F390163

General Info

Members Datasets Scaffolds Average Seq Length
291 148 582 252

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100072189|Ga0070683_1000721893
Length 255
Sequence VKIRILGCGTSTGVPKIGNEWGQCDPQEPRNSRLRSSILVESAGERMLVDCGPDLRQQLLAAGFGRLDGLIVTHTHGDHCHGIDELRPVAQAIGGPVPLHARADVIEELKQRFGYAFAQSDFYRPIVAARELGEELAFGNARVRFADQPHGGPTSLGLRFDEGAHSAAYAIDFSDLTDEMARLYDGVDVWIADCLTRRPHPTHAHLDGVLGWARDLRIGQLYLVHMGNGLDYQTLVAELPDWAAPAYDGLEIELR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
112 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
134 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
135 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
138 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 4.12
Rhizosphere 95.53
Stem 0
Stem Tuber 0
Unclassified 5.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100072189 3300005329 Bacteria 3221
2 JGI24741J21665_1004640 3300001915 Bacteria 3006
3 JGI24740J21852_10021689 3300001979 Bacteria 2223
4 JGI24740J21852_10040353 3300001979 Bacteria 1416
5 JGI24739J22299_10048206 3300001989 Bacteria 1386
6 JGI24737J22298_10004542 3300001990 Bacteria 4828
7 JGI24737J22298_10048975 3300001990 Bacteria 1286
8 JGI24735J21928_10014301 3300002067 Bacteria 2486
9 Ga0070658_10027021 3300005327 Bacteria 4608
10 Ga0070676_10225883 3300005328 Bacteria 1239
11 Ga0070683_100155651 3300005329 Bacteria 2167
12 Ga0070670_100009836 3300005331 Bacteria 8170
13 Ga0070666_10088976 3300005335 Bacteria 2119
14 Ga0070680_100000206 3300005336 Bacteria 38666
15 Ga0070680_100001206 3300005336 Bacteria 18626
16 Ga0070680_100004678 3300005336 Bacteria 10294
17 Ga0070682_100023689 3300005337 Bacteria 3647
18 Ga0070660_100006275 3300005339 Bacteria 8236
19 Ga0070660_100206145 3300005339 Bacteria 1595
20 Ga0070660_100297159 3300005339 Bacteria 1323
21 Ga0070660_100442401 3300005339 Bacteria 1078
22 Ga0070661_100017786 3300005344 Bacteria 5045
23 Ga0070661_100025707 3300005344 Bacteria 4232
24 Ga0070661_100063845 3300005344 Bacteria 2705
25 Ga0070661_100069045 3300005344 Bacteria 2598
26 Ga0070661_100437610 3300005344 Bacteria 1039
27 Ga0070692_10371336 3300005345 Unclassified 895
28 Ga0070668_100071060 3300005347 Bacteria 2711
29 Ga0070669_100154857 3300005353 Bacteria 1776
30 Ga0070675_100292366 3300005354 Bacteria 1434
31 Ga0070671_100056263 3300005355 Bacteria 3273
32 Ga0070673_100001423 3300005364 Bacteria 13976
33 Ga0070673_100252133 3300005364 Bacteria 1539
34 Ga0070659_100028355 3300005366 Bacteria 4322
35 Ga0070659_100052765 3300005366 Bacteria 3199
36 Ga0070667_100001415 3300005367 Bacteria 21477
37 Ga0070667_100062007 3300005367 Bacteria 3167
38 Ga0070667_100069523 3300005367 Bacteria 2996
39 Ga0070714_100248016 3300005435 Bacteria 1645
40 Ga0070694_100283624 3300005444 Bacteria 1263
41 Ga0070663_100540692 3300005455 Bacteria 972
42 Ga0070662_100021691 3300005457 Bacteria 4389
43 Ga0070662_100084496 3300005457 Bacteria 2371
44 Ga0070662_100183938 3300005457 Bacteria 1649
45 Ga0070662_100191071 3300005457 Bacteria 1619
46 Ga0070681_10020058 3300005458 Bacteria 6697
47 Ga0070681_10581428 3300005458 Bacteria 1034
48 Ga0068867_100232296 3300005459 Bacteria 1491
49 Ga0070679_100052066 3300005530 Bacteria 4079
50 Ga0070679_100252174 3300005530 Bacteria 1721
51 Ga0070679_100396736 3300005530 Bacteria 1326
52 Ga0070684_100104388 3300005535 Bacteria 2535
53 Ga0068853_100023270 3300005539 Bacteria 5183
54 Ga0068853_100344807 3300005539 Bacteria 1384
55 Ga0068853_100613761 3300005539 Bacteria 1033
56 Ga0070672_100014102 3300005543 Bacteria 5656
57 Ga0070696_100126087 3300005546 Bacteria 1858
58 Ga0070693_100166011 3300005547 Bacteria 1410
59 Ga0070665_100136625 3300005548 Bacteria 2455
60 Ga0068855_100066176 3300005563 Bacteria 4213
61 Ga0068855_100089894 3300005563 Bacteria 3545
62 Ga0068855_100278068 3300005563 Bacteria 1860
63 Ga0070664_100011632 3300005564 Bacteria 7142
64 Ga0070664_100064561 3300005564 Bacteria 3123
65 Ga0070664_100116417 3300005564 Bacteria 2337
66 Ga0070664_100239212 3300005564 Bacteria 1629
67 Ga0068857_100080399 3300005577 Bacteria 2910
68 Ga0068857_100295462 3300005577 Bacteria 1493
69 Ga0068854_100075147 3300005578 Bacteria 2480
70 Ga0068856_100907651 3300005614 Bacteria 900
71 Ga0068852_100002794 3300005616 Bacteria 12096
72 Ga0068852_100004538 3300005616 Bacteria 9824
73 Ga0068852_100162091 3300005616 Bacteria 2089
74 Ga0068852_100326734 3300005616 Bacteria 1491
75 Ga0068859_100002250 3300005617 Bacteria 19574
76 Ga0068864_100000399 3300005618 Bacteria 37643
77 Ga0068864_100005570 3300005618 Bacteria 10325
78 Ga0068863_100002337 3300005841 Bacteria 18844
79 Ga0068858_100000377 3300005842 Bacteria 46611
80 Ga0068860_100001953 3300005843 Bacteria 21801
81 Ga0068860_100094774 3300005843 Bacteria 2845
82 Ga0068862_100615224 3300005844 Bacteria 1044
83 Ga0070712_100003207 3300006175 Bacteria 10080
84 Ga0075433_10121702 3300006852 Bacteria 2317
85 Ga0097620_100002250 3300006931 Bacteria 19574
86 Ga0105240_10016997 3300009093 Bacteria 9827
87 Ga0105241_10350160 3300009174 Bacteria 1282
88 Ga0105248_10000075 3300009177 Bacteria 114243
89 Ga0105248_10005892 3300009177 Bacteria 13470
90 Ga0105248_10108056 3300009177 Bacteria 3137
91 Ga0105238_10057312 3300009551 Bacteria 3907
92 Ga0105238_10259102 3300009551 Bacteria 1718
93 Ga0105249_10085760 3300009553 Bacteria 2935
94 Ga0105249_10126151 3300009553 Bacteria 2437
95 Ga0105249_10419675 3300009553 Bacteria 1371
96 Ga0105239_10209701 3300010375 Bacteria 2184
97 Ga0105246_10264273 3300011119 Bacteria 1372
98 Ga0105246_10296683 3300011119 Unclassified 1303
99 Ga0157373_10020793 3300013100 Bacteria 4765
100 Ga0157373_10031652 3300013100 Bacteria 3807
101 Ga0157373_10103845 3300013100 Bacteria 1999
102 Ga0157373_10408039 3300013100 Bacteria 974
103 Ga0157371_10179487 3300013102 Bacteria 1514
104 Ga0157371_10213616 3300013102 Bacteria 1384
105 Ga0157371_10286601 3300013102 Unclassified 1190
106 Ga0157371_10321947 3300013102 Unclassified 1122
107 Ga0157370_10028078 3300013104 Bacteria 5540
108 Ga0157370_10159903 3300013104 Bacteria 2096
109 Ga0157369_10006781 3300013105 Bacteria 13211
110 Ga0157369_10014674 3300013105 Bacteria 8841
111 Ga0157369_10261682 3300013105 Bacteria 1804
112 Ga0157369_10403955 3300013105 Bacteria 1417
113 Ga0157374_10113271 3300013296 Bacteria 2611
114 Ga0163162_10064364 3300013306 Bacteria 3712
115 Ga0163162_10280256 3300013306 Bacteria 1799
116 Ga0163162_10441742 3300013306 Unclassified 1433
117 Ga0163162_10651925 3300013306 Bacteria 1176
118 Ga0157372_10191896 3300013307 Bacteria 2366
119 Ga0157372_10419193 3300013307 Bacteria 1560
120 Ga0157372_10476945 3300013307 Bacteria 1454
121 Ga0163163_10000161 3300014325 Bacteria 70120
122 Ga0157377_10005822 3300014745 Bacteria 5824
123 Ga0157379_10111071 3300014968 Bacteria 2462
124 Ga0207697_10157053 3300025315 Bacteria 991
125 Ga0207642_10022798 3300025899 Bacteria 2490
126 Ga0207688_10054063 3300025901 Bacteria 2252
127 Ga0207680_10126376 3300025903 Bacteria 1679
128 Ga0207647_10000073 3300025904 Bacteria 76404
129 Ga0207647_10096735 3300025904 Unclassified 1756
130 Ga0207705_10004793 3300025909 Bacteria 10186
131 Ga0207705_10005902 3300025909 Bacteria 9107
132 Ga0207705_10015182 3300025909 Bacteria 5534
133 Ga0207705_10021648 3300025909 Bacteria 4588
134 Ga0207705_10138717 3300025909 Bacteria 1814
135 Ga0207705_10142356 3300025909 Unclassified 1791
136 Ga0207705_10294978 3300025909 Bacteria 1243
137 Ga0207654_10488224 3300025911 Bacteria 868
138 Ga0207707_10107884 3300025912 Bacteria 2434
139 Ga0207660_10000266 3300025917 Bacteria 34179
140 Ga0207660_10010652 3300025917 Bacteria 5975
141 Ga0207660_10111606 3300025917 Bacteria 2058
142 Ga0207657_10000827 3300025919 Bacteria 32729
143 Ga0207657_10013058 3300025919 Bacteria 8162
144 Ga0207657_10043961 3300025919 Bacteria 3931
145 Ga0207657_10344070 3300025919 Bacteria 1177
146 Ga0207649_10086124 3300025920 Bacteria 2046
147 Ga0207649_10141142 3300025920 Unclassified 1649
148 Ga0207652_10023567 3300025921 Bacteria 5100
149 Ga0207652_10030934 3300025921 Bacteria 4489
150 Ga0207652_10051748 3300025921 Bacteria 3522
151 Ga0207652_10281791 3300025921 Bacteria 1499
152 Ga0207652_10323181 3300025921 Bacteria 1393
153 Ga0207681_10014589 3300025923 Bacteria 4888
154 Ga0207650_10007527 3300025925 Bacteria 7425
155 Ga0207700_10344742 3300025928 Bacteria 1296
156 Ga0207644_10042981 3300025931 Bacteria 3205
157 Ga0207644_10049876 3300025931 Bacteria 2998
158 Ga0207690_10002603 3300025932 Bacteria 10874
159 Ga0207690_10082834 3300025932 Bacteria 2244
160 Ga0207690_10378686 3300025932 Bacteria 1124
161 Ga0207706_10000308 3300025933 Bacteria 52928
162 Ga0207706_10001415 3300025933 Bacteria 24005
163 Ga0207706_10084047 3300025933 Bacteria 2798
164 Ga0207706_10088610 3300025933 Bacteria 2720
165 Ga0207706_10143074 3300025933 Bacteria 2104
166 Ga0207706_10447110 3300025933 Bacteria 1118
167 Ga0207706_10661152 3300025933 Bacteria 894
168 Ga0207691_10066906 3300025940 Bacteria 3250
169 Ga0207711_10000281 3300025941 Bacteria 54787
170 Ga0207711_10002986 3300025941 Bacteria 14786
171 Ga0207711_10005127 3300025941 Bacteria 11107
172 Ga0207661_10052386 3300025944 Bacteria 3260
173 Ga0207679_10009818 3300025945 Bacteria 6143
174 Ga0207679_10317646 3300025945 Bacteria 1348
175 Ga0207667_10097677 3300025949 Bacteria 3031
176 Ga0207667_10350059 3300025949 Bacteria 1507
177 Ga0207667_10717606 3300025949 Bacteria 1001
178 Ga0207667_10854482 3300025949 Unclassified 904
179 Ga0207651_10003823 3300025960 Bacteria 7462
180 Ga0207651_10148361 3300025960 Bacteria 1822
181 Ga0207712_10001394 3300025961 Bacteria 16514
182 Ga0207712_10004567 3300025961 Bacteria 8734
183 Ga0207668_10079160 3300025972 Bacteria 2376
184 Ga0207668_10334093 3300025972 Bacteria 1262
185 Ga0207668_10334961 3300025972 Bacteria 1260
186 Ga0207640_10177572 3300025981 Bacteria 1593
187 Ga0207658_10007326 3300025986 Bacteria 7526
188 Ga0207658_10017917 3300025986 Bacteria 4881
189 Ga0207658_10062348 3300025986 Bacteria 2790
190 Ga0207677_10018579 3300026023 Bacteria 4175
191 Ga0207703_10001696 3300026035 Bacteria 19817
192 Ga0207639_10163984 3300026041 Bacteria 1875
193 Ga0207678_10008982 3300026067 Bacteria 8796
194 Ga0207678_10036447 3300026067 Bacteria 4281
195 Ga0207678_10066903 3300026067 Bacteria 3084
196 Ga0207702_10316382 3300026078 Bacteria 1485
197 Ga0207702_10752162 3300026078 Bacteria 962
198 Ga0207641_10000140 3300026088 Bacteria 105699
199 Ga0207641_10166805 3300026088 Bacteria 2006
200 Ga0207648_10337916 3300026089 Bacteria 1356
201 Ga0207676_10000630 3300026095 Bacteria 28536
202 Ga0207676_10271196 3300026095 Bacteria 1537
203 Ga0207674_10013717 3300026116 Bacteria 8972
204 Ga0207674_10147386 3300026116 Bacteria 2312
205 Ga0207698_10002079 3300026142 Bacteria 11802
206 Ga0207698_10003636 3300026142 Bacteria 9309
207 Ga0207698_10084442 3300026142 Bacteria 2574
208 Ga0207698_10328829 3300026142 Bacteria 1435
209 Ga0268265_10087623 3300028380 Bacteria 2477
210 Ga0268264_10000864 3300028381 Bacteria 32127
211 Ga0268264_10089739 3300028381 Bacteria 2647
212 Ga0307408_100153545 3300031548 Bacteria 1820
213 Ga0307413_10034956 3300031824 Bacteria 2878
214 Ga0307413_10084826 3300031824 Bacteria 2043
215 Ga0307413_10090686 3300031824 Bacteria 1989
216 Ga0307410_10075998 3300031852 Bacteria 2343
217 Ga0307412_10291550 3300031911 Bacteria 1285
218 Ga0307409_100324431 3300031995 Bacteria 1442
219 Ga0307409_100747933 3300031995 Bacteria 981
220 Ga0307416_100042508 3300032002 Bacteria 3548
221 Ga0307411_10110546 3300032005 Bacteria 1965
222 Ga0307415_100112872 3300032126 Bacteria 2020
223 Ga0307415_100561041 3300032126 Bacteria 1009
224 Ga0373956_0007058 3300035119 Bacteria 4518
225 Ga0373933_0118705 3300035724 Bacteria 1655
226 Ga0373937_0131406 3300036401 Bacteria 2338
227 Ga0395899_0003164 3300037312 Bacteria 13068
228 Ga0395899_0040877 3300037312 Bacteria 3467
229 Ga0395899_0064442 3300037312 Bacteria 2694
230 Ga0395899_0088088 3300037312 Bacteria 2252
231 Ga0395899_0098303 3300037312 Unclassified 2114
232 Ga0395899_0252036 3300037312 Bacteria 1211
233 Ga0395900_0017493 3300037418 Bacteria 7315
234 Ga0395900_0025379 3300037418 Bacteria 6067
235 Ga0395900_0080035 3300037418 Bacteria 3358
236 Ga0395900_0100537 3300037418 Bacteria 2970
237 Ga0395900_0116275 3300037418 Bacteria 2744
238 Ga0395900_0139153 3300037418 Bacteria 2486
239 Ga0395900_0253465 3300037418 Bacteria 1760
240 Ga0395900_0561185 3300037418 Bacteria 1085
241 Ga0395898_0011731 3300037466 Bacteria 9085
242 Ga0395898_0022903 3300037466 Bacteria 6316
243 Ga0395898_0025075 3300037466 Bacteria 6011
244 Ga0395898_0082624 3300037466 Bacteria 3096
245 Ga0395898_0130065 3300037466 Bacteria 2411
246 Ga0395905_0000434 3300037471 Bacteria 58335
247 Ga0395905_0004386 3300037471 Bacteria 14684
248 Ga0395905_0022093 3300037471 Bacteria 6018
249 Ga0395905_0043145 3300037471 Bacteria 4231
250 Ga0395905_0072966 3300037471 Bacteria 3217
251 Ga0395905_0075986 3300037471 Bacteria 3147
252 Ga0395905_0253852 3300037471 Bacteria 1642
253 Ga0395905_0512647 3300037471 Bacteria 1100
254 Ga0395905_0663911 3300037471 Unclassified 945
255 Ga0395901_0013342 3300038443 Bacteria 8347
256 Ga0395901_0059384 3300038443 Bacteria 3978
257 Ga0395901_0066460 3300038443 Bacteria 3755
258 Ga0395901_0145880 3300038443 Bacteria 2487
259 Ga0395901_0430346 3300038443 Bacteria 1352
260 Ga0395901_1279851 3300038443 Bacteria 696
261 Ga0466963_0028131 3300044694 Bacteria 3606
262 Ga0466963_0143977 3300044694 Bacteria 1653
263 Ga0466964_0038669 3300044706 Bacteria 1919
264 Ga0466971_0068236 3300044719 Bacteria 1612
265 Ga0466971_0111530 3300044719 Bacteria 1262
266 Ga0466959_0053233 3300045049 Bacteria 2959
267 Ga0466958_0101671 3300045836 Bacteria 1787
268 Ga0466967_0020865 3300045976 Bacteria 5307
269 Ga0466967_0129278 3300045976 Bacteria 2343
270 Ga0495642_0045575 3300046528 Bacteria 1792
271 Ga0495668_0295646 3300046616 Unclassified 887
272 Ga0495623_0021035 3300046679 Bacteria 4216
273 Ga0495669_0025630 3300046684 Bacteria 2572
274 Ga0495669_0287554 3300046684 Bacteria 791
275 Ga0495660_0293766 3300046810 Unclassified 739
276 Ga0495602_0255790 3300048088 Bacteria 1302
277 Ga0496100_0059043 3300048903 Bacteria 2519
278 Ga0496101_0037961 3300048904 Bacteria 3419
279 Ga0496105_0464272 3300048908 Bacteria 998
280 Ga0496106_0001021 3300048909 Bacteria 20555
281 Ga0496107_0002405 3300048910 Bacteria 12117
282 Ga0496107_0168066 3300048910 Bacteria 1627
283 Ga0496107_0276189 3300048910 Unclassified 1251
284 Ga0496108_0020422 3300048911 Bacteria 5446
285 Ga0496109_0042088 3300048912 Bacteria 4137
286 Ga0496110_0006908 3300048913 Bacteria 9026
287 Ga0496111_0004932 3300048914 Bacteria 8475
288 Ga0496112_0000197 3300048915 Bacteria 39454
289 Ga0501249_017535 3300049679 Unclassified 1543
290 nmdc:mga0a205_1022_c1 3300050515 Bacteria 23264
291 Ga0500658_0000029 3300053134 Bacteria 99170
292 Ga0070683_100072189
293 JGI24741J21665_1004640
294 JGI24740J21852_10021689
295 JGI24740J21852_10040353
296 JGI24739J22299_10048206
297 JGI24737J22298_10004542
298 JGI24737J22298_10048975
299 JGI24735J21928_10014301
300 Ga0070658_10027021
301 Ga0070676_10225883
302 Ga0070683_100155651
303 Ga0070670_100009836
304 Ga0070666_10088976
305 Ga0070680_100000206
306 Ga0070680_100001206
307 Ga0070680_100004678
308 Ga0070682_100023689
309 Ga0070660_100006275
310 Ga0070660_100206145
311 Ga0070660_100297159
312 Ga0070660_100442401
313 Ga0070661_100017786
314 Ga0070661_100025707
315 Ga0070661_100063845
316 Ga0070661_100069045
317 Ga0070661_100437610
318 Ga0070692_10371336
319 Ga0070668_100071060
320 Ga0070669_100154857
321 Ga0070675_100292366
322 Ga0070671_100056263
323 Ga0070673_100001423
324 Ga0070673_100252133
325 Ga0070659_100028355
326 Ga0070659_100052765
327 Ga0070667_100001415
328 Ga0070667_100062007
329 Ga0070667_100069523
330 Ga0070714_100248016
331 Ga0070694_100283624
332 Ga0070663_100540692
333 Ga0070662_100021691
334 Ga0070662_100084496
335 Ga0070662_100183938
336 Ga0070662_100191071
337 Ga0070681_10020058
338 Ga0070681_10581428
339 Ga0068867_100232296
340 Ga0070679_100052066
341 Ga0070679_100252174
342 Ga0070679_100396736
343 Ga0070684_100104388
344 Ga0068853_100023270
345 Ga0068853_100344807
346 Ga0068853_100613761
347 Ga0070672_100014102
348 Ga0070696_100126087
349 Ga0070693_100166011
350 Ga0070665_100136625
351 Ga0068855_100066176
352 Ga0068855_100089894
353 Ga0068855_100278068
354 Ga0070664_100011632
355 Ga0070664_100064561
356 Ga0070664_100116417
357 Ga0070664_100239212
358 Ga0068857_100080399
359 Ga0068857_100295462
360 Ga0068854_100075147
361 Ga0068856_100907651
362 Ga0068852_100002794
363 Ga0068852_100004538
364 Ga0068852_100162091
365 Ga0068852_100326734
366 Ga0068859_100002250
367 Ga0068864_100000399
368 Ga0068864_100005570
369 Ga0068863_100002337
370 Ga0068858_100000377
371 Ga0068860_100001953
372 Ga0068860_100094774
373 Ga0068862_100615224
374 Ga0070712_100003207
375 Ga0075433_10121702
376 Ga0097620_100002250
377 Ga0105240_10016997
378 Ga0105241_10350160
379 Ga0105248_10000075
380 Ga0105248_10005892
381 Ga0105248_10108056
382 Ga0105238_10057312
383 Ga0105238_10259102
384 Ga0105249_10085760
385 Ga0105249_10126151
386 Ga0105249_10419675
387 Ga0105239_10209701
388 Ga0105246_10264273
389 Ga0105246_10296683
390 Ga0157373_10020793
391 Ga0157373_10031652
392 Ga0157373_10103845
393 Ga0157373_10408039
394 Ga0157371_10179487
395 Ga0157371_10213616
396 Ga0157371_10286601
397 Ga0157371_10321947
398 Ga0157370_10028078
399 Ga0157370_10159903
400 Ga0157369_10006781
401 Ga0157369_10014674
402 Ga0157369_10261682
403 Ga0157369_10403955
404 Ga0157374_10113271
405 Ga0163162_10064364
406 Ga0163162_10280256
407 Ga0163162_10441742
408 Ga0163162_10651925
409 Ga0157372_10191896
410 Ga0157372_10419193
411 Ga0157372_10476945
412 Ga0163163_10000161
413 Ga0157377_10005822
414 Ga0157379_10111071
415 Ga0207697_10157053
416 Ga0207642_10022798
417 Ga0207688_10054063
418 Ga0207680_10126376
419 Ga0207647_10000073
420 Ga0207647_10096735
421 Ga0207705_10004793
422 Ga0207705_10005902
423 Ga0207705_10015182
424 Ga0207705_10021648
425 Ga0207705_10138717
426 Ga0207705_10142356
427 Ga0207705_10294978
428 Ga0207654_10488224
429 Ga0207707_10107884
430 Ga0207660_10000266
431 Ga0207660_10010652
432 Ga0207660_10111606
433 Ga0207657_10000827
434 Ga0207657_10013058
435 Ga0207657_10043961
436 Ga0207657_10344070
437 Ga0207649_10086124
438 Ga0207649_10141142
439 Ga0207652_10023567
440 Ga0207652_10030934
441 Ga0207652_10051748
442 Ga0207652_10281791
443 Ga0207652_10323181
444 Ga0207681_10014589
445 Ga0207650_10007527
446 Ga0207700_10344742
447 Ga0207644_10042981
448 Ga0207644_10049876
449 Ga0207690_10002603
450 Ga0207690_10082834
451 Ga0207690_10378686
452 Ga0207706_10000308
453 Ga0207706_10001415
454 Ga0207706_10084047
455 Ga0207706_10088610
456 Ga0207706_10143074
457 Ga0207706_10447110
458 Ga0207706_10661152
459 Ga0207691_10066906
460 Ga0207711_10000281
461 Ga0207711_10002986
462 Ga0207711_10005127
463 Ga0207661_10052386
464 Ga0207679_10009818
465 Ga0207679_10317646
466 Ga0207667_10097677
467 Ga0207667_10350059
468 Ga0207667_10717606
469 Ga0207667_10854482
470 Ga0207651_10003823
471 Ga0207651_10148361
472 Ga0207712_10001394
473 Ga0207712_10004567
474 Ga0207668_10079160
475 Ga0207668_10334093
476 Ga0207668_10334961
477 Ga0207640_10177572
478 Ga0207658_10007326
479 Ga0207658_10017917
480 Ga0207658_10062348
481 Ga0207677_10018579
482 Ga0207703_10001696
483 Ga0207639_10163984
484 Ga0207678_10008982
485 Ga0207678_10036447
486 Ga0207678_10066903
487 Ga0207702_10316382
488 Ga0207702_10752162
489 Ga0207641_10000140
490 Ga0207641_10166805
491 Ga0207648_10337916
492 Ga0207676_10000630
493 Ga0207676_10271196
494 Ga0207674_10013717
495 Ga0207674_10147386
496 Ga0207698_10002079
497 Ga0207698_10003636
498 Ga0207698_10084442
499 Ga0207698_10328829
500 Ga0268265_10087623
501 Ga0268264_10000864
502 Ga0268264_10089739
503 Ga0307408_100153545
504 Ga0307413_10034956
505 Ga0307413_10084826
506 Ga0307413_10090686
507 Ga0307410_10075998
508 Ga0307412_10291550
509 Ga0307409_100324431
510 Ga0307409_100747933
511 Ga0307416_100042508
512 Ga0307411_10110546
513 Ga0307415_100112872
514 Ga0307415_100561041
515 Ga0373956_0007058
516 Ga0373933_0118705
517 Ga0373937_0131406
518 Ga0395899_0003164
519 Ga0395899_0040877
520 Ga0395899_0064442
521 Ga0395899_0088088
522 Ga0395899_0098303
523 Ga0395899_0252036
524 Ga0395900_0017493
525 Ga0395900_0025379
526 Ga0395900_0080035
527 Ga0395900_0100537
528 Ga0395900_0116275
529 Ga0395900_0139153
530 Ga0395900_0253465
531 Ga0395900_0561185
532 Ga0395898_0011731
533 Ga0395898_0022903
534 Ga0395898_0025075
535 Ga0395898_0082624
536 Ga0395898_0130065
537 Ga0395905_0000434
538 Ga0395905_0004386
539 Ga0395905_0022093
540 Ga0395905_0043145
541 Ga0395905_0072966
542 Ga0395905_0075986
543 Ga0395905_0253852
544 Ga0395905_0512647
545 Ga0395905_0663911
546 Ga0395901_0013342
547 Ga0395901_0059384
548 Ga0395901_0066460
549 Ga0395901_0145880
550 Ga0395901_0430346
551 Ga0395901_1279851
552 Ga0466963_0028131
553 Ga0466963_0143977
554 Ga0466964_0038669
555 Ga0466971_0068236
556 Ga0466971_0111530
557 Ga0466959_0053233
558 Ga0466958_0101671
559 Ga0466967_0020865
560 Ga0466967_0129278
561 Ga0495642_0045575
562 Ga0495668_0295646
563 Ga0495623_0021035
564 Ga0495669_0025630
565 Ga0495669_0287554
566 Ga0495660_0293766
567 Ga0495602_0255790
568 Ga0496100_0059043
569 Ga0496101_0037961
570 Ga0496105_0464272
571 Ga0496106_0001021
572 Ga0496107_0002405
573 Ga0496107_0168066
574 Ga0496107_0276189
575 Ga0496108_0020422
576 Ga0496109_0042088
577 Ga0496110_0006908
578 Ga0496111_0004932
579 Ga0496112_0000197
580 Ga0501249_017535
581 nmdc:mga0a205_1022_c1
582 Ga0500658_0000029

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

31

185

0.95

PF12706

Lactamase_B_2

Beta-lactamase superfamily domain

45

226

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b9v-assembly1.cif.gz_A crystal structure of a new diphosphatase from the phnp family 0.9065 2 252
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.8948 2 254
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.8938 2 252
3qh8-assembly1.cif.gz_A crystal structure of a beta-lactamase-like protein bound to amp from brucella melitensis, long wavelength synchrotron data 0.8806 2 252
6b9v-assembly1.cif.gz_B crystal structure of a new diphosphatase from the phnp family 0.8681 2 254
ID Description Score Start End Superfamily
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8935 2 252 3.60.15.10
3py6A00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8803 2 252 3.60.15.10
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8564 2 254 3.60.15.10
af_I1K3H5_2_307_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8511 2 254 3.60.15.10
af_C4J9M0_89_373_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8501 2 254 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A431JRA6-F1-model_v4 deleted 0.9687 39 254
AF-A0A431JRA6-F1-model_v4 deleted 0.96 39 254
AF-A0A4V1V102-F1-model_v4 MBL fold metallo-hydrolase 0.9583 136 254 GO:0016787
AF-A0A7W7ABG6-F1-model_v4 Phosphoribosyl 1,2-cyclic phosphate phosphodiesterase (EC 3.1.4.55) 0.9538 37 254 GO:0103043
AF-A0A2U1G4B8-F1-model_v4 deleted 0.9525 1 254

Map