F390234
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 291 | 150 | 582 | 882 |
Family's Representative Sequence
| Representative Sequence | 3300005547|Ga0070693_100008643|Ga0070693_1000086434 |
| Length | 961 |
| Sequence | MAHRAMTMWPCVARAEIILLDRPDGPISRLETAVAVPSRCGLPVSWMLTSGGGRGLLTWPRRRAGAELRAEMGMRTRSEPVPALLDRQRERAALDGLLEDLRSGRGRALVVRGEAGLHLLCAPLLDRLERLPGPQRDALRVAFGLREGGAPDRFMVGLAVLTLLSEAAEDRPLLCVVDDAQWLDQASAQVLAFAARRLLAEPVGLIFSAREPGEAFGGLAELEVRGLPEQDARALLKLVIRFRLDERVRDRILAETNGNPLALLELPRGLSITQLTGGFGLPGARAVPARIEQGFRRRIEALPAETRSLLLVAAADPTGDPVLVWRAAGRLGIQSSATEAAQADGLLQTGARVRFRHPLVRSAAYAAASLPQRRAAHLTLAEVTDRDRDPDRRAWHLAAAAAGPDEAVAAELERSAGRAQARGGMAAAAAFLQRAVELTGQPARRSGRAXXXXQASLQAGAFDAAAGLLATAAAGPLDELQQARAGLLRGQIAFASSAGSDAPALLMKAAKQLEPLDATLARQTYLDAWGAAMFAGQFAGAGSLHEVARGARSAPPPAGSPRPSDLLLDGLAVLVTEGRAEAAPLLRRAARVFAEGAITVEEGLRYGWLATTAAAIVQEEEYWHATVARQLQSVREAGLLVHLPLWVQTMAIMTAWRGDFAAAASLIAEEEAIAAATGSGFARYSAVFLAGLRGAEAGAWPVIEAVITDSRAAGQGLGVQWSQWISAILYNSLGRYGEALAEAQQAADQAPELYMSMWALPELIEAASRTGQRRLAADALGRLAEATSTGQTDWGQGIYARCRALVSDGQDAEGYYREAVGRLRRTRLRPELARAHLLYGEWLRRERRXXXARAQLRIAHEMFAEIGMQAFAERARRELRATGETARTRAATTHDQLTPQEAQIARLARDGLSNPKIAAQLFLSPRTIQYHLGNIFTKLEITSRRQLRQALPDSGRDAPMA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 6 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 20 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 21 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 22 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 23 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 24 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 25 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 26 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 27 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 28 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 38 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 46 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 63 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 64 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 65 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 66 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 67 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 68 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 69 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 70 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 71 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 72 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 73 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 74 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 75 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 76 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 77 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 78 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 79 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 80 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 81 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 82 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 83 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 84 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 119 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 120 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 121 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 122 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 123 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 124 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 125 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 126 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 127 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 128 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 129 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 132 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 133 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 134 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 135 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 136 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 138 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 139 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 140 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 141 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 142 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 143 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 146 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 147 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 148 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 149 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 150 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.94 |
| Metatranscriptomes | 0 |
| Isolates | 2.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 5.84 |
| Rhizosphere | 89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070693_100008643 | 3300005547 | Bacteria | 5036 |
| 2 | JGI25407J50210_10002467 | 3300003373 | Bacteria | 4359 |
| 3 | Ga0070683_100046446 | 3300005329 | Bacteria | 4012 |
| 4 | Ga0070682_100009952 | 3300005337 | Bacteria | 5386 |
| 5 | Ga0070691_10006707 | 3300005341 | Bacteria | 5269 |
| 6 | Ga0070709_10001758 | 3300005434 | Bacteria | 11778 |
| 7 | Ga0070709_10004935 | 3300005434 | Bacteria | 7207 |
| 8 | Ga0070709_10013607 | 3300005434 | Bacteria | 4578 |
| 9 | Ga0070714_100001598 | 3300005435 | Bacteria | 16464 |
| 10 | Ga0070714_100005986 | 3300005435 | Bacteria | 9334 |
| 11 | Ga0070714_100009283 | 3300005435 | Bacteria | 7731 |
| 12 | Ga0070714_100027662 | 3300005435 | Bacteria | 4697 |
| 13 | Ga0070713_100002653 | 3300005436 | Bacteria | 11655 |
| 14 | Ga0070713_100004270 | 3300005436 | Bacteria | 9563 |
| 15 | Ga0070713_100012749 | 3300005436 | Bacteria | 6178 |
| 16 | Ga0070713_100012979 | 3300005436 | Bacteria | 6134 |
| 17 | Ga0070710_10001124 | 3300005437 | Bacteria | 12650 |
| 18 | Ga0070710_10001852 | 3300005437 | Bacteria | 9960 |
| 19 | Ga0070710_10022505 | 3300005437 | Bacteria | 3297 |
| 20 | Ga0070710_10029271 | 3300005437 | Bacteria | 2954 |
| 21 | Ga0070711_100002253 | 3300005439 | Bacteria | 10946 |
| 22 | Ga0070711_100008885 | 3300005439 | Bacteria | 6165 |
| 23 | Ga0070711_100013547 | 3300005439 | Bacteria | 5121 |
| 24 | Ga0070705_100020906 | 3300005440 | Bacteria | 3473 |
| 25 | Ga0070708_100007867 | 3300005445 | Bacteria | 8534 |
| 26 | Ga0070706_100017100 | 3300005467 | Bacteria | 6700 |
| 27 | Ga0070706_100023971 | 3300005467 | Bacteria | 5618 |
| 28 | Ga0070707_100032952 | 3300005468 | Bacteria | 4938 |
| 29 | Ga0070707_100056858 | 3300005468 | Bacteria | 3753 |
| 30 | Ga0070707_100058805 | 3300005468 | Bacteria | 3687 |
| 31 | Ga0070698_100038282 | 3300005471 | Bacteria | 4942 |
| 32 | Ga0070698_100051085 | 3300005471 | Bacteria | 4212 |
| 33 | Ga0070698_100065984 | 3300005471 | Bacteria | 3644 |
| 34 | Ga0070699_100004277 | 3300005518 | Bacteria | 12622 |
| 35 | Ga0070684_100005756 | 3300005535 | Bacteria | 9530 |
| 36 | Ga0070684_100024303 | 3300005535 | Bacteria | 5081 |
| 37 | Ga0070697_100012635 | 3300005536 | Bacteria | 6614 |
| 38 | Ga0068853_100040391 | 3300005539 | Bacteria | 3981 |
| 39 | Ga0068855_100006213 | 3300005563 | Bacteria | 14557 |
| 40 | Ga0068856_100025655 | 3300005614 | Bacteria | 5747 |
| 41 | Ga0068852_100013891 | 3300005616 | Bacteria | 6175 |
| 42 | Ga0068864_100002741 | 3300005618 | Bacteria | 14519 |
| 43 | Ga0068863_100004413 | 3300005841 | Bacteria | 13873 |
| 44 | Ga0068863_100055345 | 3300005841 | Bacteria | 3757 |
| 45 | Ga0081538_10000561 | 3300005981 | Bacteria | 41243 |
| 46 | Ga0081538_10000736 | 3300005981 | Bacteria | 35786 |
| 47 | Ga0081538_10000882 | 3300005981 | Bacteria | 32411 |
| 48 | Ga0081538_10005132 | 3300005981 | Bacteria | 11876 |
| 49 | Ga0081538_10010452 | 3300005981 | Bacteria | 7610 |
| 50 | Ga0081538_10016794 | 3300005981 | Bacteria | 5590 |
| 51 | Ga0081540_1010830 | 3300005983 | Bacteria | 6129 |
| 52 | Ga0081539_10000821 | 3300005985 | Bacteria | 60095 |
| 53 | Ga0081539_10003404 | 3300005985 | Bacteria | 19619 |
| 54 | Ga0081539_10010227 | 3300005985 | Bacteria | 7673 |
| 55 | Ga0070717_10013205 | 3300006028 | Bacteria | 6318 |
| 56 | Ga0070717_10013912 | 3300006028 | Bacteria | 6180 |
| 57 | Ga0070717_10045521 | 3300006028 | Bacteria | 3588 |
| 58 | Ga0070717_10056288 | 3300006028 | Bacteria | 3248 |
| 59 | Ga0070715_10002312 | 3300006163 | Bacteria | 5818 |
| 60 | Ga0070716_100003904 | 3300006173 | Bacteria | 7079 |
| 61 | Ga0070716_100004273 | 3300006173 | Bacteria | 6807 |
| 62 | Ga0070716_100007263 | 3300006173 | Bacteria | 5447 |
| 63 | Ga0070716_100011165 | 3300006173 | Bacteria | 4520 |
| 64 | Ga0070712_100001262 | 3300006175 | Bacteria | 15289 |
| 65 | Ga0070712_100010378 | 3300006175 | Bacteria | 5876 |
| 66 | Ga0070712_100012322 | 3300006175 | Bacteria | 5434 |
| 67 | Ga0070712_100022161 | 3300006175 | Bacteria | 4180 |
| 68 | Ga0070712_100033160 | 3300006175 | Bacteria | 3492 |
| 69 | Ga0105245_10029397 | 3300009098 | Bacteria | 4854 |
| 70 | Ga0105247_10013811 | 3300009101 | Bacteria | 4842 |
| 71 | Ga0105247_10026838 | 3300009101 | Bacteria | 3481 |
| 72 | Ga0105249_10051553 | 3300009553 | Bacteria | 3754 |
| 73 | Ga0105239_10062176 | 3300010375 | Bacteria | 4098 |
| 74 | Ga0105246_10023120 | 3300011119 | Bacteria | 4019 |
| 75 | Ga0105246_10055359 | 3300011119 | Bacteria | 2737 |
| 76 | Ga0157370_10012034 | 3300013104 | Bacteria | 9009 |
| 77 | Ga0157369_10001255 | 3300013105 | Bacteria | 31570 |
| 78 | Ga0157374_10014176 | 3300013296 | Bacteria | 6969 |
| 79 | Ga0163162_10066073 | 3300013306 | Bacteria | 3665 |
| 80 | Ga0157372_10062701 | 3300013307 | Bacteria | 4166 |
| 81 | Ga0163163_10060404 | 3300014325 | Bacteria | 3753 |
| 82 | Ga0163163_10062187 | 3300014325 | Bacteria | 3699 |
| 83 | Ga0157379_10064354 | 3300014968 | Bacteria | 3277 |
| 84 | Ga0157376_10030810 | 3300014969 | Bacteria | 4288 |
| 85 | Ga0213875_10000444 | 3300021388 | Bacteria | 36086 |
| 86 | Ga0207692_10000853 | 3300025898 | Bacteria | 10957 |
| 87 | Ga0207692_10001582 | 3300025898 | Bacteria | 8571 |
| 88 | Ga0207692_10001986 | 3300025898 | Bacteria | 7806 |
| 89 | Ga0207692_10008435 | 3300025898 | Bacteria | 4261 |
| 90 | Ga0207685_10000136 | 3300025905 | Bacteria | 10805 |
| 91 | Ga0207685_10005252 | 3300025905 | Bacteria | 3398 |
| 92 | Ga0207699_10001297 | 3300025906 | Bacteria | 11880 |
| 93 | Ga0207699_10005033 | 3300025906 | Bacteria | 6319 |
| 94 | Ga0207699_10017794 | 3300025906 | Bacteria | 3751 |
| 95 | Ga0207699_10021487 | 3300025906 | Bacteria | 3479 |
| 96 | Ga0207684_10007648 | 3300025910 | Bacteria | 9693 |
| 97 | Ga0207684_10015866 | 3300025910 | Bacteria | 6475 |
| 98 | Ga0207684_10054802 | 3300025910 | Bacteria | 3383 |
| 99 | Ga0207693_10003410 | 3300025915 | Bacteria | 13566 |
| 100 | Ga0207693_10003816 | 3300025915 | Bacteria | 12832 |
| 101 | Ga0207693_10004549 | 3300025915 | Bacteria | 11713 |
| 102 | Ga0207693_10008436 | 3300025915 | Bacteria | 8430 |
| 103 | Ga0207693_10014099 | 3300025915 | Bacteria | 6435 |
| 104 | Ga0207693_10027523 | 3300025915 | Bacteria | 4494 |
| 105 | Ga0207693_10029899 | 3300025915 | Bacteria | 4299 |
| 106 | Ga0207693_10030531 | 3300025915 | Bacteria | 4257 |
| 107 | Ga0207663_10000613 | 3300025916 | Bacteria | 15831 |
| 108 | Ga0207663_10003441 | 3300025916 | Bacteria | 7750 |
| 109 | Ga0207663_10005439 | 3300025916 | Bacteria | 6416 |
| 110 | Ga0207663_10027881 | 3300025916 | Bacteria | 3298 |
| 111 | Ga0207646_10020931 | 3300025922 | Bacteria | 6051 |
| 112 | Ga0207646_10029146 | 3300025922 | Bacteria | 5018 |
| 113 | Ga0207646_10037776 | 3300025922 | Bacteria | 4352 |
| 114 | Ga0207687_10028874 | 3300025927 | Bacteria | 3728 |
| 115 | Ga0207700_10000658 | 3300025928 | Bacteria | 20214 |
| 116 | Ga0207700_10001015 | 3300025928 | Bacteria | 16210 |
| 117 | Ga0207700_10007128 | 3300025928 | Bacteria | 6812 |
| 118 | Ga0207700_10011930 | 3300025928 | Bacteria | 5571 |
| 119 | Ga0207700_10036818 | 3300025928 | Bacteria | 3538 |
| 120 | Ga0207664_10002063 | 3300025929 | Bacteria | 13226 |
| 121 | Ga0207664_10002692 | 3300025929 | Bacteria | 11785 |
| 122 | Ga0207664_10003613 | 3300025929 | Bacteria | 10350 |
| 123 | Ga0207664_10004254 | 3300025929 | Bacteria | 9686 |
| 124 | Ga0207664_10006290 | 3300025929 | Bacteria | 8162 |
| 125 | Ga0207664_10007285 | 3300025929 | Bacteria | 7672 |
| 126 | Ga0207664_10019593 | 3300025929 | Bacteria | 5004 |
| 127 | Ga0207664_10021574 | 3300025929 | Bacteria | 4792 |
| 128 | Ga0207664_10022670 | 3300025929 | Bacteria | 4693 |
| 129 | Ga0207664_10025051 | 3300025929 | Bacteria | 4487 |
| 130 | Ga0207664_10039650 | 3300025929 | Bacteria | 3657 |
| 131 | Ga0207665_10004361 | 3300025939 | Bacteria | 9398 |
| 132 | Ga0207665_10005232 | 3300025939 | Bacteria | 8667 |
| 133 | Ga0207665_10007861 | 3300025939 | Bacteria | 7044 |
| 134 | Ga0207665_10008206 | 3300025939 | Bacteria | 6896 |
| 135 | Ga0207665_10008416 | 3300025939 | Bacteria | 6800 |
| 136 | Ga0207665_10020445 | 3300025939 | Bacteria | 4350 |
| 137 | Ga0207665_10022456 | 3300025939 | Bacteria | 4151 |
| 138 | Ga0207665_10023874 | 3300025939 | Bacteria | 4028 |
| 139 | Ga0207665_10030150 | 3300025939 | Bacteria | 3585 |
| 140 | Ga0207667_10065967 | 3300025949 | Bacteria | 3774 |
| 141 | Ga0207702_10011813 | 3300026078 | Bacteria | 7270 |
| 142 | Ga0207641_10007575 | 3300026088 | Bacteria | 9030 |
| 143 | Ga0207674_10016345 | 3300026116 | Bacteria | 8128 |
| 144 | Ga0207674_10072302 | 3300026116 | Bacteria | 3465 |
| 145 | Ga0268266_10054923 | 3300028379 | Bacteria | 3423 |
| 146 | Ga0307509_10079329 | 3300031507 | Bacteria | 3399 |
| 147 | Ga0373944_0000404 | 3300035089 | Bacteria | 9811 |
| 148 | Ga0373936_0000280 | 3300035113 | Bacteria | 17037 |
| 149 | Ga0373945_0000081 | 3300035116 | Bacteria | 21933 |
| 150 | Ga0373943_0006963 | 3300035170 | Bacteria | 5072 |
| 151 | Ga0373946_0000031 | 3300035171 | Bacteria | 37176 |
| 152 | Ga0373924_0008771 | 3300035410 | Bacteria | 3686 |
| 153 | Ga0373935_0002401 | 3300035692 | Bacteria | 10712 |
| 154 | Ga0373935_0023550 | 3300035692 | Bacteria | 3784 |
| 155 | Ga0373927_0001282 | 3300035695 | Bacteria | 19012 |
| 156 | Ga0373927_0017848 | 3300035695 | Bacteria | 4666 |
| 157 | Ga0373933_0018509 | 3300035724 | Bacteria | 3918 |
| 158 | Ga0373947_0000100 | 3300035725 | Bacteria | 43717 |
| 159 | Ga0373925_0000952 | 3300037068 | Bacteria | 26337 |
| 160 | Ga0395900_0001528 | 3300037418 | Bacteria | 27508 |
| 161 | Ga0395900_0083001 | 3300037418 | Bacteria | 3292 |
| 162 | Ga0395898_0001730 | 3300037466 | Bacteria | 28869 |
| 163 | Ga0395898_0002507 | 3300037466 | Bacteria | 21574 |
| 164 | Ga0395898_0002746 | 3300037466 | Bacteria | 20298 |
| 165 | Ga0395905_0041631 | 3300037471 | Bacteria | 4310 |
| 166 | Ga0436364_1465635 | 3300037853 | Bacteria | 45318 |
| 167 | Ga0395901_0006995 | 3300038443 | Bacteria | 11404 |
| 168 | Ga0395901_0008502 | 3300038443 | Bacteria | 10373 |
| 169 | Ga0436365_0139407 | 3300039437 | Bacteria | 3625 |
| 170 | Ga0436365_0946849 | 3300039437 | Bacteria | 13502 |
| 171 | Ga0436365_0986683 | 3300039437 | Bacteria | 32616 |
| 172 | Ga0436365_1911174 | 3300039437 | Bacteria | 13291 |
| 173 | Ga0436363_0078429 | 3300039450 | Bacteria | 7982 |
| 174 | Ga0436363_1126263 | 3300039450 | Bacteria | 3935 |
| 175 | Ga0436363_1237892 | 3300039450 | Bacteria | 6871 |
| 176 | Ga0439450_000554 | 3300042008 | Bacteria | 4903 |
| 177 | Ga0466960_0000010 | 3300044901 | Bacteria | 61407 |
| 178 | Ga0466960_0004088 | 3300044901 | Bacteria | 5670 |
| 179 | Ga0466967_0018578 | 3300045976 | Bacteria | 5561 |
| 180 | Ga0495641_0012134 | 3300046461 | Bacteria | 4844 |
| 181 | Ga0495651_0004948 | 3300046462 | Bacteria | 10181 |
| 182 | Ga0495651_0022786 | 3300046462 | Bacteria | 4869 |
| 183 | Ga0495653_0009805 | 3300046463 | Bacteria | 7833 |
| 184 | Ga0495653_0021235 | 3300046463 | Bacteria | 5260 |
| 185 | Ga0495653_0033514 | 3300046463 | Bacteria | 4068 |
| 186 | Ga0495653_0040605 | 3300046463 | Bacteria | 3635 |
| 187 | Ga0495582_0021448 | 3300046473 | Bacteria | 3535 |
| 188 | Ga0495662_0005075 | 3300046476 | Bacteria | 6594 |
| 189 | Ga0495664_0004242 | 3300046477 | Bacteria | 7821 |
| 190 | Ga0495608_0005374 | 3300046511 | Bacteria | 9152 |
| 191 | Ga0495608_0025259 | 3300046511 | Bacteria | 4055 |
| 192 | Ga0495618_0015994 | 3300046514 | Bacteria | 4582 |
| 193 | Ga0495628_0020382 | 3300046516 | Bacteria | 5470 |
| 194 | Ga0495628_0051605 | 3300046516 | Bacteria | 3251 |
| 195 | Ga0495630_0023195 | 3300046517 | Bacteria | 4586 |
| 196 | Ga0495648_0001760 | 3300046524 | Bacteria | 20908 |
| 197 | Ga0495666_0017975 | 3300046526 | Bacteria | 3521 |
| 198 | Ga0495652_0033288 | 3300046529 | Bacteria | 4500 |
| 199 | Ga0495652_0053340 | 3300046529 | Bacteria | 3446 |
| 200 | Ga0495665_0004107 | 3300046531 | Bacteria | 7846 |
| 201 | Ga0495665_0007450 | 3300046531 | Bacteria | 5920 |
| 202 | Ga0495645_0028358 | 3300046543 | Bacteria | 4067 |
| 203 | Ga0495667_0004267 | 3300046559 | Bacteria | 9635 |
| 204 | Ga0495667_0006671 | 3300046559 | Bacteria | 7834 |
| 205 | Ga0495667_0027541 | 3300046559 | Bacteria | 3828 |
| 206 | Ga0495634_0007205 | 3300046642 | Bacteria | 8384 |
| 207 | Ga0495635_0000296 | 3300046663 | Bacteria | 32118 |
| 208 | Ga0495635_0001516 | 3300046663 | Bacteria | 15547 |
| 209 | Ga0495635_0005309 | 3300046663 | Bacteria | 8966 |
| 210 | Ga0495635_0018410 | 3300046663 | Bacteria | 4874 |
| 211 | Ga0495657_0010193 | 3300046675 | Bacteria | 7080 |
| 212 | Ga0495657_0010273 | 3300046675 | Bacteria | 7047 |
| 213 | Ga0495657_0022372 | 3300046675 | Bacteria | 4529 |
| 214 | Ga0495657_0029644 | 3300046675 | Bacteria | 3836 |
| 215 | Ga0495599_0010997 | 3300046678 | Bacteria | 5553 |
| 216 | Ga0495599_0016408 | 3300046678 | Bacteria | 4597 |
| 217 | Ga0495599_0016754 | 3300046678 | Bacteria | 4551 |
| 218 | Ga0495623_0007920 | 3300046679 | Bacteria | 6908 |
| 219 | Ga0495646_0003599 | 3300046680 | Bacteria | 9674 |
| 220 | Ga0495613_0003668 | 3300046689 | Bacteria | 11516 |
| 221 | Ga0495624_0013969 | 3300046690 | Bacteria | 5466 |
| 222 | Ga0495600_0015662 | 3300046809 | Bacteria | 4800 |
| 223 | Ga0495600_0019196 | 3300046809 | Bacteria | 4363 |
| 224 | Ga0495581_0007575 | 3300047315 | Bacteria | 6279 |
| 225 | Ga0495581_0023290 | 3300047315 | Bacteria | 3588 |
| 226 | Ga0495604_0005446 | 3300047317 | Bacteria | 10095 |
| 227 | Ga0495604_0013191 | 3300047317 | Bacteria | 6580 |
| 228 | Ga0495674_0000276 | 3300047319 | Bacteria | 44078 |
| 229 | Ga0495676_0021102 | 3300047321 | Bacteria | 5700 |
| 230 | Ga0495676_0045311 | 3300047321 | Bacteria | 3581 |
| 231 | Ga0495680_0007360 | 3300047322 | Bacteria | 10113 |
| 232 | Ga0495680_0010820 | 3300047322 | Bacteria | 8121 |
| 233 | Ga0495680_0011748 | 3300047322 | Bacteria | 7737 |
| 234 | Ga0495680_0012828 | 3300047322 | Bacteria | 7344 |
| 235 | Ga0495680_0018539 | 3300047322 | Bacteria | 5901 |
| 236 | Ga0495680_0026271 | 3300047322 | Bacteria | 4803 |
| 237 | Ga0495675_0002541 | 3300047444 | Bacteria | 10919 |
| 238 | Ga0495673_0001486 | 3300047469 | Bacteria | 18546 |
| 239 | Ga0495684_0003801 | 3300047471 | Bacteria | 11767 |
| 240 | Ga0495684_0008405 | 3300047471 | Bacteria | 7995 |
| 241 | Ga0495684_0016748 | 3300047471 | Bacteria | 5647 |
| 242 | Ga0495602_0009267 | 3300048088 | Bacteria | 10239 |
| 243 | Ga0496102_0073051 | 3300048905 | Bacteria | 3153 |
| 244 | Ga0496104_0003520 | 3300048907 | Bacteria | 13502 |
| 245 | Ga0496104_0016260 | 3300048907 | Bacteria | 6754 |
| 246 | Ga0496104_0069165 | 3300048907 | Bacteria | 3355 |
| 247 | Ga0496105_0002125 | 3300048908 | Bacteria | 14357 |
| 248 | Ga0496106_0021220 | 3300048909 | Bacteria | 4822 |
| 249 | Ga0496108_0000064 | 3300048911 | Bacteria | 118022 |
| 250 | Ga0496108_0004804 | 3300048911 | Bacteria | 10900 |
| 251 | Ga0496108_0046476 | 3300048911 | Bacteria | 3627 |
| 252 | Ga0496109_0042466 | 3300048912 | Bacteria | 4118 |
| 253 | Ga0496111_0046102 | 3300048914 | Bacteria | 3138 |
| 254 | Ga0496112_0003553 | 3300048915 | Bacteria | 12949 |
| 255 | Ga0496112_0005701 | 3300048915 | Bacteria | 10815 |
| 256 | Ga0496112_0015049 | 3300048915 | Bacteria | 7201 |
| 257 | Ga0496113_0021809 | 3300048916 | Bacteria | 4522 |
| 258 | Ga0496115_0007840 | 3300048918 | Bacteria | 7873 |
| 259 | Ga0496115_0048134 | 3300048918 | Bacteria | 3410 |
| 260 | Ga0501034_0009240 | 3300049571 | Bacteria | 10334 |
| 261 | Ga0501039_0035964 | 3300049575 | Bacteria | 3821 |
| 262 | Ga0501040_0000867 | 3300049576 | Bacteria | 18975 |
| 263 | Ga0501040_0027929 | 3300049576 | Bacteria | 3801 |
| 264 | Ga0501041_0003429 | 3300049577 | Bacteria | 9118 |
| 265 | Ga0501042_0001781 | 3300049578 | Bacteria | 12889 |
| 266 | Ga0501042_0028080 | 3300049578 | Bacteria | 3960 |
| 267 | Ga0501046_0008148 | 3300049580 | Bacteria | 9154 |
| 268 | Ga0501047_0012516 | 3300049581 | Bacteria | 8036 |
| 269 | Ga0501048_0001347 | 3300049582 | Bacteria | 18636 |
| 270 | Ga0501072_0046911 | 3300049588 | Bacteria | 3402 |
| 271 | Ga0501072_0048662 | 3300049588 | Bacteria | 3338 |
| 272 | Ga0501074_0008672 | 3300049590 | Bacteria | 7364 |
| 273 | Ga0501075_0014407 | 3300049591 | Bacteria | 5665 |
| 274 | Ga0501076_0007270 | 3300049592 | Bacteria | 8057 |
| 275 | Ga0501077_0005588 | 3300049593 | Bacteria | 7657 |
| 276 | Ga0501079_0009085 | 3300049741 | Bacteria | 7525 |
| 277 | Ga0501079_0028011 | 3300049741 | Bacteria | 4322 |
| 278 | Ga0501081_0019206 | 3300049743 | Bacteria | 4548 |
| 279 | Ga0495612_0000022 | 3300053078 | Bacteria | 119126 |
| 280 | Ga0495612_0008290 | 3300053078 | Bacteria | 4216 |
| 281 | Ga0495612_0017289 | 3300053078 | Bacteria | 2889 |
| 282 | Ga0501084_0029205 | 3300054114 | Bacteria | 4612 |
| 283 | Ga0501084_0050254 | 3300054114 | Bacteria | 3490 |
| 284 | Ga0530510_0008793 | 3300061734 | Bacteria | 7066 |
| 285 | Ga0530510_0016853 | 3300061734 | Bacteria | 5174 |
| 286 | 2862289227 | 2862281513 | Bacteria | 9621493 |
| 287 | 2884703778 | 2884693830 | Bacteria | 11273186 |
| 288 | 2895434238 | 2895427314 | Bacteria | 13147766 |
| 289 | 2895434916 | 2895427314 | Bacteria | 13147766 |
| 290 | 2895448920 | 2895442618 | Bacteria | 11027144 |
| 291 | 3003007959 | 3002998708 | Bacteria | 11715108 |
| 292 | Ga0070693_100008643 | |||
| 293 | JGI25407J50210_10002467 | |||
| 294 | Ga0070683_100046446 | |||
| 295 | Ga0070682_100009952 | |||
| 296 | Ga0070691_10006707 | |||
| 297 | Ga0070709_10001758 | |||
| 298 | Ga0070709_10004935 | |||
| 299 | Ga0070709_10013607 | |||
| 300 | Ga0070714_100001598 | |||
| 301 | Ga0070714_100005986 | |||
| 302 | Ga0070714_100009283 | |||
| 303 | Ga0070714_100027662 | |||
| 304 | Ga0070713_100002653 | |||
| 305 | Ga0070713_100004270 | |||
| 306 | Ga0070713_100012749 | |||
| 307 | Ga0070713_100012979 | |||
| 308 | Ga0070710_10001124 | |||
| 309 | Ga0070710_10001852 | |||
| 310 | Ga0070710_10022505 | |||
| 311 | Ga0070710_10029271 | |||
| 312 | Ga0070711_100002253 | |||
| 313 | Ga0070711_100008885 | |||
| 314 | Ga0070711_100013547 | |||
| 315 | Ga0070705_100020906 | |||
| 316 | Ga0070708_100007867 | |||
| 317 | Ga0070706_100017100 | |||
| 318 | Ga0070706_100023971 | |||
| 319 | Ga0070707_100032952 | |||
| 320 | Ga0070707_100056858 | |||
| 321 | Ga0070707_100058805 | |||
| 322 | Ga0070698_100038282 | |||
| 323 | Ga0070698_100051085 | |||
| 324 | Ga0070698_100065984 | |||
| 325 | Ga0070699_100004277 | |||
| 326 | Ga0070684_100005756 | |||
| 327 | Ga0070684_100024303 | |||
| 328 | Ga0070697_100012635 | |||
| 329 | Ga0068853_100040391 | |||
| 330 | Ga0068855_100006213 | |||
| 331 | Ga0068856_100025655 | |||
| 332 | Ga0068852_100013891 | |||
| 333 | Ga0068864_100002741 | |||
| 334 | Ga0068863_100004413 | |||
| 335 | Ga0068863_100055345 | |||
| 336 | Ga0081538_10000561 | |||
| 337 | Ga0081538_10000736 | |||
| 338 | Ga0081538_10000882 | |||
| 339 | Ga0081538_10005132 | |||
| 340 | Ga0081538_10010452 | |||
| 341 | Ga0081538_10016794 | |||
| 342 | Ga0081540_1010830 | |||
| 343 | Ga0081539_10000821 | |||
| 344 | Ga0081539_10003404 | |||
| 345 | Ga0081539_10010227 | |||
| 346 | Ga0070717_10013205 | |||
| 347 | Ga0070717_10013912 | |||
| 348 | Ga0070717_10045521 | |||
| 349 | Ga0070717_10056288 | |||
| 350 | Ga0070715_10002312 | |||
| 351 | Ga0070716_100003904 | |||
| 352 | Ga0070716_100004273 | |||
| 353 | Ga0070716_100007263 | |||
| 354 | Ga0070716_100011165 | |||
| 355 | Ga0070712_100001262 | |||
| 356 | Ga0070712_100010378 | |||
| 357 | Ga0070712_100012322 | |||
| 358 | Ga0070712_100022161 | |||
| 359 | Ga0070712_100033160 | |||
| 360 | Ga0105245_10029397 | |||
| 361 | Ga0105247_10013811 | |||
| 362 | Ga0105247_10026838 | |||
| 363 | Ga0105249_10051553 | |||
| 364 | Ga0105239_10062176 | |||
| 365 | Ga0105246_10023120 | |||
| 366 | Ga0105246_10055359 | |||
| 367 | Ga0157370_10012034 | |||
| 368 | Ga0157369_10001255 | |||
| 369 | Ga0157374_10014176 | |||
| 370 | Ga0163162_10066073 | |||
| 371 | Ga0157372_10062701 | |||
| 372 | Ga0163163_10060404 | |||
| 373 | Ga0163163_10062187 | |||
| 374 | Ga0157379_10064354 | |||
| 375 | Ga0157376_10030810 | |||
| 376 | Ga0213875_10000444 | |||
| 377 | Ga0207692_10000853 | |||
| 378 | Ga0207692_10001582 | |||
| 379 | Ga0207692_10001986 | |||
| 380 | Ga0207692_10008435 | |||
| 381 | Ga0207685_10000136 | |||
| 382 | Ga0207685_10005252 | |||
| 383 | Ga0207699_10001297 | |||
| 384 | Ga0207699_10005033 | |||
| 385 | Ga0207699_10017794 | |||
| 386 | Ga0207699_10021487 | |||
| 387 | Ga0207684_10007648 | |||
| 388 | Ga0207684_10015866 | |||
| 389 | Ga0207684_10054802 | |||
| 390 | Ga0207693_10003410 | |||
| 391 | Ga0207693_10003816 | |||
| 392 | Ga0207693_10004549 | |||
| 393 | Ga0207693_10008436 | |||
| 394 | Ga0207693_10014099 | |||
| 395 | Ga0207693_10027523 | |||
| 396 | Ga0207693_10029899 | |||
| 397 | Ga0207693_10030531 | |||
| 398 | Ga0207663_10000613 | |||
| 399 | Ga0207663_10003441 | |||
| 400 | Ga0207663_10005439 | |||
| 401 | Ga0207663_10027881 | |||
| 402 | Ga0207646_10020931 | |||
| 403 | Ga0207646_10029146 | |||
| 404 | Ga0207646_10037776 | |||
| 405 | Ga0207687_10028874 | |||
| 406 | Ga0207700_10000658 | |||
| 407 | Ga0207700_10001015 | |||
| 408 | Ga0207700_10007128 | |||
| 409 | Ga0207700_10011930 | |||
| 410 | Ga0207700_10036818 | |||
| 411 | Ga0207664_10002063 | |||
| 412 | Ga0207664_10002692 | |||
| 413 | Ga0207664_10003613 | |||
| 414 | Ga0207664_10004254 | |||
| 415 | Ga0207664_10006290 | |||
| 416 | Ga0207664_10007285 | |||
| 417 | Ga0207664_10019593 | |||
| 418 | Ga0207664_10021574 | |||
| 419 | Ga0207664_10022670 | |||
| 420 | Ga0207664_10025051 | |||
| 421 | Ga0207664_10039650 | |||
| 422 | Ga0207665_10004361 | |||
| 423 | Ga0207665_10005232 | |||
| 424 | Ga0207665_10007861 | |||
| 425 | Ga0207665_10008206 | |||
| 426 | Ga0207665_10008416 | |||
| 427 | Ga0207665_10020445 | |||
| 428 | Ga0207665_10022456 | |||
| 429 | Ga0207665_10023874 | |||
| 430 | Ga0207665_10030150 | |||
| 431 | Ga0207667_10065967 | |||
| 432 | Ga0207702_10011813 | |||
| 433 | Ga0207641_10007575 | |||
| 434 | Ga0207674_10016345 | |||
| 435 | Ga0207674_10072302 | |||
| 436 | Ga0268266_10054923 | |||
| 437 | Ga0307509_10079329 | |||
| 438 | Ga0373944_0000404 | |||
| 439 | Ga0373936_0000280 | |||
| 440 | Ga0373945_0000081 | |||
| 441 | Ga0373943_0006963 | |||
| 442 | Ga0373946_0000031 | |||
| 443 | Ga0373924_0008771 | |||
| 444 | Ga0373935_0002401 | |||
| 445 | Ga0373935_0023550 | |||
| 446 | Ga0373927_0001282 | |||
| 447 | Ga0373927_0017848 | |||
| 448 | Ga0373933_0018509 | |||
| 449 | Ga0373947_0000100 | |||
| 450 | Ga0373925_0000952 | |||
| 451 | Ga0395900_0001528 | |||
| 452 | Ga0395900_0083001 | |||
| 453 | Ga0395898_0001730 | |||
| 454 | Ga0395898_0002507 | |||
| 455 | Ga0395898_0002746 | |||
| 456 | Ga0395905_0041631 | |||
| 457 | Ga0436364_1465635 | |||
| 458 | Ga0395901_0006995 | |||
| 459 | Ga0395901_0008502 | |||
| 460 | Ga0436365_0139407 | |||
| 461 | Ga0436365_0946849 | |||
| 462 | Ga0436365_0986683 | |||
| 463 | Ga0436365_1911174 | |||
| 464 | Ga0436363_0078429 | |||
| 465 | Ga0436363_1126263 | |||
| 466 | Ga0436363_1237892 | |||
| 467 | Ga0439450_000554 | |||
| 468 | Ga0466960_0000010 | |||
| 469 | Ga0466960_0004088 | |||
| 470 | Ga0466967_0018578 | |||
| 471 | Ga0495641_0012134 | |||
| 472 | Ga0495651_0004948 | |||
| 473 | Ga0495651_0022786 | |||
| 474 | Ga0495653_0009805 | |||
| 475 | Ga0495653_0021235 | |||
| 476 | Ga0495653_0033514 | |||
| 477 | Ga0495653_0040605 | |||
| 478 | Ga0495582_0021448 | |||
| 479 | Ga0495662_0005075 | |||
| 480 | Ga0495664_0004242 | |||
| 481 | Ga0495608_0005374 | |||
| 482 | Ga0495608_0025259 | |||
| 483 | Ga0495618_0015994 | |||
| 484 | Ga0495628_0020382 | |||
| 485 | Ga0495628_0051605 | |||
| 486 | Ga0495630_0023195 | |||
| 487 | Ga0495648_0001760 | |||
| 488 | Ga0495666_0017975 | |||
| 489 | Ga0495652_0033288 | |||
| 490 | Ga0495652_0053340 | |||
| 491 | Ga0495665_0004107 | |||
| 492 | Ga0495665_0007450 | |||
| 493 | Ga0495645_0028358 | |||
| 494 | Ga0495667_0004267 | |||
| 495 | Ga0495667_0006671 | |||
| 496 | Ga0495667_0027541 | |||
| 497 | Ga0495634_0007205 | |||
| 498 | Ga0495635_0000296 | |||
| 499 | Ga0495635_0001516 | |||
| 500 | Ga0495635_0005309 | |||
| 501 | Ga0495635_0018410 | |||
| 502 | Ga0495657_0010193 | |||
| 503 | Ga0495657_0010273 | |||
| 504 | Ga0495657_0022372 | |||
| 505 | Ga0495657_0029644 | |||
| 506 | Ga0495599_0010997 | |||
| 507 | Ga0495599_0016408 | |||
| 508 | Ga0495599_0016754 | |||
| 509 | Ga0495623_0007920 | |||
| 510 | Ga0495646_0003599 | |||
| 511 | Ga0495613_0003668 | |||
| 512 | Ga0495624_0013969 | |||
| 513 | Ga0495600_0015662 | |||
| 514 | Ga0495600_0019196 | |||
| 515 | Ga0495581_0007575 | |||
| 516 | Ga0495581_0023290 | |||
| 517 | Ga0495604_0005446 | |||
| 518 | Ga0495604_0013191 | |||
| 519 | Ga0495674_0000276 | |||
| 520 | Ga0495676_0021102 | |||
| 521 | Ga0495676_0045311 | |||
| 522 | Ga0495680_0007360 | |||
| 523 | Ga0495680_0010820 | |||
| 524 | Ga0495680_0011748 | |||
| 525 | Ga0495680_0012828 | |||
| 526 | Ga0495680_0018539 | |||
| 527 | Ga0495680_0026271 | |||
| 528 | Ga0495675_0002541 | |||
| 529 | Ga0495673_0001486 | |||
| 530 | Ga0495684_0003801 | |||
| 531 | Ga0495684_0008405 | |||
| 532 | Ga0495684_0016748 | |||
| 533 | Ga0495602_0009267 | |||
| 534 | Ga0496102_0073051 | |||
| 535 | Ga0496104_0003520 | |||
| 536 | Ga0496104_0016260 | |||
| 537 | Ga0496104_0069165 | |||
| 538 | Ga0496105_0002125 | |||
| 539 | Ga0496106_0021220 | |||
| 540 | Ga0496108_0000064 | |||
| 541 | Ga0496108_0004804 | |||
| 542 | Ga0496108_0046476 | |||
| 543 | Ga0496109_0042466 | |||
| 544 | Ga0496111_0046102 | |||
| 545 | Ga0496112_0003553 | |||
| 546 | Ga0496112_0005701 | |||
| 547 | Ga0496112_0015049 | |||
| 548 | Ga0496113_0021809 | |||
| 549 | Ga0496115_0007840 | |||
| 550 | Ga0496115_0048134 | |||
| 551 | Ga0501034_0009240 | |||
| 552 | Ga0501039_0035964 | |||
| 553 | Ga0501040_0000867 | |||
| 554 | Ga0501040_0027929 | |||
| 555 | Ga0501041_0003429 | |||
| 556 | Ga0501042_0001781 | |||
| 557 | Ga0501042_0028080 | |||
| 558 | Ga0501046_0008148 | |||
| 559 | Ga0501047_0012516 | |||
| 560 | Ga0501048_0001347 | |||
| 561 | Ga0501072_0046911 | |||
| 562 | Ga0501072_0048662 | |||
| 563 | Ga0501074_0008672 | |||
| 564 | Ga0501075_0014407 | |||
| 565 | Ga0501076_0007270 | |||
| 566 | Ga0501077_0005588 | |||
| 567 | Ga0501079_0009085 | |||
| 568 | Ga0501079_0028011 | |||
| 569 | Ga0501081_0019206 | |||
| 570 | Ga0495612_0000022 | |||
| 571 | Ga0495612_0008290 | |||
| 572 | Ga0495612_0017289 | |||
| 573 | Ga0501084_0029205 | |||
| 574 | Ga0501084_0050254 | |||
| 575 | Ga0530510_0008793 | |||
| 576 | Ga0530510_0016853 | |||
| 577 | 2862289227 | |||
| 578 | 2884703778 | |||
| 579 | 2895434238 | |||
| 580 | 2895434916 | |||
| 581 | 2895448920 | |||
| 582 | 3003007959 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3ulq-assembly1.cif.gz_B | crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain | 0.971 | 811 | 865 |
| 7ve5-assembly1.cif.gz_B | c-terminal domain of vrar | 0.952 | 812 | 868 |
| 1zlj-assembly4.cif.gz_H | crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain | 0.9434 | 812 | 866 |
| 1zlj-assembly2.cif.gz_C | crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain | 0.9414 | 810 | 866 |
| 1fse-assembly1.cif.gz_A | crystal structure of the bacillus subtilis regulatory protein gere | 0.9335 | 811 | 870 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cloC02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9576 | 812 | 866 | 1.10.10.10 |
| 3cloA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9559 | 812 | 866 | 1.10.10.10 |
| 1yioA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9463 | 811 | 868 | 1.10.10.10 |
| af_P06993_830_894_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9407 | 810 | 868 | 1.10.10.10 |
| 3qp6A02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9327 | 811 | 868 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S8MA09-F1-model_v4 | deleted | 0.9242 | 463 | 803 |
|
| AF-A0A7W2HKW5-F1-model_v4 | AAA family ATPase | 0.9104 | 40 | 325 |
GO:0000166
GO:0004016 GO:0005737 |
| AF-A0A2S8MA09-F1-model_v4 | deleted | 0.9037 | 463 | 803 |
|
| AF-A0A7W2HKW5-F1-model_v4 | AAA family ATPase | 0.8984 | 40 | 325 |
GO:0000166
GO:0004016 GO:0005737 |
| AF-A0A1X4I4X7-F1-model_v4 | LuxR family transcriptional regulator | 0.8786 | 390 | 806 |
|