F390234

General Info

Members Datasets Scaffolds Average Seq Length
291 150 582 882

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100008643|Ga0070693_1000086434
Length 961
Sequence MAHRAMTMWPCVARAEIILLDRPDGPISRLETAVAVPSRCGLPVSWMLTSGGGRGLLTWPRRRAGAELRAEMGMRTRSEPVPALLDRQRERAALDGLLEDLRSGRGRALVVRGEAGLHLLCAPLLDRLERLPGPQRDALRVAFGLREGGAPDRFMVGLAVLTLLSEAAEDRPLLCVVDDAQWLDQASAQVLAFAARRLLAEPVGLIFSAREPGEAFGGLAELEVRGLPEQDARALLKLVIRFRLDERVRDRILAETNGNPLALLELPRGLSITQLTGGFGLPGARAVPARIEQGFRRRIEALPAETRSLLLVAAADPTGDPVLVWRAAGRLGIQSSATEAAQADGLLQTGARVRFRHPLVRSAAYAAASLPQRRAAHLTLAEVTDRDRDPDRRAWHLAAAAAGPDEAVAAELERSAGRAQARGGMAAAAAFLQRAVELTGQPARRSGRAXXXXQASLQAGAFDAAAGLLATAAAGPLDELQQARAGLLRGQIAFASSAGSDAPALLMKAAKQLEPLDATLARQTYLDAWGAAMFAGQFAGAGSLHEVARGARSAPPPAGSPRPSDLLLDGLAVLVTEGRAEAAPLLRRAARVFAEGAITVEEGLRYGWLATTAAAIVQEEEYWHATVARQLQSVREAGLLVHLPLWVQTMAIMTAWRGDFAAAASLIAEEEAIAAATGSGFARYSAVFLAGLRGAEAGAWPVIEAVITDSRAAGQGLGVQWSQWISAILYNSLGRYGEALAEAQQAADQAPELYMSMWALPELIEAASRTGQRRLAADALGRLAEATSTGQTDWGQGIYARCRALVSDGQDAEGYYREAVGRLRRTRLRPELARAHLLYGEWLRRERRXXXARAQLRIAHEMFAEIGMQAFAERARRELRATGETARTRAATTHDQLTPQEAQIARLARDGLSNPKIAAQLFLSPRTIQYHLGNIFTKLEITSRRQLRQALPDSGRDAPMA

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
26 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
38 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
39 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
64 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
65 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
66 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
67 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
68 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
71 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
72 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
73 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
74 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
75 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
76 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
77 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
78 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
81 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
82 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
85 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
86 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
87 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
95 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
96 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
97 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
98 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
99 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
100 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
103 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
107 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
110 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
111 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
115 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
116 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
117 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
118 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
121 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
122 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
123 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
138 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
139 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
140 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
141 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
142 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
143 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
144 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
145 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
146 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
147 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
148 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
149 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
150 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.94
Metatranscriptomes 0
Isolates 2.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.84
Rhizosphere 89
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100008643 3300005547 Bacteria 5036
2 JGI25407J50210_10002467 3300003373 Bacteria 4359
3 Ga0070683_100046446 3300005329 Bacteria 4012
4 Ga0070682_100009952 3300005337 Bacteria 5386
5 Ga0070691_10006707 3300005341 Bacteria 5269
6 Ga0070709_10001758 3300005434 Bacteria 11778
7 Ga0070709_10004935 3300005434 Bacteria 7207
8 Ga0070709_10013607 3300005434 Bacteria 4578
9 Ga0070714_100001598 3300005435 Bacteria 16464
10 Ga0070714_100005986 3300005435 Bacteria 9334
11 Ga0070714_100009283 3300005435 Bacteria 7731
12 Ga0070714_100027662 3300005435 Bacteria 4697
13 Ga0070713_100002653 3300005436 Bacteria 11655
14 Ga0070713_100004270 3300005436 Bacteria 9563
15 Ga0070713_100012749 3300005436 Bacteria 6178
16 Ga0070713_100012979 3300005436 Bacteria 6134
17 Ga0070710_10001124 3300005437 Bacteria 12650
18 Ga0070710_10001852 3300005437 Bacteria 9960
19 Ga0070710_10022505 3300005437 Bacteria 3297
20 Ga0070710_10029271 3300005437 Bacteria 2954
21 Ga0070711_100002253 3300005439 Bacteria 10946
22 Ga0070711_100008885 3300005439 Bacteria 6165
23 Ga0070711_100013547 3300005439 Bacteria 5121
24 Ga0070705_100020906 3300005440 Bacteria 3473
25 Ga0070708_100007867 3300005445 Bacteria 8534
26 Ga0070706_100017100 3300005467 Bacteria 6700
27 Ga0070706_100023971 3300005467 Bacteria 5618
28 Ga0070707_100032952 3300005468 Bacteria 4938
29 Ga0070707_100056858 3300005468 Bacteria 3753
30 Ga0070707_100058805 3300005468 Bacteria 3687
31 Ga0070698_100038282 3300005471 Bacteria 4942
32 Ga0070698_100051085 3300005471 Bacteria 4212
33 Ga0070698_100065984 3300005471 Bacteria 3644
34 Ga0070699_100004277 3300005518 Bacteria 12622
35 Ga0070684_100005756 3300005535 Bacteria 9530
36 Ga0070684_100024303 3300005535 Bacteria 5081
37 Ga0070697_100012635 3300005536 Bacteria 6614
38 Ga0068853_100040391 3300005539 Bacteria 3981
39 Ga0068855_100006213 3300005563 Bacteria 14557
40 Ga0068856_100025655 3300005614 Bacteria 5747
41 Ga0068852_100013891 3300005616 Bacteria 6175
42 Ga0068864_100002741 3300005618 Bacteria 14519
43 Ga0068863_100004413 3300005841 Bacteria 13873
44 Ga0068863_100055345 3300005841 Bacteria 3757
45 Ga0081538_10000561 3300005981 Bacteria 41243
46 Ga0081538_10000736 3300005981 Bacteria 35786
47 Ga0081538_10000882 3300005981 Bacteria 32411
48 Ga0081538_10005132 3300005981 Bacteria 11876
49 Ga0081538_10010452 3300005981 Bacteria 7610
50 Ga0081538_10016794 3300005981 Bacteria 5590
51 Ga0081540_1010830 3300005983 Bacteria 6129
52 Ga0081539_10000821 3300005985 Bacteria 60095
53 Ga0081539_10003404 3300005985 Bacteria 19619
54 Ga0081539_10010227 3300005985 Bacteria 7673
55 Ga0070717_10013205 3300006028 Bacteria 6318
56 Ga0070717_10013912 3300006028 Bacteria 6180
57 Ga0070717_10045521 3300006028 Bacteria 3588
58 Ga0070717_10056288 3300006028 Bacteria 3248
59 Ga0070715_10002312 3300006163 Bacteria 5818
60 Ga0070716_100003904 3300006173 Bacteria 7079
61 Ga0070716_100004273 3300006173 Bacteria 6807
62 Ga0070716_100007263 3300006173 Bacteria 5447
63 Ga0070716_100011165 3300006173 Bacteria 4520
64 Ga0070712_100001262 3300006175 Bacteria 15289
65 Ga0070712_100010378 3300006175 Bacteria 5876
66 Ga0070712_100012322 3300006175 Bacteria 5434
67 Ga0070712_100022161 3300006175 Bacteria 4180
68 Ga0070712_100033160 3300006175 Bacteria 3492
69 Ga0105245_10029397 3300009098 Bacteria 4854
70 Ga0105247_10013811 3300009101 Bacteria 4842
71 Ga0105247_10026838 3300009101 Bacteria 3481
72 Ga0105249_10051553 3300009553 Bacteria 3754
73 Ga0105239_10062176 3300010375 Bacteria 4098
74 Ga0105246_10023120 3300011119 Bacteria 4019
75 Ga0105246_10055359 3300011119 Bacteria 2737
76 Ga0157370_10012034 3300013104 Bacteria 9009
77 Ga0157369_10001255 3300013105 Bacteria 31570
78 Ga0157374_10014176 3300013296 Bacteria 6969
79 Ga0163162_10066073 3300013306 Bacteria 3665
80 Ga0157372_10062701 3300013307 Bacteria 4166
81 Ga0163163_10060404 3300014325 Bacteria 3753
82 Ga0163163_10062187 3300014325 Bacteria 3699
83 Ga0157379_10064354 3300014968 Bacteria 3277
84 Ga0157376_10030810 3300014969 Bacteria 4288
85 Ga0213875_10000444 3300021388 Bacteria 36086
86 Ga0207692_10000853 3300025898 Bacteria 10957
87 Ga0207692_10001582 3300025898 Bacteria 8571
88 Ga0207692_10001986 3300025898 Bacteria 7806
89 Ga0207692_10008435 3300025898 Bacteria 4261
90 Ga0207685_10000136 3300025905 Bacteria 10805
91 Ga0207685_10005252 3300025905 Bacteria 3398
92 Ga0207699_10001297 3300025906 Bacteria 11880
93 Ga0207699_10005033 3300025906 Bacteria 6319
94 Ga0207699_10017794 3300025906 Bacteria 3751
95 Ga0207699_10021487 3300025906 Bacteria 3479
96 Ga0207684_10007648 3300025910 Bacteria 9693
97 Ga0207684_10015866 3300025910 Bacteria 6475
98 Ga0207684_10054802 3300025910 Bacteria 3383
99 Ga0207693_10003410 3300025915 Bacteria 13566
100 Ga0207693_10003816 3300025915 Bacteria 12832
101 Ga0207693_10004549 3300025915 Bacteria 11713
102 Ga0207693_10008436 3300025915 Bacteria 8430
103 Ga0207693_10014099 3300025915 Bacteria 6435
104 Ga0207693_10027523 3300025915 Bacteria 4494
105 Ga0207693_10029899 3300025915 Bacteria 4299
106 Ga0207693_10030531 3300025915 Bacteria 4257
107 Ga0207663_10000613 3300025916 Bacteria 15831
108 Ga0207663_10003441 3300025916 Bacteria 7750
109 Ga0207663_10005439 3300025916 Bacteria 6416
110 Ga0207663_10027881 3300025916 Bacteria 3298
111 Ga0207646_10020931 3300025922 Bacteria 6051
112 Ga0207646_10029146 3300025922 Bacteria 5018
113 Ga0207646_10037776 3300025922 Bacteria 4352
114 Ga0207687_10028874 3300025927 Bacteria 3728
115 Ga0207700_10000658 3300025928 Bacteria 20214
116 Ga0207700_10001015 3300025928 Bacteria 16210
117 Ga0207700_10007128 3300025928 Bacteria 6812
118 Ga0207700_10011930 3300025928 Bacteria 5571
119 Ga0207700_10036818 3300025928 Bacteria 3538
120 Ga0207664_10002063 3300025929 Bacteria 13226
121 Ga0207664_10002692 3300025929 Bacteria 11785
122 Ga0207664_10003613 3300025929 Bacteria 10350
123 Ga0207664_10004254 3300025929 Bacteria 9686
124 Ga0207664_10006290 3300025929 Bacteria 8162
125 Ga0207664_10007285 3300025929 Bacteria 7672
126 Ga0207664_10019593 3300025929 Bacteria 5004
127 Ga0207664_10021574 3300025929 Bacteria 4792
128 Ga0207664_10022670 3300025929 Bacteria 4693
129 Ga0207664_10025051 3300025929 Bacteria 4487
130 Ga0207664_10039650 3300025929 Bacteria 3657
131 Ga0207665_10004361 3300025939 Bacteria 9398
132 Ga0207665_10005232 3300025939 Bacteria 8667
133 Ga0207665_10007861 3300025939 Bacteria 7044
134 Ga0207665_10008206 3300025939 Bacteria 6896
135 Ga0207665_10008416 3300025939 Bacteria 6800
136 Ga0207665_10020445 3300025939 Bacteria 4350
137 Ga0207665_10022456 3300025939 Bacteria 4151
138 Ga0207665_10023874 3300025939 Bacteria 4028
139 Ga0207665_10030150 3300025939 Bacteria 3585
140 Ga0207667_10065967 3300025949 Bacteria 3774
141 Ga0207702_10011813 3300026078 Bacteria 7270
142 Ga0207641_10007575 3300026088 Bacteria 9030
143 Ga0207674_10016345 3300026116 Bacteria 8128
144 Ga0207674_10072302 3300026116 Bacteria 3465
145 Ga0268266_10054923 3300028379 Bacteria 3423
146 Ga0307509_10079329 3300031507 Bacteria 3399
147 Ga0373944_0000404 3300035089 Bacteria 9811
148 Ga0373936_0000280 3300035113 Bacteria 17037
149 Ga0373945_0000081 3300035116 Bacteria 21933
150 Ga0373943_0006963 3300035170 Bacteria 5072
151 Ga0373946_0000031 3300035171 Bacteria 37176
152 Ga0373924_0008771 3300035410 Bacteria 3686
153 Ga0373935_0002401 3300035692 Bacteria 10712
154 Ga0373935_0023550 3300035692 Bacteria 3784
155 Ga0373927_0001282 3300035695 Bacteria 19012
156 Ga0373927_0017848 3300035695 Bacteria 4666
157 Ga0373933_0018509 3300035724 Bacteria 3918
158 Ga0373947_0000100 3300035725 Bacteria 43717
159 Ga0373925_0000952 3300037068 Bacteria 26337
160 Ga0395900_0001528 3300037418 Bacteria 27508
161 Ga0395900_0083001 3300037418 Bacteria 3292
162 Ga0395898_0001730 3300037466 Bacteria 28869
163 Ga0395898_0002507 3300037466 Bacteria 21574
164 Ga0395898_0002746 3300037466 Bacteria 20298
165 Ga0395905_0041631 3300037471 Bacteria 4310
166 Ga0436364_1465635 3300037853 Bacteria 45318
167 Ga0395901_0006995 3300038443 Bacteria 11404
168 Ga0395901_0008502 3300038443 Bacteria 10373
169 Ga0436365_0139407 3300039437 Bacteria 3625
170 Ga0436365_0946849 3300039437 Bacteria 13502
171 Ga0436365_0986683 3300039437 Bacteria 32616
172 Ga0436365_1911174 3300039437 Bacteria 13291
173 Ga0436363_0078429 3300039450 Bacteria 7982
174 Ga0436363_1126263 3300039450 Bacteria 3935
175 Ga0436363_1237892 3300039450 Bacteria 6871
176 Ga0439450_000554 3300042008 Bacteria 4903
177 Ga0466960_0000010 3300044901 Bacteria 61407
178 Ga0466960_0004088 3300044901 Bacteria 5670
179 Ga0466967_0018578 3300045976 Bacteria 5561
180 Ga0495641_0012134 3300046461 Bacteria 4844
181 Ga0495651_0004948 3300046462 Bacteria 10181
182 Ga0495651_0022786 3300046462 Bacteria 4869
183 Ga0495653_0009805 3300046463 Bacteria 7833
184 Ga0495653_0021235 3300046463 Bacteria 5260
185 Ga0495653_0033514 3300046463 Bacteria 4068
186 Ga0495653_0040605 3300046463 Bacteria 3635
187 Ga0495582_0021448 3300046473 Bacteria 3535
188 Ga0495662_0005075 3300046476 Bacteria 6594
189 Ga0495664_0004242 3300046477 Bacteria 7821
190 Ga0495608_0005374 3300046511 Bacteria 9152
191 Ga0495608_0025259 3300046511 Bacteria 4055
192 Ga0495618_0015994 3300046514 Bacteria 4582
193 Ga0495628_0020382 3300046516 Bacteria 5470
194 Ga0495628_0051605 3300046516 Bacteria 3251
195 Ga0495630_0023195 3300046517 Bacteria 4586
196 Ga0495648_0001760 3300046524 Bacteria 20908
197 Ga0495666_0017975 3300046526 Bacteria 3521
198 Ga0495652_0033288 3300046529 Bacteria 4500
199 Ga0495652_0053340 3300046529 Bacteria 3446
200 Ga0495665_0004107 3300046531 Bacteria 7846
201 Ga0495665_0007450 3300046531 Bacteria 5920
202 Ga0495645_0028358 3300046543 Bacteria 4067
203 Ga0495667_0004267 3300046559 Bacteria 9635
204 Ga0495667_0006671 3300046559 Bacteria 7834
205 Ga0495667_0027541 3300046559 Bacteria 3828
206 Ga0495634_0007205 3300046642 Bacteria 8384
207 Ga0495635_0000296 3300046663 Bacteria 32118
208 Ga0495635_0001516 3300046663 Bacteria 15547
209 Ga0495635_0005309 3300046663 Bacteria 8966
210 Ga0495635_0018410 3300046663 Bacteria 4874
211 Ga0495657_0010193 3300046675 Bacteria 7080
212 Ga0495657_0010273 3300046675 Bacteria 7047
213 Ga0495657_0022372 3300046675 Bacteria 4529
214 Ga0495657_0029644 3300046675 Bacteria 3836
215 Ga0495599_0010997 3300046678 Bacteria 5553
216 Ga0495599_0016408 3300046678 Bacteria 4597
217 Ga0495599_0016754 3300046678 Bacteria 4551
218 Ga0495623_0007920 3300046679 Bacteria 6908
219 Ga0495646_0003599 3300046680 Bacteria 9674
220 Ga0495613_0003668 3300046689 Bacteria 11516
221 Ga0495624_0013969 3300046690 Bacteria 5466
222 Ga0495600_0015662 3300046809 Bacteria 4800
223 Ga0495600_0019196 3300046809 Bacteria 4363
224 Ga0495581_0007575 3300047315 Bacteria 6279
225 Ga0495581_0023290 3300047315 Bacteria 3588
226 Ga0495604_0005446 3300047317 Bacteria 10095
227 Ga0495604_0013191 3300047317 Bacteria 6580
228 Ga0495674_0000276 3300047319 Bacteria 44078
229 Ga0495676_0021102 3300047321 Bacteria 5700
230 Ga0495676_0045311 3300047321 Bacteria 3581
231 Ga0495680_0007360 3300047322 Bacteria 10113
232 Ga0495680_0010820 3300047322 Bacteria 8121
233 Ga0495680_0011748 3300047322 Bacteria 7737
234 Ga0495680_0012828 3300047322 Bacteria 7344
235 Ga0495680_0018539 3300047322 Bacteria 5901
236 Ga0495680_0026271 3300047322 Bacteria 4803
237 Ga0495675_0002541 3300047444 Bacteria 10919
238 Ga0495673_0001486 3300047469 Bacteria 18546
239 Ga0495684_0003801 3300047471 Bacteria 11767
240 Ga0495684_0008405 3300047471 Bacteria 7995
241 Ga0495684_0016748 3300047471 Bacteria 5647
242 Ga0495602_0009267 3300048088 Bacteria 10239
243 Ga0496102_0073051 3300048905 Bacteria 3153
244 Ga0496104_0003520 3300048907 Bacteria 13502
245 Ga0496104_0016260 3300048907 Bacteria 6754
246 Ga0496104_0069165 3300048907 Bacteria 3355
247 Ga0496105_0002125 3300048908 Bacteria 14357
248 Ga0496106_0021220 3300048909 Bacteria 4822
249 Ga0496108_0000064 3300048911 Bacteria 118022
250 Ga0496108_0004804 3300048911 Bacteria 10900
251 Ga0496108_0046476 3300048911 Bacteria 3627
252 Ga0496109_0042466 3300048912 Bacteria 4118
253 Ga0496111_0046102 3300048914 Bacteria 3138
254 Ga0496112_0003553 3300048915 Bacteria 12949
255 Ga0496112_0005701 3300048915 Bacteria 10815
256 Ga0496112_0015049 3300048915 Bacteria 7201
257 Ga0496113_0021809 3300048916 Bacteria 4522
258 Ga0496115_0007840 3300048918 Bacteria 7873
259 Ga0496115_0048134 3300048918 Bacteria 3410
260 Ga0501034_0009240 3300049571 Bacteria 10334
261 Ga0501039_0035964 3300049575 Bacteria 3821
262 Ga0501040_0000867 3300049576 Bacteria 18975
263 Ga0501040_0027929 3300049576 Bacteria 3801
264 Ga0501041_0003429 3300049577 Bacteria 9118
265 Ga0501042_0001781 3300049578 Bacteria 12889
266 Ga0501042_0028080 3300049578 Bacteria 3960
267 Ga0501046_0008148 3300049580 Bacteria 9154
268 Ga0501047_0012516 3300049581 Bacteria 8036
269 Ga0501048_0001347 3300049582 Bacteria 18636
270 Ga0501072_0046911 3300049588 Bacteria 3402
271 Ga0501072_0048662 3300049588 Bacteria 3338
272 Ga0501074_0008672 3300049590 Bacteria 7364
273 Ga0501075_0014407 3300049591 Bacteria 5665
274 Ga0501076_0007270 3300049592 Bacteria 8057
275 Ga0501077_0005588 3300049593 Bacteria 7657
276 Ga0501079_0009085 3300049741 Bacteria 7525
277 Ga0501079_0028011 3300049741 Bacteria 4322
278 Ga0501081_0019206 3300049743 Bacteria 4548
279 Ga0495612_0000022 3300053078 Bacteria 119126
280 Ga0495612_0008290 3300053078 Bacteria 4216
281 Ga0495612_0017289 3300053078 Bacteria 2889
282 Ga0501084_0029205 3300054114 Bacteria 4612
283 Ga0501084_0050254 3300054114 Bacteria 3490
284 Ga0530510_0008793 3300061734 Bacteria 7066
285 Ga0530510_0016853 3300061734 Bacteria 5174
286 2862289227 2862281513 Bacteria 9621493
287 2884703778 2884693830 Bacteria 11273186
288 2895434238 2895427314 Bacteria 13147766
289 2895434916 2895427314 Bacteria 13147766
290 2895448920 2895442618 Bacteria 11027144
291 3003007959 3002998708 Bacteria 11715108
292 Ga0070693_100008643
293 JGI25407J50210_10002467
294 Ga0070683_100046446
295 Ga0070682_100009952
296 Ga0070691_10006707
297 Ga0070709_10001758
298 Ga0070709_10004935
299 Ga0070709_10013607
300 Ga0070714_100001598
301 Ga0070714_100005986
302 Ga0070714_100009283
303 Ga0070714_100027662
304 Ga0070713_100002653
305 Ga0070713_100004270
306 Ga0070713_100012749
307 Ga0070713_100012979
308 Ga0070710_10001124
309 Ga0070710_10001852
310 Ga0070710_10022505
311 Ga0070710_10029271
312 Ga0070711_100002253
313 Ga0070711_100008885
314 Ga0070711_100013547
315 Ga0070705_100020906
316 Ga0070708_100007867
317 Ga0070706_100017100
318 Ga0070706_100023971
319 Ga0070707_100032952
320 Ga0070707_100056858
321 Ga0070707_100058805
322 Ga0070698_100038282
323 Ga0070698_100051085
324 Ga0070698_100065984
325 Ga0070699_100004277
326 Ga0070684_100005756
327 Ga0070684_100024303
328 Ga0070697_100012635
329 Ga0068853_100040391
330 Ga0068855_100006213
331 Ga0068856_100025655
332 Ga0068852_100013891
333 Ga0068864_100002741
334 Ga0068863_100004413
335 Ga0068863_100055345
336 Ga0081538_10000561
337 Ga0081538_10000736
338 Ga0081538_10000882
339 Ga0081538_10005132
340 Ga0081538_10010452
341 Ga0081538_10016794
342 Ga0081540_1010830
343 Ga0081539_10000821
344 Ga0081539_10003404
345 Ga0081539_10010227
346 Ga0070717_10013205
347 Ga0070717_10013912
348 Ga0070717_10045521
349 Ga0070717_10056288
350 Ga0070715_10002312
351 Ga0070716_100003904
352 Ga0070716_100004273
353 Ga0070716_100007263
354 Ga0070716_100011165
355 Ga0070712_100001262
356 Ga0070712_100010378
357 Ga0070712_100012322
358 Ga0070712_100022161
359 Ga0070712_100033160
360 Ga0105245_10029397
361 Ga0105247_10013811
362 Ga0105247_10026838
363 Ga0105249_10051553
364 Ga0105239_10062176
365 Ga0105246_10023120
366 Ga0105246_10055359
367 Ga0157370_10012034
368 Ga0157369_10001255
369 Ga0157374_10014176
370 Ga0163162_10066073
371 Ga0157372_10062701
372 Ga0163163_10060404
373 Ga0163163_10062187
374 Ga0157379_10064354
375 Ga0157376_10030810
376 Ga0213875_10000444
377 Ga0207692_10000853
378 Ga0207692_10001582
379 Ga0207692_10001986
380 Ga0207692_10008435
381 Ga0207685_10000136
382 Ga0207685_10005252
383 Ga0207699_10001297
384 Ga0207699_10005033
385 Ga0207699_10017794
386 Ga0207699_10021487
387 Ga0207684_10007648
388 Ga0207684_10015866
389 Ga0207684_10054802
390 Ga0207693_10003410
391 Ga0207693_10003816
392 Ga0207693_10004549
393 Ga0207693_10008436
394 Ga0207693_10014099
395 Ga0207693_10027523
396 Ga0207693_10029899
397 Ga0207693_10030531
398 Ga0207663_10000613
399 Ga0207663_10003441
400 Ga0207663_10005439
401 Ga0207663_10027881
402 Ga0207646_10020931
403 Ga0207646_10029146
404 Ga0207646_10037776
405 Ga0207687_10028874
406 Ga0207700_10000658
407 Ga0207700_10001015
408 Ga0207700_10007128
409 Ga0207700_10011930
410 Ga0207700_10036818
411 Ga0207664_10002063
412 Ga0207664_10002692
413 Ga0207664_10003613
414 Ga0207664_10004254
415 Ga0207664_10006290
416 Ga0207664_10007285
417 Ga0207664_10019593
418 Ga0207664_10021574
419 Ga0207664_10022670
420 Ga0207664_10025051
421 Ga0207664_10039650
422 Ga0207665_10004361
423 Ga0207665_10005232
424 Ga0207665_10007861
425 Ga0207665_10008206
426 Ga0207665_10008416
427 Ga0207665_10020445
428 Ga0207665_10022456
429 Ga0207665_10023874
430 Ga0207665_10030150
431 Ga0207667_10065967
432 Ga0207702_10011813
433 Ga0207641_10007575
434 Ga0207674_10016345
435 Ga0207674_10072302
436 Ga0268266_10054923
437 Ga0307509_10079329
438 Ga0373944_0000404
439 Ga0373936_0000280
440 Ga0373945_0000081
441 Ga0373943_0006963
442 Ga0373946_0000031
443 Ga0373924_0008771
444 Ga0373935_0002401
445 Ga0373935_0023550
446 Ga0373927_0001282
447 Ga0373927_0017848
448 Ga0373933_0018509
449 Ga0373947_0000100
450 Ga0373925_0000952
451 Ga0395900_0001528
452 Ga0395900_0083001
453 Ga0395898_0001730
454 Ga0395898_0002507
455 Ga0395898_0002746
456 Ga0395905_0041631
457 Ga0436364_1465635
458 Ga0395901_0006995
459 Ga0395901_0008502
460 Ga0436365_0139407
461 Ga0436365_0946849
462 Ga0436365_0986683
463 Ga0436365_1911174
464 Ga0436363_0078429
465 Ga0436363_1126263
466 Ga0436363_1237892
467 Ga0439450_000554
468 Ga0466960_0000010
469 Ga0466960_0004088
470 Ga0466967_0018578
471 Ga0495641_0012134
472 Ga0495651_0004948
473 Ga0495651_0022786
474 Ga0495653_0009805
475 Ga0495653_0021235
476 Ga0495653_0033514
477 Ga0495653_0040605
478 Ga0495582_0021448
479 Ga0495662_0005075
480 Ga0495664_0004242
481 Ga0495608_0005374
482 Ga0495608_0025259
483 Ga0495618_0015994
484 Ga0495628_0020382
485 Ga0495628_0051605
486 Ga0495630_0023195
487 Ga0495648_0001760
488 Ga0495666_0017975
489 Ga0495652_0033288
490 Ga0495652_0053340
491 Ga0495665_0004107
492 Ga0495665_0007450
493 Ga0495645_0028358
494 Ga0495667_0004267
495 Ga0495667_0006671
496 Ga0495667_0027541
497 Ga0495634_0007205
498 Ga0495635_0000296
499 Ga0495635_0001516
500 Ga0495635_0005309
501 Ga0495635_0018410
502 Ga0495657_0010193
503 Ga0495657_0010273
504 Ga0495657_0022372
505 Ga0495657_0029644
506 Ga0495599_0010997
507 Ga0495599_0016408
508 Ga0495599_0016754
509 Ga0495623_0007920
510 Ga0495646_0003599
511 Ga0495613_0003668
512 Ga0495624_0013969
513 Ga0495600_0015662
514 Ga0495600_0019196
515 Ga0495581_0007575
516 Ga0495581_0023290
517 Ga0495604_0005446
518 Ga0495604_0013191
519 Ga0495674_0000276
520 Ga0495676_0021102
521 Ga0495676_0045311
522 Ga0495680_0007360
523 Ga0495680_0010820
524 Ga0495680_0011748
525 Ga0495680_0012828
526 Ga0495680_0018539
527 Ga0495680_0026271
528 Ga0495675_0002541
529 Ga0495673_0001486
530 Ga0495684_0003801
531 Ga0495684_0008405
532 Ga0495684_0016748
533 Ga0495602_0009267
534 Ga0496102_0073051
535 Ga0496104_0003520
536 Ga0496104_0016260
537 Ga0496104_0069165
538 Ga0496105_0002125
539 Ga0496106_0021220
540 Ga0496108_0000064
541 Ga0496108_0004804
542 Ga0496108_0046476
543 Ga0496109_0042466
544 Ga0496111_0046102
545 Ga0496112_0003553
546 Ga0496112_0005701
547 Ga0496112_0015049
548 Ga0496113_0021809
549 Ga0496115_0007840
550 Ga0496115_0048134
551 Ga0501034_0009240
552 Ga0501039_0035964
553 Ga0501040_0000867
554 Ga0501040_0027929
555 Ga0501041_0003429
556 Ga0501042_0001781
557 Ga0501042_0028080
558 Ga0501046_0008148
559 Ga0501047_0012516
560 Ga0501048_0001347
561 Ga0501072_0046911
562 Ga0501072_0048662
563 Ga0501074_0008672
564 Ga0501075_0014407
565 Ga0501076_0007270
566 Ga0501077_0005588
567 Ga0501079_0009085
568 Ga0501079_0028011
569 Ga0501081_0019206
570 Ga0495612_0000022
571 Ga0495612_0008290
572 Ga0495612_0017289
573 Ga0501084_0029205
574 Ga0501084_0050254
575 Ga0530510_0008793
576 Ga0530510_0016853
577 2862289227
578 2884703778
579 2895434238
580 2895434916
581 2895448920
582 3003007959

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

895

950

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ulq-assembly1.cif.gz_B crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain 0.971 811 865
7ve5-assembly1.cif.gz_B c-terminal domain of vrar 0.952 812 868
1zlj-assembly4.cif.gz_H crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain 0.9434 812 866
1zlj-assembly2.cif.gz_C crystal structure of the mycobacterium tuberculosis hypoxic response regulator dosr c-terminal domain 0.9414 810 866
1fse-assembly1.cif.gz_A crystal structure of the bacillus subtilis regulatory protein gere 0.9335 811 870
ID Description Score Start End Superfamily
3cloC02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9576 812 866 1.10.10.10
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9559 812 866 1.10.10.10
1yioA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9463 811 868 1.10.10.10
af_P06993_830_894_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9407 810 868 1.10.10.10
3qp6A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9327 811 868 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2S8MA09-F1-model_v4 deleted 0.9242 463 803
AF-A0A7W2HKW5-F1-model_v4 AAA family ATPase 0.9104 40 325 GO:0000166
GO:0004016
GO:0005737
AF-A0A2S8MA09-F1-model_v4 deleted 0.9037 463 803
AF-A0A7W2HKW5-F1-model_v4 AAA family ATPase 0.8984 40 325 GO:0000166
GO:0004016
GO:0005737
AF-A0A1X4I4X7-F1-model_v4 LuxR family transcriptional regulator 0.8786 390 806

Map