F389924

General Info

Members Datasets Scaffolds Average Seq Length
290 173 580 511

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0032520|Ga0466967_0032520_358_2037
Length 559
Sequence MRSLPIERLSIASGTARRQPAPDCSFLTNSNPELRMRLRRFLVCASVALAASASAGPAFPQSAGTLQQQIRGYTAAHDREIVRELADFLAIPNLASDSAGIRRNADHLIAMMRARGIVARLLQSPSGGPPAVYGELPAPGATKTVVFYAHYDGQPVDTTQWSSPPWQPLLRDKPLDLGGKPIPIPDTPGGVSGEWRLYARSASDDKAPIVAMLSALDALRAARVVPSVNLEFFFEGEEEAGSGHLRPNLEQNASLLRADAWLFGDGPVHQSRRQQIVFGVRGVTGAELTVYGPSHGLHSGHYGNWAPNPVTMLANLIASMRDDDGHIRIAHFYDDVAPISAAERRALAEIPAVDSALRVEVQLDSTEAHDAPLVERIMLPALNLRGIRGGGVGATASNTIPTEATASIDFRLVPHQTPEHVRQLVEAHLRARGFTVVDHTPAPAERMRHARLVKVTWEAGYPATRVSMESPLAQAVTRATQAAVGTPIVRLPTLGGSLPLYTFESVLHTPVIVLPIVNHDNNQHSSNENIRLQNLFDGIAVYATVLADLGRDWAASARP

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
124 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
125 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
134 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
152 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
153 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 0
Rhizoplane 0.69
Rhizosphere 97.24
Stem 0
Stem Tuber 0
Unclassified 3.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0032520 3300045976 Bacteria 4406
2 Ga0070676_10029242 3300005328 Bacteria 3134
3 Ga0070683_100001577 3300005329 Bacteria 17635
4 Ga0070683_100011083 3300005329 Bacteria 7772
5 Ga0070683_100038666 3300005329 Bacteria 4374
6 Ga0070683_100044387 3300005329 Bacteria 4099
7 Ga0070683_100187801 3300005329 Bacteria 1962
8 Ga0070690_100034951 3300005330 Bacteria 3151
9 Ga0070670_100010045 3300005331 Bacteria 8078
10 Ga0068869_100017521 3300005334 Bacteria 4857
11 Ga0070666_10000537 3300005335 Bacteria 22903
12 Ga0070680_100001517 3300005336 Bacteria 16896
13 Ga0070680_100005565 3300005336 Bacteria 9537
14 Ga0070680_100021303 3300005336 Bacteria 5150
15 Ga0068868_100032034 3300005338 Bacteria 4042
16 Ga0070689_100019977 3300005340 Bacteria 4963
17 Ga0070689_100020625 3300005340 Bacteria 4893
18 Ga0070689_100054126 3300005340 Bacteria 3106
19 Ga0070687_100069479 3300005343 Bacteria 1886
20 Ga0070661_100020149 3300005344 Bacteria 4754
21 Ga0070675_100003506 3300005354 Bacteria 11903
22 Ga0070675_100028782 3300005354 Bacteria 4474
23 Ga0070675_100127003 3300005354 Bacteria 2170
24 Ga0070674_100034009 3300005356 Bacteria 3399
25 Ga0070673_100037807 3300005364 Bacteria 3681
26 Ga0070673_100080320 3300005364 Unclassified 2642
27 Ga0070688_100037927 3300005365 Bacteria 2939
28 Ga0070688_100081769 3300005365 Bacteria 2092
29 Ga0070703_10000084 3300005406 Bacteria 47544
30 Ga0070701_10011752 3300005438 Bacteria 3929
31 Ga0070711_100132718 3300005439 Bacteria 1857
32 Ga0070705_100000041 3300005440 Bacteria 65129
33 Ga0070705_100011192 3300005440 Bacteria 4519
34 Ga0070700_100000016 3300005441 Bacteria 147213
35 Ga0070700_100017560 3300005441 Bacteria 4095
36 Ga0070694_100102893 3300005444 Bacteria 2023
37 Ga0070708_100002954 3300005445 Bacteria 13216
38 Ga0070708_100007916 3300005445 Bacteria 8508
39 Ga0070708_100045187 3300005445 Bacteria 3878
40 Ga0070708_100064018 3300005445 Bacteria 3293
41 Ga0070708_100092741 3300005445 Bacteria 2752
42 Ga0070663_100107850 3300005455 Bacteria 2088
43 Ga0070681_10000838 3300005458 Bacteria 25763
44 Ga0070681_10013367 3300005458 Bacteria 8157
45 Ga0070685_10042483 3300005466 Bacteria 2594
46 Ga0070706_100016101 3300005467 Bacteria 6904
47 Ga0070706_100105583 3300005467 Bacteria 2620
48 Ga0070707_100005129 3300005468 Bacteria 12269
49 Ga0070698_100032590 3300005471 Bacteria 5396
50 Ga0070698_100101851 3300005471 Bacteria 2843
51 Ga0070698_100149094 3300005471 Bacteria 2287
52 Ga0070699_100000088 3300005518 Bacteria 88268
53 Ga0070699_100002938 3300005518 Bacteria 15160
54 Ga0070699_100089610 3300005518 Bacteria 2688
55 Ga0070679_100005069 3300005530 Bacteria 12165
56 Ga0070679_100012414 3300005530 Bacteria 8141
57 Ga0070679_100013528 3300005530 Bacteria 7818
58 Ga0070684_100025477 3300005535 Bacteria 4973
59 Ga0070684_100042130 3300005535 Bacteria 3940
60 Ga0070684_100048372 3300005535 Bacteria 3689
61 Ga0070684_100088386 3300005535 Bacteria 2753
62 Ga0070684_100147447 3300005535 Bacteria 2130
63 Ga0070684_100165310 3300005535 Bacteria 2008
64 Ga0070684_100184357 3300005535 Bacteria 1898
65 Ga0070697_100013507 3300005536 Archaea 6406
66 Ga0068853_100012325 3300005539 Bacteria 6955
67 Ga0070672_100032541 3300005543 Bacteria 3937
68 Ga0070672_100041516 3300005543 Bacteria 3536
69 Ga0070686_100086416 3300005544 Unclassified 2088
70 Ga0070695_100075724 3300005545 Bacteria 2215
71 Ga0070696_100000160 3300005546 Bacteria 37837
72 Ga0070696_100001351 3300005546 Bacteria 16016
73 Ga0070693_100001884 3300005547 Bacteria 9580
74 Ga0070693_100008820 3300005547 Bacteria 4996
75 Ga0068855_100024015 3300005563 Bacteria 7299
76 Ga0070664_100019600 3300005564 Bacteria 5566
77 Ga0068857_100024238 3300005577 Bacteria 5341
78 Ga0068857_100074534 3300005577 Bacteria 3024
79 Ga0068856_100145144 3300005614 Bacteria 2381
80 Ga0070702_100000760 3300005615 Bacteria 12222
81 Ga0070702_100036157 3300005615 Bacteria 2734
82 Ga0068852_100030044 3300005616 Bacteria 4469
83 Ga0068859_100006771 3300005617 Bacteria 11640
84 Ga0068859_100021980 3300005617 Bacteria 6397
85 Ga0068859_100024956 3300005617 Bacteria 6000
86 Ga0068859_100049163 3300005617 Bacteria 4235
87 Ga0068861_100000326 3300005719 Bacteria 26888
88 Ga0068861_100034831 3300005719 Bacteria 3725
89 Ga0068860_100001632 3300005843 Bacteria 24029
90 Ga0068860_100033353 3300005843 Unclassified 4941
91 Ga0068862_100001502 3300005844 Bacteria 21405
92 Ga0068862_100151458 3300005844 Bacteria 2065
93 Ga0081539_10023228 3300005985 Bacteria 4069
94 Ga0075365_10040411 3300006038 Bacteria 3041
95 Ga0075367_10012478 3300006178 Bacteria 4533
96 Ga0075366_10002555 3300006195 Bacteria 9358
97 Ga0097621_100040068 3300006237 Bacteria 3765
98 Ga0068871_100007617 3300006358 Bacteria 7743
99 Ga0075428_100001097 3300006844 Bacteria 28820
100 Ga0075428_100013775 3300006844 Bacteria 9007
101 Ga0075428_100026564 3300006844 Bacteria 6409
102 Ga0075428_100039009 3300006844 Bacteria 5227
103 Ga0075428_100260937 3300006844 Bacteria 1865
104 Ga0075430_100019791 3300006846 Bacteria 5726
105 Ga0075431_100002736 3300006847 Bacteria 17097
106 Ga0075431_100004695 3300006847 Bacteria 13426
107 Ga0075431_100006888 3300006847 Bacteria 11296
108 Ga0075431_100006935 3300006847 Bacteria 11262
109 Ga0075433_10078874 3300006852 Bacteria 2902
110 Ga0075434_100073567 3300006871 Bacteria 3410
111 Ga0075429_100058889 3300006880 Bacteria 3345
112 Ga0068865_100008194 3300006881 Bacteria 6452
113 Ga0097620_100006771 3300006931 Bacteria 11640
114 Ga0097620_100021980 3300006931 Bacteria 6397
115 Ga0097620_100024955 3300006931 Bacteria 6000
116 Ga0097620_100049163 3300006931 Bacteria 4235
117 Ga0075435_100026876 3300007076 Bacteria 4495
118 Ga0075435_100162803 3300007076 Bacteria 1880
119 Ga0099794_10002956 3300007265 Bacteria 6407
120 Ga0105240_10053121 3300009093 Bacteria 5089
121 Ga0111539_10000427 3300009094 Bacteria 52916
122 Ga0111539_10000908 3300009094 Bacteria 38705
123 Ga0111539_10019945 3300009094 Bacteria 8258
124 Ga0111539_10064545 3300009094 Bacteria 4330
125 Ga0105245_10025421 3300009098 Bacteria 5208
126 Ga0114129_10006135 3300009147 Bacteria 17039
127 Ga0114129_10021542 3300009147 Bacteria 9150
128 Ga0114129_10039940 3300009147 Bacteria 6619
129 Ga0114129_10089439 3300009147 Bacteria 4268
130 Ga0114129_10144922 3300009147 Bacteria 3254
131 Ga0105243_10019595 3300009148 Bacteria 5128
132 Ga0105241_10004260 3300009174 Bacteria 10576
133 Ga0105242_10009019 3300009176 Bacteria 7664
134 Ga0105242_10024777 3300009176 Bacteria 4741
135 Ga0105248_10005262 3300009177 Bacteria 14236
136 Ga0105248_10039616 3300009177 Bacteria 5280
137 Ga0105248_10060107 3300009177 Bacteria 4266
138 Ga0105249_10005790 3300009553 Bacteria 10690
139 Ga0105249_10055266 3300009553 Bacteria 3631
140 Ga0105239_10038071 3300010375 Bacteria 5269
141 Ga0105246_10001278 3300011119 Bacteria 14783
142 Ga0157373_10018328 3300013100 Bacteria 5099
143 Ga0157370_10158330 3300013104 Bacteria 2107
144 Ga0157369_10010379 3300013105 Bacteria 10618
145 Ga0157369_10235406 3300013105 Bacteria 1914
146 Ga0157374_10013776 3300013296 Bacteria 7063
147 Ga0157372_10029046 3300013307 Bacteria 6034
148 Ga0157375_10016016 3300013308 Bacteria 6725
149 Ga0157375_10017074 3300013308 Bacteria 6541
150 Ga0157375_10043532 3300013308 Bacteria 4355
151 Ga0157375_10087697 3300013308 Bacteria 3164
152 Ga0157375_10211909 3300013308 Bacteria 2095
153 Ga0163163_10035422 3300014325 Bacteria 4841
154 Ga0157380_10079642 3300014326 Bacteria 2676
155 Ga0157377_10000114 3300014745 Bacteria 55008
156 Ga0157377_10013235 3300014745 Bacteria 4172
157 Ga0157379_10014256 3300014968 Bacteria 6972
158 Ga0157376_10001291 3300014969 Bacteria 16489
159 Ga0207680_10000452 3300025903 Bacteria 19374
160 Ga0207684_10000075 3300025910 Bacteria 183366
161 Ga0207684_10016845 3300025910 Bacteria 6275
162 Ga0207684_10048439 3300025910 Bacteria 3604
163 Ga0207684_10112986 3300025910 Bacteria 2325
164 Ga0207707_10001488 3300025912 Bacteria 21644
165 Ga0207707_10119638 3300025912 Unclassified 2302
166 Ga0207695_10004801 3300025913 Bacteria 18291
167 Ga0207660_10001988 3300025917 Bacteria 13621
168 Ga0207660_10015040 3300025917 Bacteria 5101
169 Ga0207660_10024580 3300025917 Bacteria 4080
170 Ga0207660_10124348 3300025917 Bacteria 1957
171 Ga0207662_10002428 3300025918 Bacteria 9350
172 Ga0207652_10001470 3300025921 Bacteria 20851
173 Ga0207652_10017942 3300025921 Bacteria 5799
174 Ga0207652_10101715 3300025921 Bacteria 2539
175 Ga0207646_10024999 3300025922 Bacteria 5466
176 Ga0207681_10027091 3300025923 Bacteria 3703
177 Ga0207681_10060894 3300025923 Bacteria 2593
178 Ga0207694_10062644 3300025924 Bacteria 2896
179 Ga0207650_10006211 3300025925 Bacteria 8141
180 Ga0207650_10063147 3300025925 Bacteria 2768
181 Ga0207650_10107513 3300025925 Bacteria 2155
182 Ga0207659_10091011 3300025926 Bacteria 2278
183 Ga0207687_10026315 3300025927 Bacteria 3895
184 Ga0207706_10003247 3300025933 Bacteria 15585
185 Ga0207706_10029185 3300025933 Bacteria 4925
186 Ga0207686_10012053 3300025934 Bacteria 4749
187 Ga0207669_10044821 3300025937 Bacteria 2602
188 Ga0207711_10032940 3300025941 Bacteria 4382
189 Ga0207689_10004519 3300025942 Bacteria 12594
190 Ga0207689_10014874 3300025942 Bacteria 6604
191 Ga0207661_10005816 3300025944 Bacteria 8697
192 Ga0207661_10008125 3300025944 Bacteria 7487
193 Ga0207661_10026811 3300025944 Bacteria 4395
194 Ga0207679_10010156 3300025945 Bacteria 6057
195 Ga0207668_10007899 3300025972 Bacteria 6324
196 Ga0207658_10130707 3300025986 Unclassified 2017
197 Ga0207703_10015269 3300026035 Bacteria 5992
198 Ga0207703_10059209 3300026035 Bacteria 3128
199 Ga0207639_10000020 3300026041 Bacteria 236698
200 Ga0207639_10059865 3300026041 Bacteria 2936
201 Ga0207708_10000005 3300026075 Bacteria 284735
202 Ga0207708_10036454 3300026075 Bacteria 3744
203 Ga0207702_10188037 3300026078 Bacteria 1906
204 Ga0207648_10027650 3300026089 Bacteria 5033
205 Ga0207676_10008756 3300026095 Bacteria 7198
206 Ga0207674_10003166 3300026116 Bacteria 20256
207 Ga0207674_10026715 3300026116 Bacteria 6124
208 Ga0207674_10029754 3300026116 Bacteria 5747
209 Ga0207675_100001997 3300026118 Bacteria 20341
210 Ga0207675_100148495 3300026118 Bacteria 2230
211 Ga0207683_10023074 3300026121 Bacteria 5347
212 Ga0207683_10042135 3300026121 Bacteria 3987
213 Ga0207428_10007993 3300027907 Bacteria 9603
214 Ga0207428_10017479 3300027907 Bacteria 6153
215 Ga0268266_10280301 3300028379 Bacteria 1550
216 Ga0268265_10000644 3300028380 Bacteria 34680
217 Ga0268264_10001079 3300028381 Bacteria 26987
218 Ga0268264_10025048 3300028381 Bacteria 4876
219 Ga0307415_100061021 3300032126 Bacteria 2609
220 Ga0316580_10017190 3300032139 Bacteria 2223
221 Ga0373934_0003641 3300035086 Bacteria 5661
222 Ga0373945_0016817 3300035116 Bacteria 2472
223 Ga0373957_0003066 3300035120 Bacteria 4870
224 Ga0373957_0010092 3300035120 Bacteria 3110
225 Ga0373955_0002680 3300035172 Bacteria 7784
226 Ga0373955_0019492 3300035172 Bacteria 3392
227 Ga0373931_0009786 3300035691 Unclassified 4589
228 Ga0373927_0009385 3300035695 Bacteria 6563
229 Ga0373933_0010893 3300035724 Bacteria 4992
230 Ga0373937_0009454 3300036401 Bacteria 8473
231 Ga0373937_0031146 3300036401 Bacteria 4830
232 Ga0450894_000381 3300042131 Bacteria 7648
233 Ga0451577_0016303 3300042876 Bacteria 6884
234 Ga0466963_0059372 3300044694 Unclassified 2553
235 Ga0451576_0004899 3300045051 Bacteria 17097
236 Ga0451576_0087267 3300045051 Bacteria 3245
237 Ga0495629_0021557 3300046459 Bacteria 4598
238 Ga0495629_0029978 3300046459 Bacteria 3857
239 Ga0495651_0013720 3300046462 Bacteria 6264
240 Ga0495651_0100120 3300046462 Bacteria 2159
241 Ga0495653_0004804 3300046463 Bacteria 10956
242 Ga0495582_0020342 3300046473 Bacteria 3632
243 Ga0495664_0003636 3300046477 Bacteria 8411
244 Ga0495594_0014085 3300046499 Bacteria 4187
245 Ga0495608_0024933 3300046511 Bacteria 4086
246 Ga0495628_0092997 3300046516 Bacteria 2332
247 Ga0495630_0020287 3300046517 Bacteria 4900
248 Ga0495630_0050926 3300046517 Bacteria 3099
249 Ga0495652_0003781 3300046529 Bacteria 14775
250 Ga0495665_0033509 3300046531 Bacteria 2747
251 Ga0495586_0042203 3300046535 Bacteria 2457
252 Ga0495587_0001170 3300046536 Bacteria 17292
253 Ga0495587_0007516 3300046536 Bacteria 7057
254 Ga0495645_0000547 3300046543 Bacteria 25829
255 Ga0495657_0066329 3300046675 Bacteria 2371
256 Ga0495657_0111895 3300046675 Bacteria 1729
257 Ga0495599_0001926 3300046678 Bacteria 12015
258 Ga0495599_0003528 3300046678 Bacteria 9157
259 Ga0495623_0007491 3300046679 Bacteria 7086
260 Ga0495647_0007478 3300046681 Bacteria 3662
261 Ga0495658_0006397 3300046683 Bacteria 5787
262 Ga0495658_0034225 3300046683 Bacteria 2786
263 Ga0495581_0008566 3300047315 Bacteria 5927
264 Ga0495581_0082458 3300047315 Bacteria 1862
265 Ga0495604_0014996 3300047317 Bacteria 6182
266 Ga0495672_0001001 3300047320 Bacteria 29189
267 Ga0495675_0011063 3300047444 Bacteria 5657
268 Ga0495684_0004454 3300047471 Bacteria 10949
269 Ga0495602_0018400 3300048088 Bacteria 6980
270 Ga0495602_0027388 3300048088 Bacteria 5476
271 Ga0496108_0269766 3300048911 Bacteria 1481
272 Ga0496109_0096708 3300048912 Bacteria 2736
273 Ga0501075_0038231 3300049591 Bacteria 3587
274 nmdc:mga0k408_4994_c1 3300050493 Bacteria 7028
275 nmdc:mga06z11_30573_c1 3300050494 Bacteria 2607
276 nmdc:mga07m45_72417_c1 3300050496 Bacteria 1961
277 nmdc:mga05p37_122308_c1 3300050507 Bacteria 3196
278 nmdc:mga05p37_26_c1 3300050507 Bacteria 116369
279 nmdc:mga05p37_418052_c1 3300050507 Unclassified 1561
280 nmdc:mga05p37_5858_c1 3300050507 Bacteria 14449
281 nmdc:mga09592_10771_c1 3300050508 Bacteria 7434
282 nmdc:mga06r32_3542_c1 3300050510 Bacteria 13939
283 nmdc:mga06r32_7865_c1 3300050510 Bacteria 9581
284 nmdc:mga06r32_958_c1 3300050510 Bacteria 25765
285 nmdc:mga08y16_10759_c1 3300050511 Bacteria 9602
286 nmdc:mga08y16_4312_c1 3300050511 Bacteria 14856
287 nmdc:mga08y16_50208_c1 3300050511 Bacteria 4366
288 nmdc:mga0n895_82135_c1 3300050512 Unclassified 3212
289 nmdc:mga0rr50_183279_c1 3300050513 Bacteria 1712
290 nmdc:mga0rr50_22533_c1 3300050513 Bacteria 4325
291 Ga0466967_0032520
292 Ga0070676_10029242
293 Ga0070683_100001577
294 Ga0070683_100011083
295 Ga0070683_100038666
296 Ga0070683_100044387
297 Ga0070683_100187801
298 Ga0070690_100034951
299 Ga0070670_100010045
300 Ga0068869_100017521
301 Ga0070666_10000537
302 Ga0070680_100001517
303 Ga0070680_100005565
304 Ga0070680_100021303
305 Ga0068868_100032034
306 Ga0070689_100019977
307 Ga0070689_100020625
308 Ga0070689_100054126
309 Ga0070687_100069479
310 Ga0070661_100020149
311 Ga0070675_100003506
312 Ga0070675_100028782
313 Ga0070675_100127003
314 Ga0070674_100034009
315 Ga0070673_100037807
316 Ga0070673_100080320
317 Ga0070688_100037927
318 Ga0070688_100081769
319 Ga0070703_10000084
320 Ga0070701_10011752
321 Ga0070711_100132718
322 Ga0070705_100000041
323 Ga0070705_100011192
324 Ga0070700_100000016
325 Ga0070700_100017560
326 Ga0070694_100102893
327 Ga0070708_100002954
328 Ga0070708_100007916
329 Ga0070708_100045187
330 Ga0070708_100064018
331 Ga0070708_100092741
332 Ga0070663_100107850
333 Ga0070681_10000838
334 Ga0070681_10013367
335 Ga0070685_10042483
336 Ga0070706_100016101
337 Ga0070706_100105583
338 Ga0070707_100005129
339 Ga0070698_100032590
340 Ga0070698_100101851
341 Ga0070698_100149094
342 Ga0070699_100000088
343 Ga0070699_100002938
344 Ga0070699_100089610
345 Ga0070679_100005069
346 Ga0070679_100012414
347 Ga0070679_100013528
348 Ga0070684_100025477
349 Ga0070684_100042130
350 Ga0070684_100048372
351 Ga0070684_100088386
352 Ga0070684_100147447
353 Ga0070684_100165310
354 Ga0070684_100184357
355 Ga0070697_100013507
356 Ga0068853_100012325
357 Ga0070672_100032541
358 Ga0070672_100041516
359 Ga0070686_100086416
360 Ga0070695_100075724
361 Ga0070696_100000160
362 Ga0070696_100001351
363 Ga0070693_100001884
364 Ga0070693_100008820
365 Ga0068855_100024015
366 Ga0070664_100019600
367 Ga0068857_100024238
368 Ga0068857_100074534
369 Ga0068856_100145144
370 Ga0070702_100000760
371 Ga0070702_100036157
372 Ga0068852_100030044
373 Ga0068859_100006771
374 Ga0068859_100021980
375 Ga0068859_100024956
376 Ga0068859_100049163
377 Ga0068861_100000326
378 Ga0068861_100034831
379 Ga0068860_100001632
380 Ga0068860_100033353
381 Ga0068862_100001502
382 Ga0068862_100151458
383 Ga0081539_10023228
384 Ga0075365_10040411
385 Ga0075367_10012478
386 Ga0075366_10002555
387 Ga0097621_100040068
388 Ga0068871_100007617
389 Ga0075428_100001097
390 Ga0075428_100013775
391 Ga0075428_100026564
392 Ga0075428_100039009
393 Ga0075428_100260937
394 Ga0075430_100019791
395 Ga0075431_100002736
396 Ga0075431_100004695
397 Ga0075431_100006888
398 Ga0075431_100006935
399 Ga0075433_10078874
400 Ga0075434_100073567
401 Ga0075429_100058889
402 Ga0068865_100008194
403 Ga0097620_100006771
404 Ga0097620_100021980
405 Ga0097620_100024955
406 Ga0097620_100049163
407 Ga0075435_100026876
408 Ga0075435_100162803
409 Ga0099794_10002956
410 Ga0105240_10053121
411 Ga0111539_10000427
412 Ga0111539_10000908
413 Ga0111539_10019945
414 Ga0111539_10064545
415 Ga0105245_10025421
416 Ga0114129_10006135
417 Ga0114129_10021542
418 Ga0114129_10039940
419 Ga0114129_10089439
420 Ga0114129_10144922
421 Ga0105243_10019595
422 Ga0105241_10004260
423 Ga0105242_10009019
424 Ga0105242_10024777
425 Ga0105248_10005262
426 Ga0105248_10039616
427 Ga0105248_10060107
428 Ga0105249_10005790
429 Ga0105249_10055266
430 Ga0105239_10038071
431 Ga0105246_10001278
432 Ga0157373_10018328
433 Ga0157370_10158330
434 Ga0157369_10010379
435 Ga0157369_10235406
436 Ga0157374_10013776
437 Ga0157372_10029046
438 Ga0157375_10016016
439 Ga0157375_10017074
440 Ga0157375_10043532
441 Ga0157375_10087697
442 Ga0157375_10211909
443 Ga0163163_10035422
444 Ga0157380_10079642
445 Ga0157377_10000114
446 Ga0157377_10013235
447 Ga0157379_10014256
448 Ga0157376_10001291
449 Ga0207680_10000452
450 Ga0207684_10000075
451 Ga0207684_10016845
452 Ga0207684_10048439
453 Ga0207684_10112986
454 Ga0207707_10001488
455 Ga0207707_10119638
456 Ga0207695_10004801
457 Ga0207660_10001988
458 Ga0207660_10015040
459 Ga0207660_10024580
460 Ga0207660_10124348
461 Ga0207662_10002428
462 Ga0207652_10001470
463 Ga0207652_10017942
464 Ga0207652_10101715
465 Ga0207646_10024999
466 Ga0207681_10027091
467 Ga0207681_10060894
468 Ga0207694_10062644
469 Ga0207650_10006211
470 Ga0207650_10063147
471 Ga0207650_10107513
472 Ga0207659_10091011
473 Ga0207687_10026315
474 Ga0207706_10003247
475 Ga0207706_10029185
476 Ga0207686_10012053
477 Ga0207669_10044821
478 Ga0207711_10032940
479 Ga0207689_10004519
480 Ga0207689_10014874
481 Ga0207661_10005816
482 Ga0207661_10008125
483 Ga0207661_10026811
484 Ga0207679_10010156
485 Ga0207668_10007899
486 Ga0207658_10130707
487 Ga0207703_10015269
488 Ga0207703_10059209
489 Ga0207639_10000020
490 Ga0207639_10059865
491 Ga0207708_10000005
492 Ga0207708_10036454
493 Ga0207702_10188037
494 Ga0207648_10027650
495 Ga0207676_10008756
496 Ga0207674_10003166
497 Ga0207674_10026715
498 Ga0207674_10029754
499 Ga0207675_100001997
500 Ga0207675_100148495
501 Ga0207683_10023074
502 Ga0207683_10042135
503 Ga0207428_10007993
504 Ga0207428_10017479
505 Ga0268266_10280301
506 Ga0268265_10000644
507 Ga0268264_10001079
508 Ga0268264_10025048
509 Ga0307415_100061021
510 Ga0316580_10017190
511 Ga0373934_0003641
512 Ga0373945_0016817
513 Ga0373957_0003066
514 Ga0373957_0010092
515 Ga0373955_0002680
516 Ga0373955_0019492
517 Ga0373931_0009786
518 Ga0373927_0009385
519 Ga0373933_0010893
520 Ga0373937_0009454
521 Ga0373937_0031146
522 Ga0450894_000381
523 Ga0451577_0016303
524 Ga0466963_0059372
525 Ga0451576_0004899
526 Ga0451576_0087267
527 Ga0495629_0021557
528 Ga0495629_0029978
529 Ga0495651_0013720
530 Ga0495651_0100120
531 Ga0495653_0004804
532 Ga0495582_0020342
533 Ga0495664_0003636
534 Ga0495594_0014085
535 Ga0495608_0024933
536 Ga0495628_0092997
537 Ga0495630_0020287
538 Ga0495630_0050926
539 Ga0495652_0003781
540 Ga0495665_0033509
541 Ga0495586_0042203
542 Ga0495587_0001170
543 Ga0495587_0007516
544 Ga0495645_0000547
545 Ga0495657_0066329
546 Ga0495657_0111895
547 Ga0495599_0001926
548 Ga0495599_0003528
549 Ga0495623_0007491
550 Ga0495647_0007478
551 Ga0495658_0006397
552 Ga0495658_0034225
553 Ga0495581_0008566
554 Ga0495581_0082458
555 Ga0495604_0014996
556 Ga0495672_0001001
557 Ga0495675_0011063
558 Ga0495684_0004454
559 Ga0495602_0018400
560 Ga0495602_0027388
561 Ga0496108_0269766
562 Ga0496109_0096708
563 Ga0501075_0038231
564 nmdc:mga0k408_4994_c1
565 nmdc:mga06z11_30573_c1
566 nmdc:mga07m45_72417_c1
567 nmdc:mga05p37_122308_c1
568 nmdc:mga05p37_26_c1
569 nmdc:mga05p37_418052_c1
570 nmdc:mga05p37_5858_c1
571 nmdc:mga09592_10771_c1
572 nmdc:mga06r32_3542_c1
573 nmdc:mga06r32_7865_c1
574 nmdc:mga06r32_958_c1
575 nmdc:mga08y16_10759_c1
576 nmdc:mga08y16_4312_c1
577 nmdc:mga08y16_50208_c1
578 nmdc:mga0n895_82135_c1
579 nmdc:mga0rr50_183279_c1
580 nmdc:mga0rr50_22533_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07687

M20_dimer

Peptidase dimerisation domain

278

435

0.97

PF01546

Peptidase_M20

Peptidase family M20/M25/M40

146

548

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.8903 39 522
2pok-assembly1.cif.gz_B crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae 0.8795 39 522
4mmo-assembly1.cif.gz_A the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.8742 60 526
4mmo-assembly1.cif.gz_A the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.8631 60 526
4mmo-assembly1.cif.gz_B the crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus 0.8606 66 522
ID Description Score Start End Superfamily
2pokB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9156 256 407 3.30.70.360
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8994 60 526 3.40.630.10
4mmoB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.887 256 407 3.30.70.360
4mmoA01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8803 60 526 3.40.630.10
2pokB01 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.8528 39 522 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A2V7VX87-F1-model_v4 Peptidase M20 0.9735 42 524 GO:0016787
AF-A0A2E1M3B6-F1-model_v4 Peptidase M20 0.9706 35 522 GO:0016787
AF-A0A2V7U036-F1-model_v4 Peptidase M20 0.9694 48 524 GO:0016787
AF-A0A2V8UFK3-F1-model_v4 Peptidase M20 0.9688 165 524 GO:0016787
AF-A0A2V9HK49-F1-model_v4 Peptidase M20 0.9676 55 522 GO:0006508
GO:0008233

Map