036_0454277 Ga0501036_0454277_579_878 91
256 3300049573 Ga0501037_0192065 Ga0501037_0192065_301_612 91
257 3300049573 Ga0501037_0202908 Ga0501037_0202908_697_996 91
258 3300049573 Ga0501037_0305600 Ga0501037_0305600_405_704 91
259 3300049573 Ga0501037_0913401 Ga0501037_0913401_62_361 91
260 3300049574 Ga0501038_0002268 Ga0501038_0002268_2518_2829 91
261 3300049574 Ga0501038_0335291 Ga0501038_0335291_434_733 91
262 3300049574 Ga0501038_0353254 Ga0501038_0353254_229_528 91
263 3300049575 Ga0501039_0397387 Ga0501039_0397387_182_481 91
264 3300049575 Ga0501039_0882293 Ga0501039_0882293_227_526 91
265 3300049576 Ga0501040_0044636 Ga0501040_0044636_33_332 91
266 3300049576 Ga0501040_0875829 Ga0501040_0875829_244_555 91
267 3300049577 Ga0501041_0105603 Ga0501041_0105603_1421_1720 91
268 3300049578 Ga0501042_0054057 Ga0501042_0054057_551_850 91
269 3300049579 Ga0501043_0010117 Ga0501043_0010117_3147_3458 91
270 3300049579 Ga0501043_0040615 Ga0501043_0040615_1333_1632 91
271 3300049579 Ga0501043_0228031 Ga0501043_0228031_673_972 91
272 3300049580 Ga0501046_0307352 Ga0501046_0307352_408_707 91
273 3300049580 Ga0501046_0395605 Ga0501046_0395605_61_360 91
274 3300049580 Ga0501046_0914606 Ga0501046_0914606_218_529 91
275 3300049581 Ga0501047_0033517 Ga0501047_0033517_1031_1330 91
276 3300049581 Ga0501047_0171600 Ga0501047_0171600_1336_1647 91
277 3300049582 Ga0501048_0029184 Ga0501048_0029184_1599_1898 91
278 3300049585 Ga0501069_0037876 Ga0501069_0037876_1437_1736 91
279 3300049586 Ga0501070_0197884 Ga0501070_0197884_783_1082 91
280 3300049587 Ga0501071_0206540 Ga0501071_0206540_874_1173 91
281 3300049588 Ga0501072_0061694 Ga0501072_0061694_1463_1762 91
282 3300049589 Ga0501073_0202253 Ga0501073_0202253_668_967 91
283 3300049589 Ga0501073_0583052 Ga0501073_0583052_411_698 91
284 3300049592 Ga0501076_0131892 Ga0501076_0131892_541_840 91
285 3300049741 Ga0501079_0066235 Ga0501079_0066235_1414_1713 91
286 3300049742 Ga0501080_0115933 Ga0501080_0115933_527_826 91
287 3300049744 Ga0501083_0084887 Ga0501083_0084887_1657_1956 91
288 3300049822 Ga0501035_0166442 Ga0501035_0166442_718_1029 91
289 3300049822 Ga0501035_0495944 Ga0501035_0495944_620_919 91
290 3300049823 Ga0501044_0015357 Ga0501044_0015357_3305_3616 91
291 3300049823 Ga0501044_0188101 Ga0501044_0188101_1330_1629 91
292 3300049824 Ga0501045_0576948 Ga0501045_0576948_295_594 91
293 3300060353 Ga0501082_0680300 Ga0501082_0680300_490_789 91

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00708

Acylphosphatase

Acylphosphatase

15

97

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3trg-assembly1.cif.gz_A structure of an acylphosphatase from coxiella burnetii 0.9526 2 88
1ulr-assembly1.cif.gz_A crystal structure of tt0497 from thermus thermophilus hb8 0.9442 2 88
4ojh-assembly2.cif.gz_B the crystal structure of truncated, y86e mutant of s. solfataricus acylphosphatase 0.9429 2 88
8jfs-assembly2.cif.gz_B phosphate bound acylphosphatase from deinococcus radiodurans at 1 angstrom resolution 0.9419 2 88
3tnv-assembly1.cif.gz_A acylphosphatase with thermophilic surface and mesophilic core 0.9401 2 88
ID Description Score Start End Superfamily
af_K7LZQ3_146_256_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9777 2 88 3.30.70.100
3trgA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9518 2 88 3.30.70.100
3tnvA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9401 2 88 3.30.70.100
2hltA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9387 2 89 3.30.70.100
af_A0A1D6NY72_1_96_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9349 2 88 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A2T1HMC1-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9963 2 91 GO:0003998
AF-A0A0C9RL93-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.996 2 91 GO:0003998
AF-A0A2K1IZX3-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9915 2 91 GO:0003998
AF-A0A2I4E3P2-F1-model_v4 acylphosphatase (EC 3.6.1.7) 0.9907 2 91 GO:0003998
AF-A0A087LNE4-F1-model_v4 deleted 0.9899 2 91

Feature Viewer

pLDDT pTM Quality
95.92 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map