F390233

General Info

Members Datasets Scaffolds Average Seq Length
291 193 582 127

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_101016711|Ga0070696_1010167111
Length 130
Sequence MAKTEKRRKLERFPKQLDAAIRAAENKKAVDLVVLDLRNAAGFTDYFLICSGSNPRQIRAIADEVIDALAVQGGAKPHLEGYGSEWVLLDYFDFIVHIFAPDTRLFYDLERLWGAAERIDVDERPRPARG

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
85 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
132 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
139 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
178 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.75
Rhizosphere 97.25
Stem 0
Stem Tuber 0
Unclassified 22.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_101016711 3300005546 Bacteria 693
2 JGI24751J29686_10002775 3300002459 Bacteria 3521
3 Ga0065712_10098501 3300005290 Bacteria 2115
4 Ga0065715_10552248 3300005293 Unclassified 740
5 Ga0070676_11424205 3300005328 Unclassified 532
6 Ga0070690_100544816 3300005330 Unclassified 874
7 Ga0070670_100030708 3300005331 Bacteria 4627
8 Ga0068869_100918933 3300005334 Unclassified 758
9 Ga0070666_10030150 3300005335 Bacteria 3571
10 Ga0070680_100197722 3300005336 Bacteria 1695
11 Ga0070680_101118246 3300005336 Bacteria 681
12 Ga0068868_100824048 3300005338 Bacteria 839
13 Ga0070660_100344181 3300005339 Unclassified 1227
14 Ga0070689_100225108 3300005340 Bacteria 1540
15 Ga0070689_101285406 3300005340 Bacteria 659
16 Ga0070691_10402626 3300005341 Bacteria 771
17 Ga0070687_100015499 3300005343 Bacteria 3449
18 Ga0070687_100032644 3300005343 Bacteria 2563
19 Ga0070692_10093685 3300005345 Bacteria 1636
20 Ga0070668_100587484 3300005347 Bacteria 973
21 Ga0070668_100891028 3300005347 Unclassified 795
22 Ga0070669_100010930 3300005353 Bacteria 6447
23 Ga0070669_100716209 3300005353 Bacteria 846
24 Ga0070671_100061184 3300005355 Bacteria 3136
25 Ga0070673_100018283 3300005364 Bacteria 5003
26 Ga0070673_100062160 3300005364 Bacteria 2966
27 Ga0070688_100005679 3300005365 Bacteria 6589
28 Ga0070659_100003218 3300005366 Bacteria 11625
29 Ga0070667_100089050 3300005367 Unclassified 2651
30 Ga0070667_101080180 3300005367 Bacteria 750
31 Ga0070703_10106380 3300005406 Unclassified 997
32 Ga0070709_10157733 3300005434 Bacteria 1575
33 Ga0070709_10412939 3300005434 Bacteria 1010
34 Ga0070711_100095529 3300005439 Bacteria 2151
35 Ga0070705_100008538 3300005440 Bacteria 5075
36 Ga0070705_100049320 3300005440 Bacteria 2444
37 Ga0070705_101216871 3300005440 Unclassified 621
38 Ga0070700_100004634 3300005441 Bacteria 7201
39 Ga0070694_100016161 3300005444 Bacteria 4697
40 Ga0070694_100322104 3300005444 Bacteria 1190
41 Ga0070708_100973239 3300005445 Unclassified 796
42 Ga0070663_101414691 3300005455 Bacteria 616
43 Ga0070678_100366441 3300005456 Bacteria 1243
44 Ga0070662_101634122 3300005457 Bacteria 556
45 Ga0070681_10014084 3300005458 Bacteria 7959
46 Ga0068867_100020509 3300005459 Bacteria 4710
47 Ga0068867_100291334 3300005459 Bacteria 1342
48 Ga0068867_101323524 3300005459 Unclassified 666
49 Ga0070685_10137119 3300005466 Bacteria 1536
50 Ga0070706_101573581 3300005467 Unclassified 600
51 Ga0070707_100300580 3300005468 Bacteria 1560
52 Ga0070707_100628236 3300005468 Unclassified 1037
53 Ga0070707_100785895 3300005468 Bacteria 916
54 Ga0070698_100261552 3300005471 Bacteria 1663
55 Ga0070698_100511472 3300005471 Unclassified 1139
56 Ga0070699_100012071 3300005518 Bacteria 7454
57 Ga0070679_100118975 3300005530 Bacteria 2626
58 Ga0070684_100381209 3300005535 Bacteria 1299
59 Ga0070697_100109297 3300005536 Bacteria 2302
60 Ga0068853_100350715 3300005539 Bacteria 1373
61 Ga0070672_100018280 3300005543 Bacteria 5062
62 Ga0070672_100064039 3300005543 Bacteria 2904
63 Ga0070686_100091119 3300005544 Bacteria 2039
64 Ga0070696_101107151 3300005546 Unclassified 666
65 Ga0070693_100027914 3300005547 Bacteria 3064
66 Ga0070665_100283095 3300005548 Bacteria 1660
67 Ga0070704_100126140 3300005549 Bacteria 1975
68 Ga0070704_100207074 3300005549 Bacteria 1587
69 Ga0070704_100484179 3300005549 Unclassified 1071
70 Ga0068855_100337621 3300005563 Unclassified 1662
71 Ga0068855_100395143 3300005563 Bacteria 1516
72 Ga0068857_100021787 3300005577 Bacteria 5640
73 Ga0068857_100030084 3300005577 Bacteria 4792
74 Ga0068857_100476672 3300005577 Bacteria 1169
75 Ga0068856_100859927 3300005614 Unclassified 926
76 Ga0070702_100026438 3300005615 Bacteria 3118
77 Ga0068859_100035295 3300005617 Bacteria 5018
78 Ga0068859_100578047 3300005617 Bacteria 1217
79 Ga0068859_101229772 3300005617 Bacteria 825
80 Ga0068864_100042605 3300005618 Bacteria 3885
81 Ga0068864_101616156 3300005618 Unclassified 652
82 Ga0068866_10589143 3300005718 Bacteria 749
83 Ga0068866_10956136 3300005718 Unclassified 606
84 Ga0068861_100060476 3300005719 Bacteria 2903
85 Ga0068861_101422278 3300005719 Bacteria 678
86 Ga0068860_100050907 3300005843 Bacteria 3942
87 Ga0068860_100114472 3300005843 Bacteria 2579
88 Ga0068860_100803431 3300005843 Bacteria 954
89 Ga0068862_101020639 3300005844 Bacteria 819
90 Ga0081455_10040477 3300005937 Bacteria 4109
91 Ga0075432_10308141 3300006058 Bacteria 659
92 Ga0070715_10585302 3300006163 Bacteria 652
93 Ga0097621_100681750 3300006237 Bacteria 945
94 Ga0068871_100000309 3300006358 Bacteria 33960
95 Ga0075428_100109446 3300006844 Bacteria 3010
96 Ga0075428_100342182 3300006844 Bacteria 1606
97 Ga0075430_100390325 3300006846 Bacteria 1149
98 Ga0075433_10273703 3300006852 Bacteria 1496
99 Ga0075433_10471547 3300006852 Bacteria 1106
100 Ga0075433_10498840 3300006852 Bacteria 1072
101 Ga0075433_10773079 3300006852 Bacteria 840
102 Ga0075434_100021506 3300006871 Bacteria 6270
103 Ga0075434_100193103 3300006871 Unclassified 2056
104 Ga0075434_100581171 3300006871 Bacteria 1139
105 Ga0075434_100923421 3300006871 Bacteria 887
106 Ga0075429_101047826 3300006880 Bacteria 713
107 Ga0068865_100081855 3300006881 Bacteria 2320
108 Ga0068865_101859211 3300006881 Unclassified 545
109 Ga0075436_100030190 3300006914 Bacteria 3731
110 Ga0097620_100035295 3300006931 Bacteria 5018
111 Ga0097620_100577986 3300006931 Bacteria 1217
112 Ga0097620_101229845 3300006931 Bacteria 825
113 Ga0075435_100001374 3300007076 Bacteria 15713
114 Ga0075435_100013307 3300007076 Bacteria 6115
115 Ga0075435_100033772 3300007076 Bacteria 4048
116 Ga0075435_100042247 3300007076 Bacteria 3647
117 Ga0075435_100293356 3300007076 Bacteria 1390
118 Ga0105240_10402812 3300009093 Bacteria 1541
119 Ga0111539_10391235 3300009094 Bacteria 1619
120 Ga0111539_10528894 3300009094 Unclassified 1374
121 Ga0111539_11937408 3300009094 Bacteria 683
122 Ga0105245_10592901 3300009098 Bacteria 1134
123 Ga0105245_10975087 3300009098 Bacteria 891
124 Ga0114129_10269195 3300009147 Bacteria 2280
125 Ga0114129_10323095 3300009147 Bacteria 2051
126 Ga0114129_12689155 3300009147 Bacteria 593
127 Ga0105243_10954838 3300009148 Bacteria 857
128 Ga0105243_11009872 3300009148 Bacteria 835
129 Ga0105243_11774213 3300009148 Bacteria 648
130 Ga0105243_12220319 3300009148 Bacteria 586
131 Ga0105241_10651184 3300009174 Bacteria 957
132 Ga0105242_10196245 3300009176 Bacteria 1790
133 Ga0105242_10328129 3300009176 Bacteria 1406
134 Ga0105242_12067552 3300009176 Unclassified 613
135 Ga0105248_10012170 3300009177 Bacteria 9490
136 Ga0105237_10495585 3300009545 Unclassified 1228
137 Ga0105249_10262286 3300009553 Bacteria 1717
138 Ga0105249_12590202 3300009553 Bacteria 579
139 Ga0157323_1008062 3300012495 Bacteria 775
140 Ga0157324_1053000 3300012506 Bacteria 533
141 Ga0157374_10659837 3300013296 Bacteria 1058
142 Ga0163162_10669442 3300013306 Bacteria 1161
143 Ga0163162_11431050 3300013306 Unclassified 787
144 Ga0157375_10252693 3300013308 Bacteria 1924
145 Ga0163163_10240445 3300014325 Bacteria 1860
146 Ga0157380_10730939 3300014326 Unclassified 999
147 Ga0157380_11569056 3300014326 Bacteria 713
148 Ga0157377_10181936 3300014745 Bacteria 1322
149 Ga0157379_10031572 3300014968 Bacteria 4720
150 Ga0157376_10075382 3300014969 Bacteria 2879
151 Ga0157376_10146747 3300014969 Bacteria 2123
152 Ga0182006_1126200 3300015261 Bacteria 884
153 Ga0207682_10034688 3300025893 Bacteria 2035
154 Ga0207692_10903103 3300025898 Bacteria 581
155 Ga0207642_10952797 3300025899 Unclassified 551
156 Ga0207688_10415563 3300025901 Unclassified 835
157 Ga0207688_10706160 3300025901 Unclassified 638
158 Ga0207699_10434659 3300025906 Bacteria 939
159 Ga0207684_11183496 3300025910 Unclassified 633
160 Ga0207707_10009692 3300025912 Bacteria 8356
161 Ga0207671_10639324 3300025914 Bacteria 847
162 Ga0207671_11094174 3300025914 Bacteria 626
163 Ga0207663_10069646 3300025916 Bacteria 2264
164 Ga0207660_10218782 3300025917 Bacteria 1494
165 Ga0207660_10705353 3300025917 Bacteria 823
166 Ga0207662_10048984 3300025918 Bacteria 2505
167 Ga0207657_10035585 3300025919 Bacteria 4463
168 Ga0207652_10473363 3300025921 Bacteria 1128
169 Ga0207681_10056854 3300025923 Bacteria 2670
170 Ga0207650_10019346 3300025925 Bacteria 4782
171 Ga0207659_11092273 3300025926 Bacteria 686
172 Ga0207687_10585917 3300025927 Bacteria 939
173 Ga0207686_10201780 3300025934 Bacteria 1425
174 Ga0207704_10086250 3300025938 Bacteria 2047
175 Ga0207704_11147008 3300025938 Unclassified 661
176 Ga0207711_10159707 3300025941 Bacteria 2039
177 Ga0207679_10079401 3300025945 Bacteria 2502
178 Ga0207679_10258133 3300025945 Bacteria 1485
179 Ga0207679_11185576 3300025945 Bacteria 701
180 Ga0207651_10076492 3300025960 Bacteria 2393
181 Ga0207651_10501381 3300025960 Bacteria 1049
182 Ga0207668_10872000 3300025972 Bacteria 800
183 Ga0207658_11971641 3300025986 Bacteria 532
184 Ga0207677_10458079 3300026023 Bacteria 1094
185 Ga0207678_10478490 3300026067 Unclassified 1084
186 Ga0207678_11035929 3300026067 Bacteria 726
187 Ga0207678_11056551 3300026067 Unclassified 719
188 Ga0207708_10009239 3300026075 Bacteria 7298
189 Ga0207708_10831495 3300026075 Bacteria 796
190 Ga0207648_10025195 3300026089 Bacteria 5303
191 Ga0207648_10230150 3300026089 Bacteria 1649
192 Ga0207676_10074175 3300026095 Bacteria 2740
193 Ga0207674_10212588 3300026116 Bacteria 1883
194 Ga0207674_10261853 3300026116 Bacteria 1676
195 Ga0207675_100002502 3300026118 Bacteria 18179
196 Ga0207675_101212767 3300026118 Bacteria 775
197 Ga0207675_101777323 3300026118 Unclassified 636
198 Ga0207683_11171447 3300026121 Bacteria 712
199 Ga0207698_12364142 3300026142 Unclassified 543
200 Ga0207428_10111115 3300027907 Bacteria 2109
201 Ga0207428_10418162 3300027907 Bacteria 980
202 Ga0268266_10834225 3300028379 Bacteria 891
203 Ga0268264_11307529 3300028381 Unclassified 735
204 Ga0265332_10072831 3300031238 Bacteria 1462
205 Ga0265328_10095057 3300031239 Bacteria 1102
206 Ga0307408_101539243 3300031548 Unclassified 630
207 Ga0265314_10012919 3300031711 Bacteria 6782
208 Ga0307407_10574841 3300031903 Unclassified 836
209 Ga0307409_101395121 3300031995 Bacteria 727
210 Ga0373934_0245239 3300035086 Unclassified 740
211 Ga0373932_0014900 3300035112 Bacteria 1963
212 Ga0373956_0069736 3300035119 Bacteria 1603
213 Ga0373946_0116141 3300035171 Bacteria 1217
214 Ga0373955_0166059 3300035172 Bacteria 1305
215 Ga0373942_0128422 3300035207 Bacteria 798
216 Ga0373962_0107326 3300035242 Bacteria 877
217 Ga0373962_0362822 3300035242 Bacteria 526
218 Ga0373931_0397013 3300035691 Bacteria 872
219 Ga0373931_0939651 3300035691 Unclassified 583
220 Ga0373935_0193114 3300035692 Bacteria 1403
221 Ga0373927_0133509 3300035695 Bacteria 1622
222 Ga0373947_0195612 3300035725 Unclassified 1321
223 Ga0373947_1070507 3300035725 Bacteria 550
224 Ga0373937_0393477 3300036401 Unclassified 1315
225 Ga0373925_0169284 3300037068 Bacteria 1724
226 Ga0373925_1609527 3300037068 Unclassified 531
227 Ga0395900_0902940 3300037418 Unclassified 807
228 Ga0439460_0052582 3300042461 Bacteria 1225
229 Ga0451577_1262967 3300042876 Unclassified 658
230 Ga0466967_0176813 3300045976 Bacteria 2011
231 Ga0495603_0677524 3300046455 Unclassified 590
232 Ga0495580_0128683 3300046472 Bacteria 1757
233 Ga0495639_0407831 3300046475 Bacteria 687
234 Ga0495628_0465096 3300046516 Bacteria 917
235 Ga0495630_1063378 3300046517 Bacteria 614
236 Ga0495640_0538055 3300046533 Bacteria 709
237 Ga0495587_0792569 3300046536 Unclassified 518
238 Ga0495621_0159693 3300046539 Bacteria 891
239 Ga0495667_0687439 3300046559 Unclassified 634
240 Ga0495659_0265665 3300046664 Bacteria 718
241 Ga0495647_0082135 3300046681 Bacteria 1308
242 Ga0495647_0125727 3300046681 Bacteria 1082
243 Ga0495669_0160804 3300046684 Unclassified 1066
244 Ga0495581_0407166 3300047315 Bacteria 793
245 Ga0496104_0284270 3300048907 Unclassified 1567
246 Ga0496109_0160588 3300048912 Bacteria 2106
247 Ga0496109_1825321 3300048912 Unclassified 541
248 Ga0496110_0140285 3300048913 Bacteria 2185
249 Ga0496112_0188031 3300048915 Unclassified 2028
250 Ga0496112_1113137 3300048915 Unclassified 708
251 Ga0496113_0493342 3300048916 Bacteria 983
252 Ga0496113_0501360 3300048916 Unclassified 975
253 Ga0501034_0220225 3300049571 Bacteria 1851
254 Ga0501043_0151762 3300049579 Bacteria 1813
255 Ga0501047_0033823 3300049581 Bacteria 4934
256 Ga0501048_0179679 3300049582 Unclassified 1500
257 Ga0501073_0107360 3300049589 Unclassified 1937
258 Ga0501077_0550703 3300049593 Bacteria 740
259 Ga0501079_0496453 3300049741 Bacteria 959
260 Ga0501079_1595753 3300049741 Unclassified 513
261 Ga0501044_0009809 3300049823 Bacteria 10412
262 nmdc:mga05p37_1224047_c1 3300050507 Bacteria 773
263 nmdc:mga05p37_1671533_c1 3300050507 Bacteria 623
264 nmdc:mga05p37_907209_c1 3300050507 Unclassified 949
265 nmdc:mga09592_155456_c1 3300050508 Bacteria 1974
266 nmdc:mga0qj67_303671_c1 3300050509 Bacteria 1293
267 nmdc:mga06r32_1804012_c1 3300050510 Unclassified 547
268 nmdc:mga08y16_82075_c1 3300050511 Bacteria 3361
269 nmdc:mga08y16_997132_c1 3300050511 Bacteria 818
270 nmdc:mga0n895_1474618_c1 3300050512 Bacteria 647
271 nmdc:mga0n895_252241_c1 3300050512 Bacteria 1791
272 nmdc:mga0n895_279610_c1 3300050512 Bacteria 1693
273 nmdc:mga0n895_875079_c1 3300050512 Bacteria 885
274 nmdc:mga0rr50_223743_c1 3300050513 Bacteria 1555
275 nmdc:mga0rr50_549553_c1 3300050513 Bacteria 983
276 nmdc:mga0rr50_672596_c1 3300050513 Archaea 883
277 nmdc:mga0rr50_83129_c1 3300050513 Bacteria 2475
278 nmdc:mga08x19_152098_c1 3300050514 Bacteria 1568
279 nmdc:mga08x19_636480_c1 3300050514 Unclassified 756
280 nmdc:mga08x19_64829_c1 3300050514 Bacteria 2372
281 nmdc:mga0a205_1535117_c1 3300050515 Unclassified 514
282 nmdc:mga0a205_28021_c1 3300050515 Bacteria 5382
283 nmdc:mga0a205_656276_c1 3300050515 Unclassified 900
284 nmdc:mga0a205_708591_c1 3300050515 Bacteria 856
285 Ga0495601_0160775 3300053077 Bacteria 1468
286 Ga0495595_0397621 3300053084 Bacteria 698
287 Ga0495619_0045136 3300053085 Unclassified 2895
288 Ga0495619_0081387 3300053085 Bacteria 2180
289 Ga0495619_0504831 3300053085 Unclassified 832
290 Ga0501082_0982327 3300060353 Bacteria 738
291 Ga0530510_0071756 3300061734 Bacteria 2514
292 Ga0070696_101016711
293 JGI24751J29686_10002775
294 Ga0065712_10098501
295 Ga0065715_10552248
296 Ga0070676_11424205
297 Ga0070690_100544816
298 Ga0070670_100030708
299 Ga0068869_100918933
300 Ga0070666_10030150
301 Ga0070680_100197722
302 Ga0070680_101118246
303 Ga0068868_100824048
304 Ga0070660_100344181
305 Ga0070689_100225108
306 Ga0070689_101285406
307 Ga0070691_10402626
308 Ga0070687_100015499
309 Ga0070687_100032644
310 Ga0070692_10093685
311 Ga0070668_100587484
312 Ga0070668_100891028
313 Ga0070669_100010930
314 Ga0070669_100716209
315 Ga0070671_100061184
316 Ga0070673_100018283
317 Ga0070673_100062160
318 Ga0070688_100005679
319 Ga0070659_100003218
320 Ga0070667_100089050
321 Ga0070667_101080180
322 Ga0070703_10106380
323 Ga0070709_10157733
324 Ga0070709_10412939
325 Ga0070711_100095529
326 Ga0070705_100008538
327 Ga0070705_100049320
328 Ga0070705_101216871
329 Ga0070700_100004634
330 Ga0070694_100016161
331 Ga0070694_100322104
332 Ga0070708_100973239
333 Ga0070663_101414691
334 Ga0070678_100366441
335 Ga0070662_101634122
336 Ga0070681_10014084
337 Ga0068867_100020509
338 Ga0068867_100291334
339 Ga0068867_101323524
340 Ga0070685_10137119
341 Ga0070706_101573581
342 Ga0070707_100300580
343 Ga0070707_100628236
344 Ga0070707_100785895
345 Ga0070698_100261552
346 Ga0070698_100511472
347 Ga0070699_100012071
348 Ga0070679_100118975
349 Ga0070684_100381209
350 Ga0070697_100109297
351 Ga0068853_100350715
352 Ga0070672_100018280
353 Ga0070672_100064039
354 Ga0070686_100091119
355 Ga0070696_101107151
356 Ga0070693_100027914
357 Ga0070665_100283095
358 Ga0070704_100126140
359 Ga0070704_100207074
360 Ga0070704_100484179
361 Ga0068855_100337621
362 Ga0068855_100395143
363 Ga0068857_100021787
364 Ga0068857_100030084
365 Ga0068857_100476672
366 Ga0068856_100859927
367 Ga0070702_100026438
368 Ga0068859_100035295
369 Ga0068859_100578047
370 Ga0068859_101229772
371 Ga0068864_100042605
372 Ga0068864_101616156
373 Ga0068866_10589143
374 Ga0068866_10956136
375 Ga0068861_100060476
376 Ga0068861_101422278
377 Ga0068860_100050907
378 Ga0068860_100114472
379 Ga0068860_100803431
380 Ga0068862_101020639
381 Ga0081455_10040477
382 Ga0075432_10308141
383 Ga0070715_10585302
384 Ga0097621_100681750
385 Ga0068871_100000309
386 Ga0075428_100109446
387 Ga0075428_100342182
388 Ga0075430_100390325
389 Ga0075433_10273703
390 Ga0075433_10471547
391 Ga0075433_10498840
392 Ga0075433_10773079
393 Ga0075434_100021506
394 Ga0075434_100193103
395 Ga0075434_100581171
396 Ga0075434_100923421
397 Ga0075429_101047826
398 Ga0068865_100081855
399 Ga0068865_101859211
400 Ga0075436_100030190
401 Ga0097620_100035295
402 Ga0097620_100577986
403 Ga0097620_101229845
404 Ga0075435_100001374
405 Ga0075435_100013307
406 Ga0075435_100033772
407 Ga0075435_100042247
408 Ga0075435_100293356
409 Ga0105240_10402812
410 Ga0111539_10391235
411 Ga0111539_10528894
412 Ga0111539_11937408
413 Ga0105245_10592901
414 Ga0105245_10975087
415 Ga0114129_10269195
416 Ga0114129_10323095
417 Ga0114129_12689155
418 Ga0105243_10954838
419 Ga0105243_11009872
420 Ga0105243_11774213
421 Ga0105243_12220319
422 Ga0105241_10651184
423 Ga0105242_10196245
424 Ga0105242_10328129
425 Ga0105242_12067552
426 Ga0105248_10012170
427 Ga0105237_10495585
428 Ga0105249_10262286
429 Ga0105249_12590202
430 Ga0157323_1008062
431 Ga0157324_1053000
432 Ga0157374_10659837
433 Ga0163162_10669442
434 Ga0163162_11431050
435 Ga0157375_10252693
436 Ga0163163_10240445
437 Ga0157380_10730939
438 Ga0157380_11569056
439 Ga0157377_10181936
440 Ga0157379_10031572
441 Ga0157376_10075382
442 Ga0157376_10146747
443 Ga0182006_1126200
444 Ga0207682_10034688
445 Ga0207692_10903103
446 Ga0207642_10952797
447 Ga0207688_10415563
448 Ga0207688_10706160
449 Ga0207699_10434659
450 Ga0207684_11183496
451 Ga0207707_10009692
452 Ga0207671_10639324
453 Ga0207671_11094174
454 Ga0207663_10069646
455 Ga0207660_10218782
456 Ga0207660_10705353
457 Ga0207662_10048984
458 Ga0207657_10035585
459 Ga0207652_10473363
460 Ga0207681_10056854
461 Ga0207650_10019346
462 Ga0207659_11092273
463 Ga0207687_10585917
464 Ga0207686_10201780
465 Ga0207704_10086250
466 Ga0207704_11147008
467 Ga0207711_10159707
468 Ga0207679_10079401
469 Ga0207679_10258133
470 Ga0207679_11185576
471 Ga0207651_10076492
472 Ga0207651_10501381
473 Ga0207668_10872000
474 Ga0207658_11971641
475 Ga0207677_10458079
476 Ga0207678_10478490
477 Ga0207678_11035929
478 Ga0207678_11056551
479 Ga0207708_10009239
480 Ga0207708_10831495
481 Ga0207648_10025195
482 Ga0207648_10230150
483 Ga0207676_10074175
484 Ga0207674_10212588
485 Ga0207674_10261853
486 Ga0207675_100002502
487 Ga0207675_101212767
488 Ga0207675_101777323
489 Ga0207683_11171447
490 Ga0207698_12364142
491 Ga0207428_10111115
492 Ga0207428_10418162
493 Ga0268266_10834225
494 Ga0268264_11307529
495 Ga0265332_10072831
496 Ga0265328_10095057
497 Ga0307408_101539243
498 Ga0265314_10012919
499 Ga0307407_10574841
500 Ga0307409_101395121
501 Ga0373934_0245239
502 Ga0373932_0014900
503 Ga0373956_0069736
504 Ga0373946_0116141
505 Ga0373955_0166059
506 Ga0373942_0128422
507 Ga0373962_0107326
508 Ga0373962_0362822
509 Ga0373931_0397013
510 Ga0373931_0939651
511 Ga0373935_0193114
512 Ga0373927_0133509
513 Ga0373947_0195612
514 Ga0373947_1070507
515 Ga0373937_0393477
516 Ga0373925_0169284
517 Ga0373925_1609527
518 Ga0395900_0902940
519 Ga0439460_0052582
520 Ga0451577_1262967
521 Ga0466967_0176813
522 Ga0495603_0677524
523 Ga0495580_0128683
524 Ga0495639_0407831
525 Ga0495628_0465096
526 Ga0495630_1063378
527 Ga0495640_0538055
528 Ga0495587_0792569
529 Ga0495621_0159693
530 Ga0495667_0687439
531 Ga0495659_0265665
532 Ga0495647_0082135
533 Ga0495647_0125727
534 Ga0495669_0160804
535 Ga0495581_0407166
536 Ga0496104_0284270
537 Ga0496109_0160588
538 Ga0496109_1825321
539 Ga0496110_0140285
540 Ga0496112_0188031
541 Ga0496112_1113137
542 Ga0496113_0493342
543 Ga0496113_0501360
544 Ga0501034_0220225
545 Ga0501043_0151762
546 Ga0501047_0033823
547 Ga0501048_0179679
548 Ga0501073_0107360
549 Ga0501077_0550703
550 Ga0501079_0496453
551 Ga0501079_1595753
552 Ga0501044_0009809
553 nmdc:mga05p37_1224047_c1
554 nmdc:mga05p37_1671533_c1
555 nmdc:mga05p37_907209_c1
556 nmdc:mga09592_155456_c1
557 nmdc:mga0qj67_303671_c1
558 nmdc:mga06r32_1804012_c1
559 nmdc:mga08y16_82075_c1
560 nmdc:mga08y16_997132_c1
561 nmdc:mga0n895_1474618_c1
562 nmdc:mga0n895_252241_c1
563 nmdc:mga0n895_279610_c1
564 nmdc:mga0n895_875079_c1
565 nmdc:mga0rr50_223743_c1
566 nmdc:mga0rr50_549553_c1
567 nmdc:mga0rr50_672596_c1
568 nmdc:mga0rr50_83129_c1
569 nmdc:mga08x19_152098_c1
570 nmdc:mga08x19_636480_c1
571 nmdc:mga08x19_64829_c1
572 nmdc:mga0a205_1535117_c1
573 nmdc:mga0a205_28021_c1
574 nmdc:mga0a205_656276_c1
575 nmdc:mga0a205_708591_c1
576 Ga0495601_0160775
577 Ga0495595_0397621
578 Ga0495619_0045136
579 Ga0495619_0081387
580 Ga0495619_0504831
581 Ga0501082_0982327
582 Ga0530510_0071756

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02410

RsfS

Ribosomal silencing factor during starvation

18

113

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sj6-assembly1.cif.gz_9 cryo-em structure of 50s-rsfs complex from staphylococcus aureus 0.926 17 122
2o5a-assembly1.cif.gz_B crystal structure of q9kd89 from bacillus halodurans. northeast structural genomics target bhr21 0.9213 17 122
4wcw-assembly1.cif.gz_B ribosomal silencing factor during starvation or stationary phase (rsfs) from mycobacterium tuberculosis 0.9123 16 118
7bl5-assembly1.cif.gz_6 pre-50s-obge particle 0.8984 21 108
2id1-assembly2.cif.gz_B x-ray crystal structure of protein cv0518 from chromobacterium violaceum, northeast structural genomics consortium target cvr5. 0.8828 16 124
ID Description Score Start End Superfamily
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9524 16 115 3.30.460.10
2id1B01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9509 16 115 3.30.460.10
2o5aB01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9281 17 114 3.30.460.10
4wcwD01 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9133 16 118 3.30.460.10
af_P0AAT6_2_105_3.30.460.10 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2;Beta Polymerase, domain 2 0.9087 16 115 3.30.460.10
ID Description Score Start End GO Terms
AF-A0A7W0LFW5-F1-model_v4 Ribosomal silencing factor RsfS 0.9839 12 123 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A7Z9TD47-F1-model_v4 Ribosomal silencing factor RsfS 0.9836 12 123 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A356IGD7-F1-model_v4 Ribosomal silencing factor RsfS 0.9827 11 124 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A1Q7REH0-F1-model_v4 Ribosomal silencing factor RsfS 0.9822 12 123 GO:0003677
GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071
AF-A0A7C6QFV1-F1-model_v4 Ribosomal silencing factor RsfS 0.9801 16 120 GO:0005737
GO:0017148
GO:0042256
GO:0043023
GO:0090071

Map