F390175

General Info

Members Datasets Scaffolds Average Seq Length
291 156 582 142

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10162951|Ga0070666_101629512
Length 161
Sequence MSGGAALGFAGALLPEELEMHTFESEAAVEHIGLRLLDRTLPKSEWTHAAHFAAAFWLLRRPGVDAVRELPGIIRAYNEATGVPNTDSGGYHETITMASLRAARAWLAARPGDALHTAVNGLLRSEFGRSDWLLTYWSKPVLFSVDARRGWLEPNLRALPF

Samples

Sample ID Description Type Environment
1 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
37 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
105 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
106 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
107 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
108 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
109 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
110 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
113 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
114 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
118 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
119 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
120 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
121 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
124 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
125 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
126 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
139 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
140 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
141 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
142 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
143 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
144 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
147 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
148 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
149 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
150 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
151 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
152 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
153 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
154 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
155 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
156 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.81
Nodule 0
Rhizoplane 4.81
Rhizosphere 87.29
Stem 0
Stem Tuber 0
Unclassified 22.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070666_10162951 3300005335 Bacteria 1559
2 JGI24750J21931_1060791 3300002070 Unclassified 604
3 rootH1_10067996 3300003316 Bacteria 1869
4 rootH2_10078108 3300003320 Bacteria 1612
5 rootH2_10106626 3300003320 Bacteria 4700
6 Ga0070683_100073194 3300005329 Bacteria 3199
7 Ga0070683_100737376 3300005329 Bacteria 944
8 Ga0070683_100847956 3300005329 Unclassified 876
9 Ga0070670_100000062 3300005331 Bacteria 112560
10 Ga0070670_100472052 3300005331 Unclassified 1113
11 Ga0070666_10008063 3300005335 Bacteria 6519
12 Ga0070666_10095975 3300005335 Bacteria 2040
13 Ga0070666_10253801 3300005335 Bacteria 1245
14 Ga0070680_100014451 3300005336 Bacteria 6173
15 Ga0070680_100286603 3300005336 Bacteria 1396
16 Ga0070682_100506493 3300005337 Bacteria 936
17 Ga0070682_100722196 3300005337 Unclassified 801
18 Ga0070691_10328508 3300005341 Bacteria 843
19 Ga0070668_100002583 3300005347 Bacteria 13311
20 Ga0070688_100214125 3300005365 Bacteria 1354
21 Ga0070659_100628720 3300005366 Unclassified 924
22 Ga0070667_100000178 3300005367 Bacteria 77450
23 Ga0070667_100136308 3300005367 Bacteria 2146
24 Ga0070667_100713011 3300005367 Unclassified 929
25 Ga0070714_100600205 3300005435 Unclassified 1057
26 Ga0070714_101316123 3300005435 Bacteria 705
27 Ga0070713_100173666 3300005436 Unclassified 1932
28 Ga0070713_100247206 3300005436 Unclassified 1626
29 Ga0070713_100923173 3300005436 Unclassified 840
30 Ga0070711_100078960 3300005439 Bacteria 2340
31 Ga0070662_100020574 3300005457 Bacteria 4496
32 Ga0070681_10115563 3300005458 Bacteria 2621
33 Ga0070681_10783269 3300005458 Bacteria 870
34 Ga0070681_11009827 3300005458 Unclassified 752
35 Ga0070681_11101862 3300005458 Bacteria 715
36 Ga0070698_100864914 3300005471 Bacteria 849
37 Ga0070679_100011659 3300005530 Bacteria 8377
38 Ga0070679_100100124 3300005530 Bacteria 2885
39 Ga0070679_100237125 3300005530 Bacteria 1782
40 Ga0070679_100373414 3300005530 Unclassified 1373
41 Ga0070684_100208959 3300005535 Bacteria 1779
42 Ga0070686_100206685 3300005544 Bacteria 1411
43 Ga0070665_100003233 3300005548 Bacteria 17513
44 Ga0070665_100027759 3300005548 Bacteria 5699
45 Ga0068855_100002741 3300005563 Bacteria 21693
46 Ga0068855_100169871 3300005563 Bacteria 2470
47 Ga0068855_100422445 3300005563 Bacteria 1458
48 Ga0068856_100081984 3300005614 Bacteria 3201
49 Ga0068856_101240952 3300005614 Unclassified 761
50 Ga0068856_102369363 3300005614 Unclassified 538
51 Ga0068859_100067171 3300005617 Bacteria 3620
52 Ga0068859_100084651 3300005617 Unclassified 3216
53 Ga0068864_100001712 3300005618 Bacteria 18017
54 Ga0068863_100001240 3300005841 Bacteria 25427
55 Ga0068863_100007656 3300005841 Bacteria 10563
56 Ga0068863_100307273 3300005841 Bacteria 1539
57 Ga0068858_100004534 3300005842 Bacteria 13611
58 Ga0068858_100008984 3300005842 Bacteria 9568
59 Ga0068858_100043107 3300005842 Bacteria 4184
60 Ga0068860_100000452 3300005843 Bacteria 51890
61 Ga0068860_100003117 3300005843 Bacteria 17133
62 Ga0068862_100003171 3300005844 Bacteria 14270
63 Ga0068862_100479818 3300005844 Bacteria 1177
64 Ga0070717_10011253 3300006028 Bacteria 6788
65 Ga0070715_10047973 3300006163 Unclassified 1823
66 Ga0070716_100656676 3300006173 Unclassified 796
67 Ga0075362_10020982 3300006177 Bacteria 2735
68 Ga0075370_10083024 3300006353 Bacteria 1843
69 Ga0097620_100067173 3300006931 Bacteria 3620
70 Ga0097620_100084654 3300006931 Unclassified 3216
71 Ga0105240_10002022 3300009093 Bacteria 33438
72 Ga0105240_10027248 3300009093 Bacteria 7484
73 Ga0105240_10046125 3300009093 Bacteria 5523
74 Ga0105240_10088648 3300009093 Bacteria 3785
75 Ga0105240_10169467 3300009093 Bacteria 2587
76 Ga0105240_10354152 3300009093 Unclassified 1665
77 Ga0105240_10500733 3300009093 Bacteria 1351
78 Ga0105247_10089320 3300009101 Bacteria 1954
79 Ga0105247_10138145 3300009101 Bacteria 1594
80 Ga0105247_10178213 3300009101 Bacteria 1417
81 Ga0105241_10519516 3300009174 Bacteria 1064
82 Ga0105241_10522381 3300009174 Bacteria 1062
83 Ga0105241_10784415 3300009174 Bacteria 876
84 Ga0105248_10001644 3300009177 Bacteria 24861
85 Ga0105248_10026310 3300009177 Bacteria 6473
86 Ga0105248_10072232 3300009177 Bacteria 3878
87 Ga0105248_10285602 3300009177 Bacteria 1858
88 Ga0105237_10069012 3300009545 Bacteria 3529
89 Ga0105237_10098468 3300009545 Bacteria 2915
90 Ga0105237_10152791 3300009545 Bacteria 2305
91 Ga0105237_10162598 3300009545 Bacteria 2231
92 Ga0105238_10001369 3300009551 Bacteria 24451
93 Ga0105238_10024604 3300009551 Bacteria 6137
94 Ga0105238_10027607 3300009551 Bacteria 5785
95 Ga0105249_10006778 3300009553 Bacteria 9980
96 Ga0105249_10458005 3300009553 Bacteria 1315
97 Ga0105239_10123426 3300010375 Bacteria 2877
98 Ga0105239_10152106 3300010375 Bacteria 2583
99 Ga0105239_10168010 3300010375 Bacteria 2453
100 Ga0105239_10589081 3300010375 Bacteria 1268
101 Ga0105239_10615980 3300010375 Bacteria 1239
102 Ga0105239_11096404 3300010375 Bacteria 916
103 Ga0157373_10501611 3300013100 Unclassified 877
104 Ga0157370_10050258 3300013104 Bacteria 3985
105 Ga0157370_10075804 3300013104 Bacteria 3170
106 Ga0157369_10001397 3300013105 Bacteria 29665
107 Ga0157369_10024097 3300013105 Bacteria 6773
108 Ga0157369_10748712 3300013105 Bacteria 1005
109 Ga0157369_11266363 3300013105 Bacteria 752
110 Ga0157374_10267833 3300013296 Bacteria 1684
111 Ga0163162_10014148 3300013306 Bacteria 7797
112 Ga0163162_10400150 3300013306 Bacteria 1506
113 Ga0157372_10154467 3300013307 Bacteria 2650
114 Ga0157372_10527633 3300013307 Bacteria 1376
115 Ga0157372_10643551 3300013307 Unclassified 1235
116 Ga0163163_10128805 3300014325 Bacteria 2570
117 Ga0163163_10222930 3300014325 Bacteria 1934
118 Ga0163163_11253845 3300014325 Unclassified 804
119 Ga0157380_10000318 3300014326 Bacteria 29048
120 Ga0157379_10035891 3300014968 Unclassified 4421
121 Ga0157379_10095386 3300014968 Bacteria 2669
122 Ga0157379_10195726 3300014968 Unclassified 1827
123 Ga0157376_11618203 3300014969 Unclassified 682
124 Ga0209565_1055072 3300025263 Bacteria 703
125 Ga0207710_10101350 3300025900 Bacteria 1358
126 Ga0207680_10006677 3300025903 Bacteria 5598
127 Ga0207680_10070112 3300025903 Bacteria 2168
128 Ga0207680_10091256 3300025903 Bacteria 1938
129 Ga0207680_10409595 3300025903 Unclassified 959
130 Ga0207647_10047069 3300025904 Bacteria 2684
131 Ga0207685_10335892 3300025905 Unclassified 758
132 Ga0207699_10278815 3300025906 Unclassified 1161
133 Ga0207705_10421259 3300025909 Bacteria 1034
134 Ga0207654_10145689 3300025911 Bacteria 1515
135 Ga0207654_10325669 3300025911 Bacteria 1051
136 Ga0207654_10959647 3300025911 Bacteria 621
137 Ga0207707_10000411 3300025912 Bacteria 44888
138 Ga0207707_10009347 3300025912 Bacteria 8502
139 Ga0207707_10407624 3300025912 Bacteria 1166
140 Ga0207695_10007852 3300025913 Bacteria 13481
141 Ga0207695_10031486 3300025913 Bacteria 5816
142 Ga0207695_10077507 3300025913 Bacteria 3375
143 Ga0207695_10249951 3300025913 Unclassified 1673
144 Ga0207695_10558446 3300025913 Unclassified 1026
145 Ga0207695_10819122 3300025913 Bacteria 811
146 Ga0207671_10040418 3300025914 Unclassified 3453
147 Ga0207671_10110102 3300025914 Bacteria 2095
148 Ga0207671_10166767 3300025914 Bacteria 1708
149 Ga0207671_10199266 3300025914 Unclassified 1563
150 Ga0207671_10438258 3300025914 Bacteria 1040
151 Ga0207663_10017451 3300025916 Bacteria 4000
152 Ga0207660_10013954 3300025917 Bacteria 5273
153 Ga0207660_10226579 3300025917 Bacteria 1468
154 Ga0207652_10003804 3300025921 Bacteria 12370
155 Ga0207652_10264699 3300025921 Unclassified 1551
156 Ga0207652_10454876 3300025921 Unclassified 1154
157 Ga0207652_10895407 3300025921 Unclassified 784
158 Ga0207694_10120152 3300025924 Bacteria 2097
159 Ga0207694_10148795 3300025924 Unclassified 1886
160 Ga0207650_10000084 3300025925 Bacteria 125773
161 Ga0207650_10245351 3300025925 Bacteria 1448
162 Ga0207650_10452918 3300025925 Unclassified 1068
163 Ga0207700_10377457 3300025928 Unclassified 1239
164 Ga0207690_10586566 3300025932 Unclassified 909
165 Ga0207706_10040613 3300025933 Bacteria 4123
166 Ga0207665_10146071 3300025939 Unclassified 1690
167 Ga0207711_10000331 3300025941 Bacteria 50472
168 Ga0207711_10025244 3300025941 Bacteria 4986
169 Ga0207711_10112253 3300025941 Bacteria 2425
170 Ga0207711_10268871 3300025941 Bacteria 1568
171 Ga0207661_10313258 3300025944 Bacteria 1409
172 Ga0207661_10358418 3300025944 Bacteria 1317
173 Ga0207661_10598352 3300025944 Bacteria 1012
174 Ga0207667_10024259 3300025949 Bacteria 6662
175 Ga0207667_10205443 3300025949 Bacteria 2020
176 Ga0207712_10001180 3300025961 Bacteria 18078
177 Ga0207712_10503124 3300025961 Bacteria 1036
178 Ga0207668_10000036 3300025972 Bacteria 117190
179 Ga0207658_10000427 3300025986 Bacteria 39977
180 Ga0207658_10274735 3300025986 Bacteria 1442
181 Ga0207658_10334559 3300025986 Bacteria 1314
182 Ga0207703_10000401 3300026035 Bacteria 46568
183 Ga0207703_10008475 3300026035 Bacteria 8124
184 Ga0207639_10927174 3300026041 Bacteria 814
185 Ga0207678_10114927 3300026067 Bacteria 2296
186 Ga0207702_10012418 3300026078 Bacteria 7091
187 Ga0207702_11389210 3300026078 Unclassified 696
188 Ga0207702_12104229 3300026078 Unclassified 554
189 Ga0207641_10001065 3300026088 Bacteria 27670
190 Ga0207641_10001728 3300026088 Bacteria 21094
191 Ga0207641_10899611 3300026088 Bacteria 879
192 Ga0207676_10000102 3300026095 Bacteria 77065
193 Ga0268266_10003063 3300028379 Bacteria 17086
194 Ga0268266_10005296 3300028379 Bacteria 12100
195 Ga0268266_10008852 3300028379 Bacteria 8912
196 Ga0268265_10000635 3300028380 Bacteria 35008
197 Ga0268265_10470384 3300028380 Bacteria 1178
198 Ga0268264_10000179 3300028381 Bacteria 134401
199 Ga0268264_10000284 3300028381 Bacteria 85451
200 Ga0268264_10840107 3300028381 Unclassified 919
201 Ga0268264_11148038 3300028381 Unclassified 786
202 Ga0307511_10014205 3300030521 Bacteria 7751
203 Ga0265328_10002122 3300031239 Bacteria 8945
204 Ga0307509_10674394 3300031507 Bacteria 701
205 Ga0307408_100578709 3300031548 Bacteria 995
206 Ga0307407_10084137 3300031903 Bacteria 1932
207 Ga0307407_10804551 3300031903 Bacteria 715
208 Ga0307411_10220287 3300032005 Bacteria 1472
209 Ga0307411_11157822 3300032005 Unclassified 699
210 Ga0307415_102002227 3300032126 Unclassified 564
211 Ga0307415_102504510 3300032126 Unclassified 508
212 Ga0373923_0618385 3300035111 Bacteria 534
213 Ga0373933_0239147 3300035724 Bacteria 1168
214 Ga0373937_1600121 3300036401 Bacteria 599
215 Ga0373925_0031244 3300037068 Bacteria 3913
216 Ga0373925_0289010 3300037068 Unclassified 1322
217 Ga0395905_0481784 3300037471 Bacteria 1140
218 Ga0436365_0690868 3300039437 Bacteria 855
219 Ga0436360_0217926 3300039438 Unclassified 823
220 Ga0436360_0519380 3300039438 Bacteria 796
221 Ga0439448_0014941 3300042005 Bacteria 2347
222 Ga0439450_107238 3300042008 Unclassified 712
223 Ga0450897_025149 3300042128 Unclassified 655
224 Ga0450894_022715 3300042131 Unclassified 851
225 Ga0439458_0000150 3300042157 Bacteria 15207
226 Ga0439435_0130650 3300042436 Bacteria 793
227 Ga0451577_0570637 3300042876 Bacteria 1027
228 Ga0466969_0043152 3300044656 Unclassified 2247
229 Ga0466969_0292122 3300044656 Bacteria 738
230 Ga0466972_0200310 3300044658 Unclassified 935
231 Ga0466965_0073138 3300044683 Unclassified 1726
232 Ga0466966_0001403 3300044684 Bacteria 15504
233 Ga0466966_0062119 3300044684 Bacteria 2356
234 Ga0466961_0001926 3300044693 Bacteria 12921
235 Ga0466964_0020540 3300044706 Unclassified 2544
236 Ga0466971_0003144 3300044719 Bacteria 7035
237 Ga0466960_0468000 3300044901 Bacteria 735
238 Ga0466959_0008732 3300045049 Bacteria 7175
239 Ga0466959_0012648 3300045049 Bacteria 6103
240 Ga0466959_0136787 3300045049 Bacteria 1734
241 Ga0466959_0155659 3300045049 Bacteria 1609
242 Ga0466958_0118344 3300045836 Unclassified 1657
243 Ga0495638_0016555 3300046460 Bacteria 4935
244 Ga0495638_0016610 3300046460 Bacteria 4925
245 Ga0495638_0112361 3300046460 Bacteria 1617
246 Ga0495650_0000772 3300046471 Bacteria 39497
247 Ga0495607_0030239 3300046501 Bacteria 3327
248 Ga0495606_0000118 3300046507 Bacteria 134504
249 Ga0495610_0003766 3300046512 Bacteria 11594
250 Ga0495633_0175959 3300046558 Bacteria 985
251 Ga0495668_0000137 3300046616 Bacteria 111150
252 Ga0495668_0002114 3300046616 Bacteria 17155
253 Ga0495668_0388436 3300046616 Unclassified 767
254 Ga0495625_0001530 3300046660 Bacteria 27635
255 Ga0495625_0004184 3300046660 Bacteria 13748
256 Ga0495687_055733 3300047443 Bacteria 1651
257 Ga0495686_0004215 3300047472 Bacteria 11938
258 Ga0495686_0004973 3300047472 Bacteria 10688
259 Ga0495686_0205810 3300047472 Bacteria 1127
260 Ga0496100_0513788 3300048903 Unclassified 924
261 Ga0496101_0140266 3300048904 Bacteria 1842
262 Ga0496102_0020584 3300048905 Bacteria 5830
263 Ga0496102_0126354 3300048905 Bacteria 2390
264 Ga0496103_0156176 3300048906 Bacteria 1462
265 Ga0496103_0461637 3300048906 Unclassified 814
266 Ga0496104_0025982 3300048907 Bacteria 5400
267 Ga0496105_0230159 3300048908 Unclassified 1506
268 Ga0496105_0469385 3300048908 Bacteria 991
269 Ga0496111_0431863 3300048914 Bacteria 973
270 Ga0496114_0254725 3300048917 Unclassified 1544
271 Ga0496115_0033238 3300048918 Bacteria 4071
272 Ga0496115_0043519 3300048918 Unclassified 3581
273 Ga0496115_0274369 3300048918 Unclassified 1385
274 Ga0496118_0106905 3300048921 Bacteria 1870
275 Ga0496124_0149569 3300048927 Bacteria 1834
276 Ga0496125_0004230 3300048928 Bacteria 16722
277 Ga0501034_0162546 3300049571 Bacteria 2203
278 Ga0501034_0163260 3300049571 Bacteria 2197
279 Ga0501035_0926593 3300049822 Bacteria 689
280 nmdc:mga03683_702678_c1 3300050489 Bacteria 500
281 nmdc:mga07m45_145842_c1 3300050496 Bacteria 1372
282 Ga0500583_0002513 3300053092 Bacteria 5531
283 Ga0500583_0021489 3300053092 Bacteria 2685
284 Ga0500641_0109056 3300053096 Unclassified 1191
285 Ga0500594_0048618 3300053118 Bacteria 1187
286 Ga0500559_0018793 3300053136 Bacteria 2919
287 Ga0500616_0000073 3300053153 Bacteria 231290
288 Ga0500622_0047132 3300053156 Bacteria 2226
289 Ga0500637_0065322 3300053178 Bacteria 2087
290 Ga0500576_194246 3300053725 Unclassified 699
291 Ga0466962_0001129 3300061719 Bacteria 12338
292 Ga0070666_10162951
293 JGI24750J21931_1060791
294 rootH1_10067996
295 rootH2_10078108
296 rootH2_10106626
297 Ga0070683_100073194
298 Ga0070683_100737376
299 Ga0070683_100847956
300 Ga0070670_100000062
301 Ga0070670_100472052
302 Ga0070666_10008063
303 Ga0070666_10095975
304 Ga0070666_10253801
305 Ga0070680_100014451
306 Ga0070680_100286603
307 Ga0070682_100506493
308 Ga0070682_100722196
309 Ga0070691_10328508
310 Ga0070668_100002583
311 Ga0070688_100214125
312 Ga0070659_100628720
313 Ga0070667_100000178
314 Ga0070667_100136308
315 Ga0070667_100713011
316 Ga0070714_100600205
317 Ga0070714_101316123
318 Ga0070713_100173666
319 Ga0070713_100247206
320 Ga0070713_100923173
321 Ga0070711_100078960
322 Ga0070662_100020574
323 Ga0070681_10115563
324 Ga0070681_10783269
325 Ga0070681_11009827
326 Ga0070681_11101862
327 Ga0070698_100864914
328 Ga0070679_100011659
329 Ga0070679_100100124
330 Ga0070679_100237125
331 Ga0070679_100373414
332 Ga0070684_100208959
333 Ga0070686_100206685
334 Ga0070665_100003233
335 Ga0070665_100027759
336 Ga0068855_100002741
337 Ga0068855_100169871
338 Ga0068855_100422445
339 Ga0068856_100081984
340 Ga0068856_101240952
341 Ga0068856_102369363
342 Ga0068859_100067171
343 Ga0068859_100084651
344 Ga0068864_100001712
345 Ga0068863_100001240
346 Ga0068863_100007656
347 Ga0068863_100307273
348 Ga0068858_100004534
349 Ga0068858_100008984
350 Ga0068858_100043107
351 Ga0068860_100000452
352 Ga0068860_100003117
353 Ga0068862_100003171
354 Ga0068862_100479818
355 Ga0070717_10011253
356 Ga0070715_10047973
357 Ga0070716_100656676
358 Ga0075362_10020982
359 Ga0075370_10083024
360 Ga0097620_100067173
361 Ga0097620_100084654
362 Ga0105240_10002022
363 Ga0105240_10027248
364 Ga0105240_10046125
365 Ga0105240_10088648
366 Ga0105240_10169467
367 Ga0105240_10354152
368 Ga0105240_10500733
369 Ga0105247_10089320
370 Ga0105247_10138145
371 Ga0105247_10178213
372 Ga0105241_10519516
373 Ga0105241_10522381
374 Ga0105241_10784415
375 Ga0105248_10001644
376 Ga0105248_10026310
377 Ga0105248_10072232
378 Ga0105248_10285602
379 Ga0105237_10069012
380 Ga0105237_10098468
381 Ga0105237_10152791
382 Ga0105237_10162598
383 Ga0105238_10001369
384 Ga0105238_10024604
385 Ga0105238_10027607
386 Ga0105249_10006778
387 Ga0105249_10458005
388 Ga0105239_10123426
389 Ga0105239_10152106
390 Ga0105239_10168010
391 Ga0105239_10589081
392 Ga0105239_10615980
393 Ga0105239_11096404
394 Ga0157373_10501611
395 Ga0157370_10050258
396 Ga0157370_10075804
397 Ga0157369_10001397
398 Ga0157369_10024097
399 Ga0157369_10748712
400 Ga0157369_11266363
401 Ga0157374_10267833
402 Ga0163162_10014148
403 Ga0163162_10400150
404 Ga0157372_10154467
405 Ga0157372_10527633
406 Ga0157372_10643551
407 Ga0163163_10128805
408 Ga0163163_10222930
409 Ga0163163_11253845
410 Ga0157380_10000318
411 Ga0157379_10035891
412 Ga0157379_10095386
413 Ga0157379_10195726
414 Ga0157376_11618203
415 Ga0209565_1055072
416 Ga0207710_10101350
417 Ga0207680_10006677
418 Ga0207680_10070112
419 Ga0207680_10091256
420 Ga0207680_10409595
421 Ga0207647_10047069
422 Ga0207685_10335892
423 Ga0207699_10278815
424 Ga0207705_10421259
425 Ga0207654_10145689
426 Ga0207654_10325669
427 Ga0207654_10959647
428 Ga0207707_10000411
429 Ga0207707_10009347
430 Ga0207707_10407624
431 Ga0207695_10007852
432 Ga0207695_10031486
433 Ga0207695_10077507
434 Ga0207695_10249951
435 Ga0207695_10558446
436 Ga0207695_10819122
437 Ga0207671_10040418
438 Ga0207671_10110102
439 Ga0207671_10166767
440 Ga0207671_10199266
441 Ga0207671_10438258
442 Ga0207663_10017451
443 Ga0207660_10013954
444 Ga0207660_10226579
445 Ga0207652_10003804
446 Ga0207652_10264699
447 Ga0207652_10454876
448 Ga0207652_10895407
449 Ga0207694_10120152
450 Ga0207694_10148795
451 Ga0207650_10000084
452 Ga0207650_10245351
453 Ga0207650_10452918
454 Ga0207700_10377457
455 Ga0207690_10586566
456 Ga0207706_10040613
457 Ga0207665_10146071
458 Ga0207711_10000331
459 Ga0207711_10025244
460 Ga0207711_10112253
461 Ga0207711_10268871
462 Ga0207661_10313258
463 Ga0207661_10358418
464 Ga0207661_10598352
465 Ga0207667_10024259
466 Ga0207667_10205443
467 Ga0207712_10001180
468 Ga0207712_10503124
469 Ga0207668_10000036
470 Ga0207658_10000427
471 Ga0207658_10274735
472 Ga0207658_10334559
473 Ga0207703_10000401
474 Ga0207703_10008475
475 Ga0207639_10927174
476 Ga0207678_10114927
477 Ga0207702_10012418
478 Ga0207702_11389210
479 Ga0207702_12104229
480 Ga0207641_10001065
481 Ga0207641_10001728
482 Ga0207641_10899611
483 Ga0207676_10000102
484 Ga0268266_10003063
485 Ga0268266_10005296
486 Ga0268266_10008852
487 Ga0268265_10000635
488 Ga0268265_10470384
489 Ga0268264_10000179
490 Ga0268264_10000284
491 Ga0268264_10840107
492 Ga0268264_11148038
493 Ga0307511_10014205
494 Ga0265328_10002122
495 Ga0307509_10674394
496 Ga0307408_100578709
497 Ga0307407_10084137
498 Ga0307407_10804551
499 Ga0307411_10220287
500 Ga0307411_11157822
501 Ga0307415_102002227
502 Ga0307415_102504510
503 Ga0373923_0618385
504 Ga0373933_0239147
505 Ga0373937_1600121
506 Ga0373925_0031244
507 Ga0373925_0289010
508 Ga0395905_0481784
509 Ga0436365_0690868
510 Ga0436360_0217926
511 Ga0436360_0519380
512 Ga0439448_0014941
513 Ga0439450_107238
514 Ga0450897_025149
515 Ga0450894_022715
516 Ga0439458_0000150
517 Ga0439435_0130650
518 Ga0451577_0570637
519 Ga0466969_0043152
520 Ga0466969_0292122
521 Ga0466972_0200310
522 Ga0466965_0073138
523 Ga0466966_0001403
524 Ga0466966_0062119
525 Ga0466961_0001926
526 Ga0466964_0020540
527 Ga0466971_0003144
528 Ga0466960_0468000
529 Ga0466959_0008732
530 Ga0466959_0012648
531 Ga0466959_0136787
532 Ga0466959_0155659
533 Ga0466958_0118344
534 Ga0495638_0016555
535 Ga0495638_0016610
536 Ga0495638_0112361
537 Ga0495650_0000772
538 Ga0495607_0030239
539 Ga0495606_0000118
540 Ga0495610_0003766
541 Ga0495633_0175959
542 Ga0495668_0000137
543 Ga0495668_0002114
544 Ga0495668_0388436
545 Ga0495625_0001530
546 Ga0495625_0004184
547 Ga0495687_055733
548 Ga0495686_0004215
549 Ga0495686_0004973
550 Ga0495686_0205810
551 Ga0496100_0513788
552 Ga0496101_0140266
553 Ga0496102_0020584
554 Ga0496102_0126354
555 Ga0496103_0156176
556 Ga0496103_0461637
557 Ga0496104_0025982
558 Ga0496105_0230159
559 Ga0496105_0469385
560 Ga0496111_0431863
561 Ga0496114_0254725
562 Ga0496115_0033238
563 Ga0496115_0043519
564 Ga0496115_0274369
565 Ga0496118_0106905
566 Ga0496124_0149569
567 Ga0496125_0004230
568 Ga0501034_0162546
569 Ga0501034_0163260
570 Ga0501035_0926593
571 nmdc:mga03683_702678_c1
572 nmdc:mga07m45_145842_c1
573 Ga0500583_0002513
574 Ga0500583_0021489
575 Ga0500641_0109056
576 Ga0500594_0048618
577 Ga0500559_0018793
578 Ga0500616_0000073
579 Ga0500622_0047132
580 Ga0500637_0065322
581 Ga0500576_194246
582 Ga0466962_0001129

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xy0-assembly1.cif.gz_B hapr double mutant y76f, f171c 0.461 7 109
2of7-assembly1.cif.gz_A-2 structural genomics, the crystal structure of a tetr-family transcriptional regulator from streptomyces coelicolor a3 0.4078 7 105
7l7g-assembly1.cif.gz_G electron cryo-microscopy of the eukaryotic translation initiation factor 2b from homo sapiens (updated model of pdb id: 6caj) 0.3802 9 107
4yze-assembly2.cif.gz_B crystal structure of e.coli nemr reduced form 0.3709 8 102
3nxc-assembly1.cif.gz_A-2 molecular mechanism by which the escherichia coli nucleoid occlusion factor, slma, keeps cytokinesis in check 0.3686 7 103
ID Description Score Start End Superfamily
3bt9D02 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Tetracycline Repressor, domain 2 0.4561 7 102 1.10.357.10
2xvuB04 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.4438 22 109 1.10.246.10
2vufB04 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.4364 22 109 1.10.246.10
af_P22353_137_221_1.10.246.170 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.4349 8 86 1.10.246.170
3cx9A04 Mainly Alpha;Orthogonal Bundle;Serum Albumin; Chain A, Domain 1; 0.4344 22 109 1.10.246.10
ID Description Score Start End GO Terms
AF-A0A7W4K773-F1-model_v4 Uncharacterized protein 0.9868 11 142
AF-A0A1H5ZCS3-F1-model_v4 Uncharacterized protein 0.9835 2 142
AF-A0A845I3L2-F1-model_v4 ADP-ribosylglycohydrolase family protein 0.9808 5 142
AF-A0A2D7IUH7-F1-model_v4 Uncharacterized protein 0.9806 4 142
AF-W0A8C7-F1-model_v4 Uncharacterized protein 0.9791 1 137

Map