F390159

General Info

Members Datasets Scaffolds Average Seq Length
291 185 582 252

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100015619|Ga0070683_1000156193
Length 277
Sequence VLPLRQRRQRSNDNLDVKNRMYPEERDKQMKARYQAAGMISVLLLLAIGLLWPARSVSAAAEGKITGTVKLDGAAPHMKGIDMSKDPFCVKQHENSPAHLENVVVGAGGGLQNVVLYISQGLSAAEASQAPAKEPVFDQKNCMYTPHVLAMGVNQKFKVMTSDQTTHNIHPLPNPLAGNIPWNKSQPPGAPPIESSWKAEEVAIPVKCNIHPWMHGYFVVVKGPYATTDEKGAYTIENVPPGNYTVTAWQEEYGTQTAKVTVAAGKPGTADFTFKAK

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
89 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
90 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
129 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
132 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
136 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
142 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
144 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
145 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.13
Metatranscriptomes 6.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.84
Rhizosphere 92.78
Stem 0
Stem Tuber 0
Unclassified 23.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100015619 3300005329 Bacteria 6673
2 MRS1b_contig_100842 2162886011 Bacteria 2269
3 MBSR1b_contig_1334088 2162886012 Bacteria 2578
4 LJNas_1000011 3300000546 Bacteria 24110
5 Ga0065712_10071007 3300005290 Bacteria 5538
6 Ga0065712_10140724 3300005290 Unclassified 1452
7 Ga0065715_10129489 3300005293 Bacteria 2044
8 Ga0070690_100029450 3300005330 Unclassified 3406
9 Ga0070670_100327333 3300005331 Bacteria 1343
10 Ga0068869_100025322 3300005334 Unclassified 4118
11 Ga0070666_10007783 3300005335 Bacteria 6618
12 Ga0070680_100049286 3300005336 Bacteria 3433
13 Ga0070680_100372322 3300005336 Unclassified 1215
14 Ga0070682_100032169 3300005337 Bacteria 3179
15 Ga0068868_100077196 3300005338 Unclassified 2664
16 Ga0070660_100006565 3300005339 Bacteria 8071
17 Ga0070691_10040845 3300005341 Unclassified 2192
18 Ga0070661_100024111 3300005344 Bacteria 4364
19 Ga0070668_100012175 3300005347 Bacteria 6406
20 Ga0070669_100019337 3300005353 Bacteria 4865
21 Ga0070669_100207205 3300005353 Bacteria 1545
22 Ga0070675_100519416 3300005354 Bacteria 1074
23 Ga0070659_100003966 3300005366 Bacteria 10534
24 Ga0070659_100028456 3300005366 Bacteria 4316
25 Ga0070667_100014654 3300005367 Bacteria 6478
26 Ga0070714_100001108 3300005435 Bacteria 19307
27 Ga0070714_100203295 3300005435 Unclassified 1813
28 Ga0070713_100049829 3300005436 Bacteria 3457
29 Ga0070713_100066700 3300005436 Bacteria 3027
30 Ga0070710_10001688 3300005437 Bacteria 10408
31 Ga0070700_100023373 3300005441 Bacteria 3614
32 Ga0070708_100065095 3300005445 Bacteria 3268
33 Ga0070708_100115673 3300005445 Bacteria 2469
34 Ga0070708_100136725 3300005445 Bacteria 2271
35 Ga0070708_100173731 3300005445 Bacteria 2013
36 Ga0070708_100322969 3300005445 Bacteria 1454
37 Ga0070662_100013600 3300005457 Bacteria 5418
38 Ga0070662_100013902 3300005457 Bacteria 5362
39 Ga0070681_10023597 3300005458 Bacteria 6187
40 Ga0070681_10125491 3300005458 Bacteria 2499
41 Ga0068867_100009407 3300005459 Bacteria 6895
42 Ga0070707_100125517 3300005468 Unclassified 2493
43 Ga0070699_100025195 3300005518 Bacteria 5129
44 Ga0070699_100074341 3300005518 Bacteria 2957
45 Ga0070679_100027189 3300005530 Bacteria 5627
46 Ga0070679_100030114 3300005530 Bacteria 5357
47 Ga0070679_100131109 3300005530 Unclassified 2488
48 Ga0070679_100311602 3300005530 Unclassified 1523
49 Ga0070684_100005526 3300005535 Bacteria 9699
50 Ga0070684_100191263 3300005535 Bacteria 1862
51 Ga0070697_100000059 3300005536 Bacteria 86153
52 Ga0070697_100079682 3300005536 Bacteria 2697
53 Ga0068853_100007807 3300005539 Bacteria 8581
54 Ga0068853_100013721 3300005539 Bacteria 6618
55 Ga0070672_100471546 3300005543 Bacteria 1083
56 Ga0070686_100016986 3300005544 Unclassified 4242
57 Ga0070695_100131501 3300005545 Bacteria 1725
58 Ga0070696_100164106 3300005546 Unclassified 1638
59 Ga0070693_100005545 3300005547 Bacteria 6070
60 Ga0070693_100025953 3300005547 Bacteria 3157
61 Ga0070665_100022707 3300005548 Bacteria 6315
62 Ga0068855_100060799 3300005563 Bacteria 4416
63 Ga0068855_100077383 3300005563 Unclassified 3860
64 Ga0070664_100044955 3300005564 Unclassified 3729
65 Ga0070664_100075893 3300005564 Unclassified 2887
66 Ga0068857_100035315 3300005577 Bacteria 4427
67 Ga0068857_100059823 3300005577 Bacteria 3385
68 Ga0068854_100031855 3300005578 Bacteria 3666
69 Ga0068854_100102723 3300005578 Unclassified 2145
70 Ga0068856_100000875 3300005614 Bacteria 32269
71 Ga0068856_100012828 3300005614 Bacteria 8110
72 Ga0068856_100141837 3300005614 Unclassified 2410
73 Ga0068852_100011726 3300005616 Bacteria 6615
74 Ga0068859_100019934 3300005617 Bacteria 6732
75 Ga0068864_100150090 3300005618 Bacteria 2110
76 Ga0068864_100568516 3300005618 Unclassified 1098
77 Ga0068866_10024454 3300005718 Bacteria 2825
78 Ga0068863_100026936 3300005841 Bacteria 5481
79 Ga0068858_100017361 3300005842 Bacteria 6750
80 Ga0068860_100016831 3300005843 Bacteria 7127
81 Ga0070717_10084136 3300006028 Bacteria 2676
82 Ga0070712_100309992 3300006175 Bacteria 1280
83 Ga0097621_100064238 3300006237 Bacteria 3018
84 Ga0097621_100283897 3300006237 Bacteria 1458
85 Ga0075434_100146114 3300006871 Bacteria 2385
86 Ga0068865_100097092 3300006881 Unclassified 2150
87 Ga0075436_100004989 3300006914 Bacteria 9121
88 Ga0097620_100019934 3300006931 Bacteria 6732
89 Ga0075435_100384835 3300007076 Bacteria 1205
90 Ga0105240_10019833 3300009093 Bacteria 8980
91 Ga0105240_10033865 3300009093 Bacteria 6597
92 Ga0105240_10066723 3300009093 Unclassified 4463
93 Ga0105245_10273426 3300009098 Bacteria 1648
94 Ga0105245_10623334 3300009098 Unclassified 1107
95 Ga0105247_10107614 3300009101 Unclassified 1790
96 Ga0105243_10008383 3300009148 Bacteria 7931
97 Ga0105241_10010705 3300009174 Bacteria 6730
98 Ga0105241_10087062 3300009174 Bacteria 2458
99 Ga0105241_10142182 3300009174 Unclassified 1955
100 Ga0105242_10007812 3300009176 Bacteria 8231
101 Ga0105242_10008505 3300009176 Bacteria 7879
102 Ga0105248_10024246 3300009177 Bacteria 6745
103 Ga0105248_10050324 3300009177 Unclassified 4672
104 Ga0105237_10037253 3300009545 Bacteria 4918
105 Ga0105237_10293830 3300009545 Unclassified 1628
106 Ga0105237_10621320 3300009545 Bacteria 1087
107 Ga0105238_10026509 3300009551 Bacteria 5910
108 Ga0105249_10023998 3300009553 Bacteria 5477
109 Ga0105239_10021569 3300010375 Bacteria 7103
110 Ga0105239_10254287 3300010375 Unclassified 1973
111 Ga0105246_10033127 3300011119 Unclassified 3432
112 Ga0157373_10023429 3300013100 Bacteria 4476
113 Ga0157371_10009162 3300013102 Bacteria 7817
114 Ga0157371_10257678 3300013102 Bacteria 1257
115 Ga0157370_10093041 3300013104 Bacteria 2829
116 Ga0157369_10021915 3300013105 Bacteria 7141
117 Ga0157369_10039962 3300013105 Bacteria 5124
118 Ga0157369_10045511 3300013105 Bacteria 4772
119 Ga0157369_10209047 3300013105 Unclassified 2046
120 Ga0157374_10003717 3300013296 Bacteria 12825
121 Ga0157374_10136836 3300013296 Bacteria 2375
122 Ga0157378_10126856 3300013297 Bacteria 2358
123 Ga0157378_10716121 3300013297 Bacteria 1021
124 Ga0163162_10028620 3300013306 Bacteria 5514
125 Ga0157372_10001648 3300013307 Bacteria 24237
126 Ga0157372_10010328 3300013307 Bacteria 9921
127 Ga0157372_10015335 3300013307 Bacteria 8212
128 Ga0157372_10033050 3300013307 Bacteria 5678
129 Ga0157375_10014488 3300013308 Bacteria 7035
130 Ga0182008_10008077 3300014497 Bacteria 5765
131 Ga0157376_10075030 3300014969 Bacteria 2885
132 Ga0182007_10003880 3300015262 Bacteria 6934
133 Ga0213874_10014097 3300021377 Bacteria 2084
134 Ga0224712_10083566 3300022467 Unclassified 1323
135 Ga0224570_100005 3300022730 Bacteria 8903
136 Ga0228598_1000153 3300024227 Bacteria 12012
137 Ga0228598_1000815 3300024227 Bacteria 6717
138 Ga0228598_1001414 3300024227 Bacteria 5294
139 Ga0228598_1001531 3300024227 Bacteria 5065
140 Ga0228598_1009294 3300024227 Bacteria 1974
141 Ga0207656_10011664 3300025321 Bacteria 3325
142 Ga0207692_10000642 3300025898 Bacteria 12296
143 Ga0207642_10032287 3300025899 Unclassified 2202
144 Ga0207684_10188686 3300025910 Bacteria 1778
145 Ga0207654_10003092 3300025911 Bacteria 8426
146 Ga0207707_10002963 3300025912 Bacteria 15121
147 Ga0207707_10014749 3300025912 Bacteria 6810
148 Ga0207707_10099166 3300025912 Bacteria 2546
149 Ga0207695_10040776 3300025913 Bacteria 4973
150 Ga0207695_10057846 3300025913 Bacteria 4027
151 Ga0207695_10131953 3300025913 Unclassified 2455
152 Ga0207671_10070045 3300025914 Bacteria 2614
153 Ga0207671_10107199 3300025914 Bacteria 2122
154 Ga0207660_10071887 3300025917 Bacteria 2518
155 Ga0207660_10144664 3300025917 Bacteria 1821
156 Ga0207657_10002282 3300025919 Bacteria 20782
157 Ga0207657_10004823 3300025919 Bacteria 14205
158 Ga0207649_10010509 3300025920 Bacteria 5088
159 Ga0207652_10023082 3300025921 Bacteria 5153
160 Ga0207652_10032261 3300025921 Bacteria 4401
161 Ga0207652_10092098 3300025921 Bacteria 2666
162 Ga0207652_10180598 3300025921 Bacteria 1896
163 Ga0207652_10211270 3300025921 Unclassified 1747
164 Ga0207652_10304435 3300025921 Unclassified 1439
165 Ga0207646_10153699 3300025922 Bacteria 2075
166 Ga0207694_10022047 3300025924 Bacteria 4830
167 Ga0207694_10041123 3300025924 Bacteria 3561
168 Ga0207694_10162504 3300025924 Bacteria 1804
169 Ga0207650_10056117 3300025925 Bacteria 2926
170 Ga0207700_10036867 3300025928 Bacteria 3536
171 Ga0207664_10000217 3300025929 Bacteria 43328
172 Ga0207664_10017793 3300025929 Bacteria 5221
173 Ga0207664_10095414 3300025929 Unclassified 2447
174 Ga0207644_10025834 3300025931 Bacteria 4041
175 Ga0207690_10021996 3300025932 Bacteria 3961
176 Ga0207690_10041216 3300025932 Unclassified 3024
177 Ga0207706_10000964 3300025933 Bacteria 29432
178 Ga0207706_10013489 3300025933 Bacteria 7426
179 Ga0207686_10026713 3300025934 Bacteria 3371
180 Ga0207665_10129405 3300025939 Bacteria 1790
181 Ga0207665_10208533 3300025939 Bacteria 1426
182 Ga0207691_10426587 3300025940 Bacteria 1130
183 Ga0207711_10037165 3300025941 Unclassified 4134
184 Ga0207689_10004641 3300025942 Bacteria 12429
185 Ga0207679_10018959 3300025945 Unclassified 4616
186 Ga0207679_10064274 3300025945 Bacteria 2742
187 Ga0207667_10008795 3300025949 Bacteria 11955
188 Ga0207667_10057999 3300025949 Bacteria 4062
189 Ga0207712_10072860 3300025961 Unclassified 2475
190 Ga0207668_10022883 3300025972 Bacteria 4007
191 Ga0207640_10012213 3300025981 Bacteria 4887
192 Ga0207703_10304739 3300026035 Unclassified 1454
193 Ga0207639_10176163 3300026041 Unclassified 1815
194 Ga0207678_10008488 3300026067 Bacteria 9055
195 Ga0207678_10218631 3300026067 Bacteria 1631
196 Ga0207708_10100662 3300026075 Unclassified 2236
197 Ga0207702_10001397 3300026078 Bacteria 24081
198 Ga0207702_10095246 3300026078 Bacteria 2615
199 Ga0207648_10009505 3300026089 Bacteria 9303
200 Ga0207676_10306057 3300026095 Unclassified 1453
201 Ga0207674_10096713 3300026116 Bacteria 2937
202 Ga0265354_1004762 3300028016 Bacteria 1406
203 Ga0265356_1002174 3300028017 Bacteria 2674
204 Ga0265356_1003324 3300028017 Bacteria 2038
205 Ga0268264_10070980 3300028381 Unclassified 2949
206 Ga0265338_10005059 3300028800 Bacteria 17398
207 Ga0265338_10032282 3300028800 Bacteria 5112
208 Ga0265338_10034235 3300028800 Bacteria 4913
209 Ga0265338_10038124 3300028800 Bacteria 4559
210 Ga0265338_10222028 3300028800 Unclassified 1411
211 Ga0265762_1000956 3300030760 Bacteria 5186
212 Ga0265762_1003954 3300030760 Bacteria 2655
213 Ga0265762_1004485 3300030760 Bacteria 2499
214 Ga0265762_1022111 3300030760 Unclassified 1175
215 Ga0265762_1025737 3300030760 Bacteria 1098
216 Ga0265767_100161 3300030836 Bacteria 2471
217 Ga0265770_1001855 3300030878 Bacteria 2879
218 Ga0265769_100820 3300030888 Bacteria 1365
219 Ga0265769_101775 3300030888 Unclassified 1071
220 Ga0265760_10000122 3300031090 Bacteria 19848
221 Ga0265760_10000341 3300031090 Bacteria 13032
222 Ga0265760_10003601 3300031090 Unclassified 4495
223 Ga0265760_10012329 3300031090 Bacteria 2443
224 Ga0265760_10023344 3300031090 Bacteria 1797
225 Ga0265760_10044025 3300031090 Unclassified 1335
226 Ga0265325_10022845 3300031241 Bacteria 3422
227 Ga0265325_10032597 3300031241 Unclassified 2780
228 Ga0265325_10102182 3300031241 Bacteria 1402
229 Ga0265340_10022861 3300031247 Unclassified 3192
230 Ga0265340_10142934 3300031247 Bacteria 1094
231 Ga0265339_10009874 3300031249 Bacteria 5961
232 Ga0265339_10032604 3300031249 Bacteria 2937
233 Ga0265339_10122670 3300031249 Unclassified 1334
234 Ga0265331_10079484 3300031250 Bacteria 1526
235 Ga0265316_10013230 3300031344 Bacteria 7346
236 Ga0247548_100268 3300031814 Unclassified 1697
237 Ga0373926_0013074 3300035083 Bacteria 2812
238 Ga0373944_0042260 3300035089 Bacteria 1413
239 Ga0373923_0018577 3300035111 Bacteria 2678
240 Ga0373936_0002999 3300035113 Bacteria 6311
241 Ga0373945_0032069 3300035116 Bacteria 1860
242 Ga0373957_0019977 3300035120 Bacteria 2363
243 Ga0373943_0000183 3300035170 Bacteria 25076
244 Ga0373943_0293062 3300035170 Bacteria 922
245 Ga0373946_0005626 3300035171 Unclassified 4527
246 Ga0373955_0221719 3300035172 Bacteria 1129
247 Ga0373935_0000778 3300035692 Bacteria 16980
248 Ga0373927_0000056 3300035695 Bacteria 81041
249 Ga0373933_0207030 3300035724 Bacteria 1256
250 Ga0373933_0220193 3300035724 Bacteria 1217
251 Ga0373947_0001091 3300035725 Bacteria 16647
252 Ga0373937_0043245 3300036401 Unclassified 4111
253 Ga0373925_0003837 3300037068 Bacteria 11531
254 Ga0436364_0043538 3300037853 Unclassified 1885
255 Ga0436365_1170227 3300039437 Unclassified 2102
256 Ga0436363_0971557 3300039450 Bacteria 14307
257 Ga0436362_0797413 3300039453 Unclassified 897
258 Ga0436362_1196651 3300039453 Unclassified 3198
259 Ga0466964_0014990 3300044706 Unclassified 2953
260 Ga0451576_0067625 3300045051 Unclassified 3719
261 Ga0466967_0023496 3300045976 Bacteria 5053
262 Ga0466967_0570667 3300045976 Unclassified 1115
263 Ga0495580_0067025 3300046472 Bacteria 2512
264 Ga0495580_0322609 3300046472 Bacteria 1050
265 Ga0495628_0125021 3300046516 Bacteria 1971
266 Ga0495657_0302824 3300046675 Bacteria 953
267 Ga0495624_0072152 3300046690 Unclassified 2148
268 Ga0495602_0061287 3300048088 Unclassified 3273
269 Ga0495602_0127541 3300048088 Bacteria 2035
270 Ga0496101_0165960 3300048904 Bacteria 1695
271 Ga0496102_0010639 3300048905 Bacteria 7925
272 Ga0496102_0053200 3300048905 Unclassified 3691
273 Ga0496102_0281305 3300048905 Bacteria 1568
274 Ga0496103_0014249 3300048906 Bacteria 4720
275 Ga0496103_0068410 3300048906 Unclassified 2219
276 Ga0496106_0274801 3300048909 Unclassified 1349
277 Ga0496107_0048966 3300048910 Bacteria 3045
278 Ga0496108_0035479 3300048911 Bacteria 4146
279 Ga0496108_0349372 3300048911 Unclassified 1290
280 Ga0496109_0026273 3300048912 Bacteria 5191
281 Ga0496109_0141631 3300048912 Unclassified 2249
282 Ga0496110_0007736 3300048913 Bacteria 8603
283 Ga0496111_0032510 3300048914 Bacteria 3720
284 Ga0496112_0120154 3300048915 Bacteria 2597
285 Ga0496112_0238081 3300048915 Bacteria 1773
286 Ga0496113_0046390 3300048916 Bacteria 3225
287 nmdc:mga0n895_97206_c1 3300050512 Bacteria 2950
288 nmdc:mga0rr50_365472_c1 3300050513 Bacteria 1215
289 Ga0587066_032887 3300059490 Unclassified 935
290 Ga0587075_017118 3300059644 Bacteria 1039
291 Ga0587079_018206 3300059647 Bacteria 1228
292 Ga0070683_100015619
293 MRS1b_contig_100842
294 MBSR1b_contig_1334088
295 LJNas_1000011
296 Ga0065712_10071007
297 Ga0065712_10140724
298 Ga0065715_10129489
299 Ga0070690_100029450
300 Ga0070670_100327333
301 Ga0068869_100025322
302 Ga0070666_10007783
303 Ga0070680_100049286
304 Ga0070680_100372322
305 Ga0070682_100032169
306 Ga0068868_100077196
307 Ga0070660_100006565
308 Ga0070691_10040845
309 Ga0070661_100024111
310 Ga0070668_100012175
311 Ga0070669_100019337
312 Ga0070669_100207205
313 Ga0070675_100519416
314 Ga0070659_100003966
315 Ga0070659_100028456
316 Ga0070667_100014654
317 Ga0070714_100001108
318 Ga0070714_100203295
319 Ga0070713_100049829
320 Ga0070713_100066700
321 Ga0070710_10001688
322 Ga0070700_100023373
323 Ga0070708_100065095
324 Ga0070708_100115673
325 Ga0070708_100136725
326 Ga0070708_100173731
327 Ga0070708_100322969
328 Ga0070662_100013600
329 Ga0070662_100013902
330 Ga0070681_10023597
331 Ga0070681_10125491
332 Ga0068867_100009407
333 Ga0070707_100125517
334 Ga0070699_100025195
335 Ga0070699_100074341
336 Ga0070679_100027189
337 Ga0070679_100030114
338 Ga0070679_100131109
339 Ga0070679_100311602
340 Ga0070684_100005526
341 Ga0070684_100191263
342 Ga0070697_100000059
343 Ga0070697_100079682
344 Ga0068853_100007807
345 Ga0068853_100013721
346 Ga0070672_100471546
347 Ga0070686_100016986
348 Ga0070695_100131501
349 Ga0070696_100164106
350 Ga0070693_100005545
351 Ga0070693_100025953
352 Ga0070665_100022707
353 Ga0068855_100060799
354 Ga0068855_100077383
355 Ga0070664_100044955
356 Ga0070664_100075893
357 Ga0068857_100035315
358 Ga0068857_100059823
359 Ga0068854_100031855
360 Ga0068854_100102723
361 Ga0068856_100000875
362 Ga0068856_100012828
363 Ga0068856_100141837
364 Ga0068852_100011726
365 Ga0068859_100019934
366 Ga0068864_100150090
367 Ga0068864_100568516
368 Ga0068866_10024454
369 Ga0068863_100026936
370 Ga0068858_100017361
371 Ga0068860_100016831
372 Ga0070717_10084136
373 Ga0070712_100309992
374 Ga0097621_100064238
375 Ga0097621_100283897
376 Ga0075434_100146114
377 Ga0068865_100097092
378 Ga0075436_100004989
379 Ga0097620_100019934
380 Ga0075435_100384835
381 Ga0105240_10019833
382 Ga0105240_10033865
383 Ga0105240_10066723
384 Ga0105245_10273426
385 Ga0105245_10623334
386 Ga0105247_10107614
387 Ga0105243_10008383
388 Ga0105241_10010705
389 Ga0105241_10087062
390 Ga0105241_10142182
391 Ga0105242_10007812
392 Ga0105242_10008505
393 Ga0105248_10024246
394 Ga0105248_10050324
395 Ga0105237_10037253
396 Ga0105237_10293830
397 Ga0105237_10621320
398 Ga0105238_10026509
399 Ga0105249_10023998
400 Ga0105239_10021569
401 Ga0105239_10254287
402 Ga0105246_10033127
403 Ga0157373_10023429
404 Ga0157371_10009162
405 Ga0157371_10257678
406 Ga0157370_10093041
407 Ga0157369_10021915
408 Ga0157369_10039962
409 Ga0157369_10045511
410 Ga0157369_10209047
411 Ga0157374_10003717
412 Ga0157374_10136836
413 Ga0157378_10126856
414 Ga0157378_10716121
415 Ga0163162_10028620
416 Ga0157372_10001648
417 Ga0157372_10010328
418 Ga0157372_10015335
419 Ga0157372_10033050
420 Ga0157375_10014488
421 Ga0182008_10008077
422 Ga0157376_10075030
423 Ga0182007_10003880
424 Ga0213874_10014097
425 Ga0224712_10083566
426 Ga0224570_100005
427 Ga0228598_1000153
428 Ga0228598_1000815
429 Ga0228598_1001414
430 Ga0228598_1001531
431 Ga0228598_1009294
432 Ga0207656_10011664
433 Ga0207692_10000642
434 Ga0207642_10032287
435 Ga0207684_10188686
436 Ga0207654_10003092
437 Ga0207707_10002963
438 Ga0207707_10014749
439 Ga0207707_10099166
440 Ga0207695_10040776
441 Ga0207695_10057846
442 Ga0207695_10131953
443 Ga0207671_10070045
444 Ga0207671_10107199
445 Ga0207660_10071887
446 Ga0207660_10144664
447 Ga0207657_10002282
448 Ga0207657_10004823
449 Ga0207649_10010509
450 Ga0207652_10023082
451 Ga0207652_10032261
452 Ga0207652_10092098
453 Ga0207652_10180598
454 Ga0207652_10211270
455 Ga0207652_10304435
456 Ga0207646_10153699
457 Ga0207694_10022047
458 Ga0207694_10041123
459 Ga0207694_10162504
460 Ga0207650_10056117
461 Ga0207700_10036867
462 Ga0207664_10000217
463 Ga0207664_10017793
464 Ga0207664_10095414
465 Ga0207644_10025834
466 Ga0207690_10021996
467 Ga0207690_10041216
468 Ga0207706_10000964
469 Ga0207706_10013489
470 Ga0207686_10026713
471 Ga0207665_10129405
472 Ga0207665_10208533
473 Ga0207691_10426587
474 Ga0207711_10037165
475 Ga0207689_10004641
476 Ga0207679_10018959
477 Ga0207679_10064274
478 Ga0207667_10008795
479 Ga0207667_10057999
480 Ga0207712_10072860
481 Ga0207668_10022883
482 Ga0207640_10012213
483 Ga0207703_10304739
484 Ga0207639_10176163
485 Ga0207678_10008488
486 Ga0207678_10218631
487 Ga0207708_10100662
488 Ga0207702_10001397
489 Ga0207702_10095246
490 Ga0207648_10009505
491 Ga0207676_10306057
492 Ga0207674_10096713
493 Ga0265354_1004762
494 Ga0265356_1002174
495 Ga0265356_1003324
496 Ga0268264_10070980
497 Ga0265338_10005059
498 Ga0265338_10032282
499 Ga0265338_10034235
500 Ga0265338_10038124
501 Ga0265338_10222028
502 Ga0265762_1000956
503 Ga0265762_1003954
504 Ga0265762_1004485
505 Ga0265762_1022111
506 Ga0265762_1025737
507 Ga0265767_100161
508 Ga0265770_1001855
509 Ga0265769_100820
510 Ga0265769_101775
511 Ga0265760_10000122
512 Ga0265760_10000341
513 Ga0265760_10003601
514 Ga0265760_10012329
515 Ga0265760_10023344
516 Ga0265760_10044025
517 Ga0265325_10022845
518 Ga0265325_10032597
519 Ga0265325_10102182
520 Ga0265340_10022861
521 Ga0265340_10142934
522 Ga0265339_10009874
523 Ga0265339_10032604
524 Ga0265339_10122670
525 Ga0265331_10079484
526 Ga0265316_10013230
527 Ga0247548_100268
528 Ga0373926_0013074
529 Ga0373944_0042260
530 Ga0373923_0018577
531 Ga0373936_0002999
532 Ga0373945_0032069
533 Ga0373957_0019977
534 Ga0373943_0000183
535 Ga0373943_0293062
536 Ga0373946_0005626
537 Ga0373955_0221719
538 Ga0373935_0000778
539 Ga0373927_0000056
540 Ga0373933_0207030
541 Ga0373933_0220193
542 Ga0373947_0001091
543 Ga0373937_0043245
544 Ga0373925_0003837
545 Ga0436364_0043538
546 Ga0436365_1170227
547 Ga0436363_0971557
548 Ga0436362_0797413
549 Ga0436362_1196651
550 Ga0466964_0014990
551 Ga0451576_0067625
552 Ga0466967_0023496
553 Ga0466967_0570667
554 Ga0495580_0067025
555 Ga0495580_0322609
556 Ga0495628_0125021
557 Ga0495657_0302824
558 Ga0495624_0072152
559 Ga0495602_0061287
560 Ga0495602_0127541
561 Ga0496101_0165960
562 Ga0496102_0010639
563 Ga0496102_0053200
564 Ga0496102_0281305
565 Ga0496103_0014249
566 Ga0496103_0068410
567 Ga0496106_0274801
568 Ga0496107_0048966
569 Ga0496108_0035479
570 Ga0496108_0349372
571 Ga0496109_0026273
572 Ga0496109_0141631
573 Ga0496110_0007736
574 Ga0496111_0032510
575 Ga0496112_0120154
576 Ga0496112_0238081
577 Ga0496113_0046390
578 nmdc:mga0n895_97206_c1
579 nmdc:mga0rr50_365472_c1
580 Ga0587066_032887
581 Ga0587075_017118
582 Ga0587079_018206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14686

fn3_3

Polysaccharide lyase family 4, domain II

225

270

0.94

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

216

275

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iuz-assembly1.cif.gz_A plastocyanin 0.86 126 211
1tef-assembly2.cif.gz_B crystal structure of the spinach plastocyanin mutants g8d/k30c/t69c and k30c/t69c- a study of the effect on crystal packing and thermostability from the introduction of a novel disulfide bond 0.8435 128 211
1qmu-assembly1.cif.gz_A duck carboxypeptidase d domain ii 0.8311 212 268
7zqe-assembly1.cif.gz_M plastocyanin bound to psi of chlamydomonas reinhardtii 0.8252 127 211
8fia-assembly1.cif.gz_A-2 the structure of fly teneurin self assembly 0.8186 212 268
ID Description Score Start End Superfamily
af_P15087_375_469_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8584 215 267 2.60.40.1120
af_E7FFQ7_717_794_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8454 215 268 2.60.40.1120
af_Q9JHW1_795_903_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8375 214 268 2.60.40.1120
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8201 213 268 2.60.40.1120
af_Q9JHW1_1212_1304_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8201 213 268 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A7V9FIR8-F1-model_v4 TonB-dependent receptor 0.9615 216 266 GO:0009279
GO:0015344
GO:0030246
AF-D4T4L5-F1-model_v4 deleted 0.9479 216 266
AF-A0A2H5WU73-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.9466 53 267 GO:0030246
AF-A0A2V9XAR1-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.9463 49 268 GO:0030246
AF-A0A7X3VH12-F1-model_v4 Rhamnogalacturonan lyase domain-containing protein 0.9454 52 268

Map