F389457

General Info

Members Datasets Scaffolds Average Seq Length
289 192 289 164

Family's Representative Sequence

Representative Sequence 3300053078|Ga0495612_0015760|Ga0495612_0015760_1812_2402
Length 196
Sequence MIAAEIIVAEIVGKTNIVPTTFICDNGQAMNEQATATRHEEETSPEPVAGHTPHGDAWGALTRTHAAIVGRLQEALSSADFPPLPWYEVLATLAEAPDERMKMGDLAEAMVITRGGLTKLVDRLVKAGLLERTFCETDRRVSYATLLPAGRDLLAEMRPVVVAELRVSFSEKLSVEEAEELRSSLERVRASACDIS

Samples

Sample ID Description Type Environment
1 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
112 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
115 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
116 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
143 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
151 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
159 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
165 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
170 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
174 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
175 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
181 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 1.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.65
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1002628 3300000532 Unclassified 1257
2 JGI24746J21847_1000093 3300001977 Bacteria 9920
3 JGI24740J21852_10002620 3300001979 Bacteria 8100
4 JGI24751J29686_10009898 3300002459 Bacteria 1964
5 Ga0070658_10125411 3300005327 Bacteria 2137
6 Ga0070683_100005810 3300005329 Bacteria 10319
7 Ga0070683_100011121 3300005329 Bacteria 7762
8 Ga0070683_100071261 3300005329 Bacteria 3243
9 Ga0070683_100098363 3300005329 Bacteria 2754
10 Ga0070690_100684957 3300005330 Unclassified 786
11 Ga0070670_100150143 3300005331 Bacteria 2017
12 Ga0070677_10000153 3300005333 Bacteria 23244
13 Ga0070666_10009423 3300005335 Bacteria 6088
14 Ga0070682_100000086 3300005337 Bacteria 83703
15 Ga0068868_100003507 3300005338 Bacteria 10929
16 Ga0070660_100125941 3300005339 Bacteria 2047
17 Ga0070689_100360324 3300005340 Bacteria 1222
18 Ga0070689_100737137 3300005340 Bacteria 863
19 Ga0070691_10002759 3300005341 Bacteria 7836
20 Ga0070661_100000633 3300005344 Bacteria 26147
21 Ga0070675_100000063 3300005354 Bacteria 64820
22 Ga0070674_100000144 3300005356 Bacteria 33016
23 Ga0070673_100066959 3300005364 Bacteria 2871
24 Ga0070688_100003080 3300005365 Bacteria 8520
25 Ga0070688_100033158 3300005365 Bacteria 3120
26 Ga0070688_100041350 3300005365 Bacteria 2829
27 Ga0070659_100003464 3300005366 Bacteria 11233
28 Ga0070714_100394063 3300005435 Bacteria 1308
29 Ga0070713_100000080 3300005436 Bacteria 60198
30 Ga0070713_100123164 3300005436 Bacteria 2276
31 Ga0070711_100034629 3300005439 Bacteria 3370
32 Ga0070663_100642270 3300005455 Bacteria 897
33 Ga0070678_100017734 3300005456 Bacteria 4593
34 Ga0068867_100000145 3300005459 Bacteria 45547
35 Ga0070685_10000340 3300005466 Bacteria 28675
36 Ga0070685_10009982 3300005466 Bacteria 4926
37 Ga0070684_100038032 3300005535 Bacteria 4132
38 Ga0070684_100060602 3300005535 Bacteria 3311
39 Ga0070684_100062924 3300005535 Bacteria 3251
40 Ga0070684_100310242 3300005535 Bacteria 1448
41 Ga0068853_100357804 3300005539 Bacteria 1359
42 Ga0068853_100458789 3300005539 Bacteria 1199
43 Ga0070686_100243318 3300005544 Bacteria 1311
44 Ga0070686_100633780 3300005544 Bacteria 846
45 Ga0070696_100788242 3300005546 Bacteria 781
46 Ga0070665_100160305 3300005548 Bacteria 2251
47 Ga0070665_100543586 3300005548 Bacteria 1174
48 Ga0070664_100037876 3300005564 Bacteria 4056
49 Ga0068857_100038576 3300005577 Bacteria 4231
50 Ga0068854_100000091 3300005578 Bacteria 63568
51 Ga0068854_100221319 3300005578 Bacteria 1498
52 Ga0068854_100929873 3300005578 Bacteria 766
53 Ga0068856_100001180 3300005614 Bacteria 27504
54 Ga0068856_100712613 3300005614 Bacteria 1024
55 Ga0070702_100083830 3300005615 Bacteria 1916
56 Ga0068852_100000035 3300005616 Bacteria 99721
57 Ga0068852_100128819 3300005616 Bacteria 2328
58 Ga0068852_100225069 3300005616 Bacteria 1786
59 Ga0068866_10000014 3300005718 Bacteria 72482
60 Ga0068866_11078768 3300005718 Bacteria 574
61 Ga0068861_100998968 3300005719 Bacteria 798
62 Ga0068851_10003586 3300005834 Bacteria 6920
63 Ga0081455_10013246 3300005937 Bacteria 8167
64 Ga0081540_1000564 3300005983 Bacteria 35930
65 Ga0081539_10004745 3300005985 Bacteria 14693
66 Ga0070717_11288509 3300006028 Unclassified 664
67 Ga0070712_100003110 3300006175 Bacteria 10236
68 Ga0070712_100917060 3300006175 Bacteria 756
69 Ga0075430_100651669 3300006846 Bacteria 868
70 Ga0075433_10306746 3300006852 Bacteria 1405
71 Ga0068865_100000260 3300006881 Bacteria 29219
72 Ga0105245_10000262 3300009098 Bacteria 50073
73 Ga0105245_10007535 3300009098 Bacteria 9536
74 Ga0105245_10055348 3300009098 Bacteria 3563
75 Ga0105247_10000576 3300009101 Bacteria 29813
76 Ga0105243_10024504 3300009148 Bacteria 4602
77 Ga0105241_11108581 3300009174 Unclassified 746
78 Ga0105248_10000547 3300009177 Bacteria 42972
79 Ga0105238_10000051 3300009551 Bacteria 141705
80 Ga0105249_10000708 3300009553 Bacteria 30229
81 Ga0105249_10164726 3300009553 Bacteria 2145
82 Ga0105239_10204170 3300010375 Bacteria 2214
83 Ga0105239_10451105 3300010375 Bacteria 1459
84 Ga0157371_10029889 3300013102 Bacteria 3934
85 Ga0157370_10032862 3300013104 Bacteria 5063
86 Ga0157370_10039812 3300013104 Bacteria 4540
87 Ga0157369_10000348 3300013105 Bacteria 61516
88 Ga0157378_10026356 3300013297 Bacteria 5124
89 Ga0157378_10386945 3300013297 Bacteria 1375
90 Ga0157372_10000435 3300013307 Bacteria 45997
91 Ga0157375_10017809 3300013308 Bacteria 6425
92 Ga0157375_10162809 3300013308 Bacteria 2374
93 Ga0157375_10353922 3300013308 Bacteria 1634
94 Ga0157375_10371839 3300013308 Bacteria 1596
95 Ga0157375_11075977 3300013308 Bacteria 941
96 Ga0163163_10095359 3300014325 Bacteria 2995
97 Ga0157380_10000092 3300014326 Bacteria 48994
98 Ga0157380_10002621 3300014326 Bacteria 12167
99 Ga0157379_10033747 3300014968 Bacteria 4565
100 Ga0157379_10202746 3300014968 Bacteria 1794
101 Ga0157376_10244112 3300014969 Bacteria 1674
102 Ga0163161_10000018 3300017792 Bacteria 228801
103 Ga0206356_10600948 3300020070 Bacteria 2955
104 Ga0154015_1235223 3300020610 Bacteria 1178
105 Ga0224712_10062352 3300022467 Bacteria 1489
106 Ga0207656_10000314 3300025321 Bacteria 16753
107 Ga0207656_10037458 3300025321 Bacteria 2041
108 Ga0207682_10000756 3300025893 Bacteria 14892
109 Ga0207642_10000001 3300025899 Bacteria 714030
110 Ga0207642_10747347 3300025899 Bacteria 619
111 Ga0207710_10000154 3300025900 Bacteria 73881
112 Ga0207680_10008301 3300025903 Bacteria 5089
113 Ga0207685_10000001 3300025905 Bacteria 604473
114 Ga0207705_10041752 3300025909 Bacteria 3291
115 Ga0207671_10370665 3300025914 Archaea 1137
116 Ga0207693_10021324 3300025915 Bacteria 5149
117 Ga0207663_10033321 3300025916 Bacteria 3068
118 Ga0207663_10085774 3300025916 Bacteria 2074
119 Ga0207649_10000333 3300025920 Bacteria 35819
120 Ga0207694_10000035 3300025924 Bacteria 195870
121 Ga0207650_10057334 3300025925 Bacteria 2897
122 Ga0207659_10000054 3300025926 Bacteria 76823
123 Ga0207687_10000027 3300025927 Bacteria 168505
124 Ga0207687_10000058 3300025927 Bacteria 85860
125 Ga0207687_10024861 3300025927 Bacteria 4004
126 Ga0207700_10000013 3300025928 Bacteria 230462
127 Ga0207700_10276903 3300025928 Bacteria 1442
128 Ga0207690_10003028 3300025932 Bacteria 10114
129 Ga0207709_10012647 3300025935 Bacteria 4652
130 Ga0207670_10246054 3300025936 Bacteria 1380
131 Ga0207670_10617345 3300025936 Bacteria 891
132 Ga0207669_10013849 3300025937 Bacteria 4023
133 Ga0207704_10002108 3300025938 Bacteria 8921
134 Ga0207711_10000019 3300025941 Bacteria 412779
135 Ga0207661_10008279 3300025944 Bacteria 7429
136 Ga0207661_10010934 3300025944 Bacteria 6553
137 Ga0207661_10053213 3300025944 Bacteria 3238
138 Ga0207661_10075662 3300025944 Bacteria 2763
139 Ga0207679_10011056 3300025945 Bacteria 5829
140 Ga0207667_10402383 3300025949 Bacteria 1394
141 Ga0207651_10045867 3300025960 Bacteria 2934
142 Ga0207712_10000033 3300025961 Bacteria 209336
143 Ga0207712_11222749 3300025961 Unclassified 670
144 Ga0207640_10000140 3300025981 Bacteria 53451
145 Ga0207640_10695047 3300025981 Bacteria 871
146 Ga0207640_10801738 3300025981 Bacteria 816
147 Ga0207677_10000440 3300026023 Bacteria 28097
148 Ga0207677_10001509 3300026023 Bacteria 12292
149 Ga0207703_10000028 3300026035 Bacteria 208682
150 Ga0207639_10237912 3300026041 Bacteria 1582
151 Ga0207702_10000737 3300026078 Bacteria 34960
152 Ga0207702_10018709 3300026078 Bacteria 5730
153 Ga0207702_10041360 3300026078 Bacteria 3865
154 Ga0207648_10000573 3300026089 Bacteria 41295
155 Ga0207674_10046568 3300026116 Bacteria 4452
156 Ga0207683_10070285 3300026121 Bacteria 3093
157 Ga0207698_10000044 3300026142 Bacteria 94471
158 Ga0207698_10047805 3300026142 Bacteria 3245
159 Ga0207698_10081487 3300026142 Bacteria 2613
160 Ga0268266_10001920 3300028379 Bacteria 23363
161 Ga0268266_10017705 3300028379 Bacteria 6073
162 Ga0268266_10084798 3300028379 Bacteria 2767
163 Ga0268264_10017018 3300028381 Bacteria 5953
164 Ga0265337_1002120 3300028556 Bacteria 9359
165 Ga0265326_10000038 3300028558 Bacteria 88362
166 Ga0265322_10000006 3300028654 Bacteria 231685
167 Ga0265324_10000342 3300029957 Bacteria 34146
168 Ga0265332_10024262 3300031238 Bacteria 2669
169 Ga0265328_10001699 3300031239 Bacteria 10075
170 Ga0265320_10000001 3300031240 Bacteria 847191
171 Ga0265329_10003084 3300031242 Bacteria 7379
172 Ga0265331_10027028 3300031250 Bacteria 2880
173 Ga0265327_10000003 3300031251 Bacteria 852750
174 Ga0265316_10043738 3300031344 Bacteria 3567
175 Ga0265314_10000103 3300031711 Bacteria 127956
176 Ga0466963_0000035 3300044694 Bacteria 44364
177 Ga0466963_0017737 3300044694 Bacteria 4440
178 Ga0466963_0074254 3300044694 Bacteria 2293
179 Ga0466967_0000003 3300045976 Bacteria 169144
180 Ga0466967_0072194 3300045976 Bacteria 3093
181 Ga0495592_0000782 3300046454 Bacteria 22058
182 Ga0495592_0074732 3300046454 Bacteria 2462
183 Ga0495603_0003155 3300046455 Bacteria 9803
184 Ga0495603_0010184 3300046455 Bacteria 5690
185 Ga0495641_0014780 3300046461 Bacteria 4209
186 Ga0495653_0021594 3300046463 Bacteria 5215
187 Ga0495653_0149993 3300046463 Bacteria 1630
188 Ga0495582_0000007 3300046473 Bacteria 139882
189 Ga0495662_0000031 3300046476 Bacteria 47907
190 Ga0495664_0189838 3300046477 Bacteria 1246
191 Ga0495594_0000017 3300046499 Bacteria 88992
192 Ga0495606_0015106 3300046507 Bacteria 5974
193 Ga0495608_0000528 3300046511 Bacteria 26176
194 Ga0495608_0009658 3300046511 Bacteria 6732
195 Ga0495618_0000838 3300046514 Bacteria 21350
196 Ga0495628_0032408 3300046516 Bacteria 4219
197 Ga0495628_0049946 3300046516 Bacteria 3310
198 Ga0495630_0000053 3300046517 Bacteria 93065
199 Ga0495630_0047979 3300046517 Bacteria 3195
200 Ga0495652_0031087 3300046529 Bacteria 4678
201 Ga0495640_0003562 3300046533 Bacteria 12507
202 Ga0495586_0160638 3300046535 Bacteria 1267
203 Ga0495587_0365286 3300046536 Bacteria 803
204 Ga0495598_0000956 3300046537 Bacteria 5565
205 Ga0495621_0471001 3300046539 Unclassified 539
206 Ga0495645_0002206 3300046543 Bacteria 13245
207 Ga0495645_0121303 3300046543 Bacteria 1840
208 Ga0495622_0000107 3300046557 Bacteria 72476
209 Ga0495633_0126999 3300046558 Bacteria 1180
210 Ga0495667_0000086 3300046559 Bacteria 67148
211 Ga0495667_0056080 3300046559 Bacteria 2591
212 Ga0495634_0000030 3300046642 Bacteria 110741
213 Ga0495635_0000026 3300046663 Bacteria 142517
214 Ga0495657_0000019 3300046675 Bacteria 168441
215 Ga0495657_0013264 3300046675 Bacteria 6086
216 Ga0495647_0000688 3300046681 Bacteria 10085
217 Ga0495647_0003681 3300046681 Bacteria 4921
218 Ga0495658_0000007 3300046683 Bacteria 139822
219 Ga0495658_0022946 3300046683 Bacteria 3307
220 Ga0495669_0000045 3300046684 Bacteria 84113
221 Ga0495613_0000066 3300046689 Bacteria 102122
222 Ga0495613_0000861 3300046689 Bacteria 23279
223 Ga0495613_0064929 3300046689 Bacteria 2668
224 Ga0495624_0000699 3300046690 Bacteria 26337
225 Ga0495624_0096769 3300046690 Bacteria 1818
226 Ga0495670_0005477 3300046691 Bacteria 6230
227 Ga0495600_0009323 3300046809 Bacteria 6061
228 Ga0495600_0017169 3300046809 Bacteria 4601
229 Ga0495600_0202300 3300046809 Bacteria 1275
230 Ga0495581_0094852 3300047315 Bacteria 1732
231 Ga0495604_0044651 3300047317 Bacteria 3460
232 Ga0495672_0169630 3300047320 Bacteria 1114
233 Ga0495676_0167068 3300047321 Bacteria 1551
234 Ga0495680_0002059 3300047322 Bacteria 20963
235 Ga0495680_0003939 3300047322 Bacteria 14356
236 Ga0495675_0000141 3300047444 Bacteria 50168
237 Ga0495679_113226 3300047446 Bacteria 745
238 Ga0495685_022293 3300047447 Bacteria 2179
239 Ga0495684_0236223 3300047471 Bacteria 1335
240 Ga0495684_0550939 3300047471 Bacteria 785
241 Ga0495593_0031920 3300047673 Bacteria 2874
242 Ga0495593_0100625 3300047673 Bacteria 1482
243 Ga0495602_0000008 3300048088 Bacteria 260157
244 Ga0495602_0144537 3300048088 Bacteria 1878
245 Ga0496100_0000003 3300048903 Bacteria 360802
246 Ga0496101_0000003 3300048904 Bacteria 406565
247 Ga0496104_0000120 3300048907 Bacteria 72797
248 Ga0496105_0000020 3300048908 Bacteria 181484
249 Ga0496105_0038043 3300048908 Bacteria 3963
250 Ga0496106_0000146 3300048909 Bacteria 52294
251 Ga0496107_0000026 3300048910 Bacteria 108989
252 Ga0496108_0000025 3300048911 Bacteria 177919
253 Ga0496108_0000032 3300048911 Bacteria 158930
254 Ga0496108_0000163 3300048911 Bacteria 62902
255 Ga0496108_0009252 3300048911 Bacteria 7971
256 Ga0496108_0279467 3300048911 Bacteria 1453
257 Ga0496109_0000070 3300048912 Bacteria 108889
258 Ga0496109_0000081 3300048912 Bacteria 99723
259 Ga0496109_0000291 3300048912 Bacteria 47681
260 Ga0496109_0000884 3300048912 Bacteria 25037
261 Ga0496109_0063440 3300048912 Bacteria 3380
262 Ga0496110_0080947 3300048913 Bacteria 2895
263 Ga0496111_0000024 3300048914 Bacteria 62369
264 Ga0496112_0000003 3300048915 Bacteria 660147
265 Ga0496112_0000668 3300048915 Bacteria 23904
266 Ga0496113_0000025 3300048916 Bacteria 64773
267 Ga0496113_0026210 3300048916 Bacteria 4165
268 Ga0496113_0764961 3300048916 Bacteria 768
269 Ga0496115_0006417 3300048918 Bacteria 8616
270 Ga0496119_0052463 3300048922 Bacteria 2497
271 Ga0496119_0129425 3300048922 Bacteria 1377
272 Ga0496120_0002606 3300048923 Bacteria 17878
273 Ga0501042_0054259 3300049578 Bacteria 2858
274 Ga0501068_0538114 3300049584 Bacteria 759
275 Ga0501070_0036206 3300049586 Bacteria 4122
276 Ga0501070_0042720 3300049586 Bacteria 3775
277 nmdc:mga0a205_70565_c1 3300050515 Bacteria 3373
278 Ga0495601_0000096 3300053077 Bacteria 48420
279 Ga0495612_0001210 3300053078 Bacteria 10641
280 Ga0495612_0015760 3300053078 Bacteria 3029
281 Ga0495655_0008260 3300053083 Bacteria 1970
282 Ga0495595_0000004 3300053084 Bacteria 260821
283 Ga0495595_0000101 3300053084 Bacteria 38966
284 Ga0495595_0038007 3300053084 Bacteria 2191
285 Ga0495619_0000015 3300053085 Bacteria 252787
286 Ga0495619_0000080 3300053085 Bacteria 72201
287 Ga0495619_0000278 3300053085 Bacteria 36705
288 Ga0495619_0000336 3300053085 Bacteria 32967
289 Ga0495619_0058069 3300053085 Bacteria 2568

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005435 Ga0070714_100394063 Ga0070714_1003940632 148
2 3300013308 Ga0157375_10162809 Ga0157375_101628093 154
3 3300005340 Ga0070689_100737137 Ga0070689_1007371372 155
4 3300005364 Ga0070673_100066959 Ga0070673_1000669593 155
5 3300005459 Ga0068867_100000145 Ga0068867_1000001457 155
6 3300006846 Ga0075430_100651669 Ga0075430_1006516691 155
7 3300014326 Ga0157380_10002621 Ga0157380_100026215 155
8 3300025936 Ga0207670_10617345 Ga0207670_106173452 155
9 3300025960 Ga0207651_10045867 Ga0207651_100458673 155
10 3300026089 Ga0207648_10000573 Ga0207648_100005737 155
11 3300046455 Ga0495603_0003155 Ga0495603_0003155_5652_6164 155
12 3300046455 Ga0495603_0010184 Ga0495603_0010184_2175_2684 155
13 3300046463 Ga0495653_0021594 Ga0495653_0021594_994_1467 155
14 3300046476 Ga0495662_0000031 Ga0495662_0000031_29367_29840 155
15 3300046514 Ga0495618_0000838 Ga0495618_0000838_5489_5962 155
16 3300046516 Ga0495628_0032408 Ga0495628_0032408_1547_2020 155
17 3300046517 Ga0495630_0047979 Ga0495630_0047979_2563_3036 155
18 3300046533 Ga0495640_0003562 Ga0495640_0003562_2735_3208 155
19 3300046535 Ga0495586_0160638 Ga0495586_0160638_12_485 155
20 3300046537 Ga0495598_0000956 Ga0495598_0000956_3170_3661 155
21 3300046539 Ga0495621_0471001 Ga0495621_0471001_37_522 155
22 3300046558 Ga0495633_0126999 Ga0495633_0126999_521_1006 155
23 3300046663 Ga0495635_0000026 Ga0495635_0000026_21397_21870 155
24 3300046675 Ga0495657_0013264 Ga0495657_0013264_2851_3336 155
25 3300046681 Ga0495647_0000688 Ga0495647_0000688_4117_4590 155
26 3300046690 Ga0495624_0096769 Ga0495624_0096769_284_757 155
27 3300046691 Ga0495670_0005477 Ga0495670_0005477_1146_1631 155
28 3300046809 Ga0495600_0009323 Ga0495600_0009323_3604_4077 155
29 3300047315 Ga0495581_0094852 Ga0495581_0094852_168_641 155
30 3300047322 Ga0495680_0002059 Ga0495680_0002059_14768_15241 155
31 3300047447 Ga0495685_022293 Ga0495685_022293_1499_2056 155
32 3300047471 Ga0495684_0550939 Ga0495684_0550939_236_709 155
33 3300047673 Ga0495593_0031920 Ga0495593_0031920_784_1287 155
34 3300048088 Ga0495602_0144537 Ga0495602_0144537_1142_1645 155
35 3300048915 Ga0496112_0000003 Ga0496112_0000003_479048_479524 155
36 3300005439 Ga0070711_100034629 Ga0070711_1000346292 156
37 3300025914 Ga0207671_10370665 Ga0207671_103706651 156
38 3300025916 Ga0207663_10033321 Ga0207663_100333214 156
39 3300046516 Ga0495628_0049946 Ga0495628_0049946_226_702 156
40 3300005329 Ga0070683_100071261 Ga0070683_1000712615 157
41 3300005535 Ga0070684_100060602 Ga0070684_1000606024 157
42 3300006852 Ga0075433_10306746 Ga0075433_103067462 157
43 3300009551 Ga0105238_10000051 Ga0105238_10000051101 157
44 3300009553 Ga0105249_10164726 Ga0105249_101647262 157
45 3300025924 Ga0207694_10000035 Ga0207694_1000003536 157
46 3300025944 Ga0207661_10053213 Ga0207661_100532135 157
47 3300025961 Ga0207712_11222749 Ga0207712_112227491 157
48 3300050515 nmdc:mga0a205_70565_c1 nmdc:mga0a205_70565_c1_597_1076 157
49 3300001977 JGI24746J21847_1000093 JGI24746J21847_10000935 158
50 3300005333 Ga0070677_10000153 Ga0070677_1000015316 158
51 3300005578 Ga0068854_100221319 Ga0068854_1002213192 158
52 3300005718 Ga0068866_11078768 Ga0068866_110787681 158
53 3300009098 Ga0105245_10000262 Ga0105245_1000026244 158
54 3300009553 Ga0105249_10000708 Ga0105249_100007084 158
55 3300013308 Ga0157375_10371839 Ga0157375_103718392 158
56 3300014968 Ga0157379_10033747 Ga0157379_100337475 158
57 3300025893 Ga0207682_10000756 Ga0207682_100007568 158
58 3300025899 Ga0207642_10747347 Ga0207642_107473471 158
59 3300025927 Ga0207687_10000058 Ga0207687_1000005880 158
60 3300025961 Ga0207712_10000033 Ga0207712_10000033167 158
61 3300025981 Ga0207640_10695047 Ga0207640_106950472 158
62 3300046684 Ga0495669_0000045 Ga0495669_0000045_68749_69240 158
63 3300048903 Ga0496100_0000003 Ga0496100_0000003_48164_48655 158
64 3300048904 Ga0496101_0000003 Ga0496101_0000003_48164_48655 158
65 3300048907 Ga0496104_0000120 Ga0496104_0000120_58141_58632 158
66 3300048908 Ga0496105_0000020 Ga0496105_0000020_14166_14657 158
67 3300048909 Ga0496106_0000146 Ga0496106_0000146_48154_48645 158
68 3300048910 Ga0496107_0000026 Ga0496107_0000026_48164_48655 158
69 3300048911 Ga0496108_0000032 Ga0496108_0000032_81665_82147 158
70 3300048912 Ga0496109_0000070 Ga0496109_0000070_76784_77266 158
71 3300048915 Ga0496112_0000668 Ga0496112_0000668_868_1398 158
72 3300048916 Ga0496113_0000025 Ga0496113_0000025_35445_35975 158
73 3300049586 Ga0501070_0042720 Ga0501070_0042720_3066_3548 158
74 3300005337 Ga0070682_100000086 Ga0070682_10000008682 159
75 3300005456 Ga0070678_100017734 Ga0070678_1000177347 159
76 3300005578 Ga0068854_100000091 Ga0068854_10000009149 159
77 3300006175 Ga0070712_100917060 Ga0070712_1009170602 159
78 3300009098 Ga0105245_10055348 Ga0105245_100553484 159
79 3300010375 Ga0105239_10204170 Ga0105239_102041702 159
80 3300013307 Ga0157372_10000435 Ga0157372_100004357 159
81 3300025321 Ga0207656_10000314 Ga0207656_1000031411 159
82 3300025927 Ga0207687_10024861 Ga0207687_100248614 159
83 3300025981 Ga0207640_10000140 Ga0207640_1000014048 159
84 3300026121 Ga0207683_10070285 Ga0207683_100702855 159
85 3300044694 Ga0466963_0000035 Ga0466963_0000035_29996_30481 159
86 3300044694 Ga0466963_0017737 Ga0466963_0017737_1091_1582 159
87 3300047320 Ga0495672_0169630 Ga0495672_0169630_335_817 159
88 3300048914 Ga0496111_0000024 Ga0496111_0000024_36549_37130 159
89 3300049578 Ga0501042_0054259 Ga0501042_0054259_2041_2526 159
90 3300053085 Ga0495619_0000336 Ga0495619_0000336_5197_5679 159
91 3300002459 JGI24751J29686_10009898 JGI24751J29686_100098982 160
92 3300005330 Ga0070690_100684957 Ga0070690_1006849571 160
93 3300005335 Ga0070666_10009423 Ga0070666_100094235 160
94 3300005338 Ga0068868_100003507 Ga0068868_1000035078 160
95 3300005455 Ga0070663_100642270 Ga0070663_1006422701 160
96 3300005544 Ga0070686_100633780 Ga0070686_1006337802 160
97 3300005548 Ga0070665_100160305 Ga0070665_1001603053 160
98 3300005548 Ga0070665_100543586 Ga0070665_1005435862 160
99 3300005616 Ga0068852_100128819 Ga0068852_1001288193 160
100 3300005719 Ga0068861_100998968 Ga0068861_1009989682 160
101 3300005834 Ga0068851_10003586 Ga0068851_100035865 160
102 3300009174 Ga0105241_11108581 Ga0105241_111085812 160
103 3300014325 Ga0163163_10095359 Ga0163163_100953593 160
104 3300014969 Ga0157376_10244112 Ga0157376_102441123 160
105 3300025321 Ga0207656_10037458 Ga0207656_100374583 160
106 3300025903 Ga0207680_10008301 Ga0207680_100083013 160
107 3300026023 Ga0207677_10000440 Ga0207677_1000044011 160
108 3300026142 Ga0207698_10081487 Ga0207698_100814874 160
109 3300028379 Ga0268266_10001920 Ga0268266_100019205 160
110 3300028379 Ga0268266_10084798 Ga0268266_100847984 160
111 3300028381 Ga0268264_10017018 Ga0268264_100170185 160
112 3300046461 Ga0495641_0014780 Ga0495641_0014780_3328_3813 160
113 3300046517 Ga0495630_0000053 Ga0495630_0000053_22095_22589 160
114 3300046642 Ga0495634_0000030 Ga0495634_0000030_10604_11092 160
115 3300046681 Ga0495647_0003681 Ga0495647_0003681_1277_1762 160
116 3300046690 Ga0495624_0000699 Ga0495624_0000699_837_1322 160
117 3300047321 Ga0495676_0167068 Ga0495676_0167068_223_717 160
118 3300047471 Ga0495684_0236223 Ga0495684_0236223_549_1034 160
119 3300048908 Ga0496105_0038043 Ga0496105_0038043_3424_3912 160
120 3300049584 Ga0501068_0538114 Ga0501068_0538114_207_692 160
121 3300005327 Ga0070658_10125411 Ga0070658_101254112 161
122 3300005329 Ga0070683_100098363 Ga0070683_1000983632 161
123 3300005331 Ga0070670_100150143 Ga0070670_1001501433 161
124 3300005340 Ga0070689_100360324 Ga0070689_1003603242 161
125 3300005341 Ga0070691_10002759 Ga0070691_100027595 161
126 3300005344 Ga0070661_100000633 Ga0070661_10000063320 161
127 3300005365 Ga0070688_100041350 Ga0070688_1000413503 161
128 3300005436 Ga0070713_100000080 Ga0070713_10000008053 161
129 3300005535 Ga0070684_100038032 Ga0070684_1000380324 161
130 3300005544 Ga0070686_100243318 Ga0070686_1002433182 161
131 3300005546 Ga0070696_100788242 Ga0070696_1007882421 161
132 3300005564 Ga0070664_100037876 Ga0070664_1000378764 161
133 3300005578 Ga0068854_100929873 Ga0068854_1009298731 161
134 3300005614 Ga0068856_100712613 Ga0068856_1007126132 161
135 3300005616 Ga0068852_100000035 Ga0068852_10000003545 161
136 3300005985 Ga0081539_10004745 Ga0081539_1000474514 161
137 3300009148 Ga0105243_10024504 Ga0105243_100245042 161
138 3300013104 Ga0157370_10032862 Ga0157370_100328625 161
139 3300013297 Ga0157378_10386945 Ga0157378_103869452 161
140 3300013308 Ga0157375_10017809 Ga0157375_100178095 161
141 3300013308 Ga0157375_10353922 Ga0157375_103539223 161
142 3300013308 Ga0157375_11075977 Ga0157375_110759772 161
143 3300020070 Ga0206356_10600948 Ga0206356_106009483 161
144 3300022467 Ga0224712_10062352 Ga0224712_100623522 161
145 3300025909 Ga0207705_10041752 Ga0207705_100417524 161
146 3300025920 Ga0207649_10000333 Ga0207649_1000033327 161
147 3300025925 Ga0207650_10057334 Ga0207650_100573344 161
148 3300025928 Ga0207700_10000013 Ga0207700_10000013167 161
149 3300025935 Ga0207709_10012647 Ga0207709_100126476 161
150 3300025936 Ga0207670_10246054 Ga0207670_102460542 161
151 3300025944 Ga0207661_10075662 Ga0207661_100756624 161
152 3300025945 Ga0207679_10011056 Ga0207679_100110563 161
153 3300025981 Ga0207640_10801738 Ga0207640_108017382 161
154 3300026023 Ga0207677_10001509 Ga0207677_100015095 161
155 3300026035 Ga0207703_10000028 Ga0207703_10000028165 161
156 3300026078 Ga0207702_10018709 Ga0207702_100187092 161
157 3300026078 Ga0207702_10041360 Ga0207702_100413604 161
158 3300026142 Ga0207698_10000044 Ga0207698_1000004415 161
159 3300028556 Ga0265337_1002120 Ga0265337_10021201 161
160 3300028558 Ga0265326_10000038 Ga0265326_1000003854 161
161 3300028654 Ga0265322_10000006 Ga0265322_10000006186 161
162 3300029957 Ga0265324_10000342 Ga0265324_1000034227 161
163 3300031238 Ga0265332_10024262 Ga0265332_100242624 161
164 3300031239 Ga0265328_10001699 Ga0265328_100016999 161
165 3300031240 Ga0265320_10000001 Ga0265320_10000001655 161
166 3300031242 Ga0265329_10003084 Ga0265329_100030844 161
167 3300031250 Ga0265331_10027028 Ga0265331_100270283 161
168 3300031251 Ga0265327_10000003 Ga0265327_10000003655 161
169 3300031344 Ga0265316_10043738 Ga0265316_100437382 161
170 3300031711 Ga0265314_10000103 Ga0265314_1000010344 161
171 3300044694 Ga0466963_0074254 Ga0466963_0074254_1325_1822 161
172 3300045976 Ga0466967_0000003 Ga0466967_0000003_119442_119930 161
173 3300046454 Ga0495592_0074732 Ga0495592_0074732_828_1328 161
174 3300046507 Ga0495606_0015106 Ga0495606_0015106_4665_5153 161
175 3300046511 Ga0495608_0009658 Ga0495608_0009658_2993_3484 161
176 3300046529 Ga0495652_0031087 Ga0495652_0031087_1082_1579 161
177 3300046543 Ga0495645_0121303 Ga0495645_0121303_371_868 161
178 3300046557 Ga0495622_0000107 Ga0495622_0000107_52448_52948 161
179 3300046559 Ga0495667_0000086 Ga0495667_0000086_22558_23100 161
180 3300046559 Ga0495667_0056080 Ga0495667_0056080_1329_1820 161
181 3300046675 Ga0495657_0000019 Ga0495657_0000019_167089_167595 161
182 3300046689 Ga0495613_0064929 Ga0495613_0064929_551_1042 161
183 3300047322 Ga0495680_0003939 Ga0495680_0003939_1114_1656 161
184 3300047444 Ga0495675_0000141 Ga0495675_0000141_1281_1787 161
185 3300047446 Ga0495679_113226 Ga0495679_113226_37_540 161
186 3300048911 Ga0496108_0000163 Ga0496108_0000163_4741_5256 161
187 3300048912 Ga0496109_0000291 Ga0496109_0000291_18158_18673 161
188 3300048913 Ga0496110_0080947 Ga0496110_0080947_1734_2222 161
189 3300048918 Ga0496115_0006417 Ga0496115_0006417_2252_2740 161
190 3300049586 Ga0501070_0036206 Ga0501070_0036206_979_1500 161
191 3300053078 Ga0495612_0001210 Ga0495612_0001210_827_1315 161
192 3300053084 Ga0495595_0000004 Ga0495595_0000004_167089_167595 161
193 3300053085 Ga0495619_0000015 Ga0495619_0000015_235357_235848 161
194 3300053085 Ga0495619_0000080 Ga0495619_0000080_851_1357 161
195 3300053085 Ga0495619_0000278 Ga0495619_0000278_3117_3626 161
196 3300000532 CNAas_1002628 CNAas_10026281 162
197 3300001979 JGI24740J21852_10002620 JGI24740J21852_100026206 162
198 3300005329 Ga0070683_100005810 Ga0070683_10000581010 162
199 3300005329 Ga0070683_100011121 Ga0070683_1000111212 162
200 3300005339 Ga0070660_100125941 Ga0070660_1001259411 162
201 3300005354 Ga0070675_100000063 Ga0070675_10000006355 162
202 3300005356 Ga0070674_100000144 Ga0070674_1000001445 162
203 3300005365 Ga0070688_100003080 Ga0070688_1000030804 162
204 3300005365 Ga0070688_100033158 Ga0070688_1000331582 162
205 3300005366 Ga0070659_100003464 Ga0070659_1000034645 162
206 3300005436 Ga0070713_100123164 Ga0070713_1001231643 162
207 3300005466 Ga0070685_10000340 Ga0070685_1000034031 162
208 3300005466 Ga0070685_10009982 Ga0070685_100099822 162
209 3300005535 Ga0070684_100062924 Ga0070684_1000629244 162
210 3300005535 Ga0070684_100310242 Ga0070684_1003102423 162
211 3300005539 Ga0068853_100357804 Ga0068853_1003578042 162
212 3300005539 Ga0068853_100458789 Ga0068853_1004587892 162
213 3300005577 Ga0068857_100038576 Ga0068857_1000385765 162
214 3300005614 Ga0068856_100001180 Ga0068856_10000118011 162
215 3300005615 Ga0070702_100083830 Ga0070702_1000838303 162
216 3300005616 Ga0068852_100225069 Ga0068852_1002250691 162
217 3300005718 Ga0068866_10000014 Ga0068866_100000145 162
218 3300005937 Ga0081455_10013246 Ga0081455_100132463 162
219 3300005983 Ga0081540_1000564 Ga0081540_100056416 162
220 3300006028 Ga0070717_11288509 Ga0070717_112885091 162
221 3300006175 Ga0070712_100003110 Ga0070712_1000031102 162
222 3300006881 Ga0068865_100000260 Ga0068865_10000026027 162
223 3300009098 Ga0105245_10007535 Ga0105245_100075354 162
224 3300009101 Ga0105247_10000576 Ga0105247_1000057632 162
225 3300009177 Ga0105248_10000547 Ga0105248_1000054728 162
226 3300010375 Ga0105239_10451105 Ga0105239_104511052 162
227 3300013102 Ga0157371_10029889 Ga0157371_100298893 162
228 3300013104 Ga0157370_10039812 Ga0157370_100398125 162
229 3300013105 Ga0157369_10000348 Ga0157369_1000034826 162
230 3300013297 Ga0157378_10026356 Ga0157378_100263564 162
231 3300014326 Ga0157380_10000092 Ga0157380_100000925 162
232 3300014968 Ga0157379_10202746 Ga0157379_102027462 162
233 3300017792 Ga0163161_10000018 Ga0163161_10000018164 162
234 3300020610 Ga0154015_1235223 Ga0154015_12352232 162
235 3300025899 Ga0207642_10000001 Ga0207642_10000001685 162
236 3300025900 Ga0207710_10000154 Ga0207710_1000015450 162
237 3300025905 Ga0207685_10000001 Ga0207685_10000001187 162
238 3300025915 Ga0207693_10021324 Ga0207693_100213245 162
239 3300025916 Ga0207663_10085774 Ga0207663_100857741 162
240 3300025926 Ga0207659_10000054 Ga0207659_1000005424 162
241 3300025927 Ga0207687_10000027 Ga0207687_1000002764 162
242 3300025928 Ga0207700_10276903 Ga0207700_102769032 162
243 3300025932 Ga0207690_10003028 Ga0207690_100030285 162
244 3300025937 Ga0207669_10013849 Ga0207669_100138492 162
245 3300025938 Ga0207704_10002108 Ga0207704_100021089 162
246 3300025941 Ga0207711_10000019 Ga0207711_10000019417 162
247 3300025944 Ga0207661_10008279 Ga0207661_100082795 162
248 3300025944 Ga0207661_10010934 Ga0207661_100109342 162
249 3300025949 Ga0207667_10402383 Ga0207667_104023832 162
250 3300026041 Ga0207639_10237912 Ga0207639_102379123 162
251 3300026078 Ga0207702_10000737 Ga0207702_1000073731 162
252 3300026116 Ga0207674_10046568 Ga0207674_100465682 162
253 3300026142 Ga0207698_10047805 Ga0207698_100478051 162
254 3300028379 Ga0268266_10017705 Ga0268266_100177056 162
255 3300045976 Ga0466967_0072194 Ga0466967_0072194_35_532 162
256 3300046454 Ga0495592_0000782 Ga0495592_0000782_5653_6150 162
257 3300046463 Ga0495653_0149993 Ga0495653_0149993_951_1475 162
258 3300046473 Ga0495582_0000007 Ga0495582_0000007_98032_98556 162
259 3300046477 Ga0495664_0189838 Ga0495664_0189838_434_940 162
260 3300046499 Ga0495594_0000017 Ga0495594_0000017_49149_49640 162
261 3300046511 Ga0495608_0000528 Ga0495608_0000528_5446_5970 162
262 3300046536 Ga0495587_0365286 Ga0495587_0365286_162_686 162
263 3300046543 Ga0495645_0002206 Ga0495645_0002206_5542_6048 162
264 3300046683 Ga0495658_0000007 Ga0495658_0000007_97987_98511 162
265 3300046683 Ga0495658_0022946 Ga0495658_0022946_1290_1781 162
266 3300046689 Ga0495613_0000066 Ga0495613_0000066_72164_72688 162
267 3300046689 Ga0495613_0000861 Ga0495613_0000861_21161_21652 162
268 3300046809 Ga0495600_0017169 Ga0495600_0017169_4048_4539 162
269 3300046809 Ga0495600_0202300 Ga0495600_0202300_438_962 162
270 3300047317 Ga0495604_0044651 Ga0495604_0044651_1710_2201 162
271 3300047673 Ga0495593_0100625 Ga0495593_0100625_148_639 162
272 3300048088 Ga0495602_0000008 Ga0495602_0000008_232351_232842 162
273 3300048911 Ga0496108_0000025 Ga0496108_0000025_151502_151993 162
274 3300048911 Ga0496108_0009252 Ga0496108_0009252_6003_6521 162
275 3300048911 Ga0496108_0279467 Ga0496108_0279467_138_629 162
276 3300048912 Ga0496109_0000081 Ga0496109_0000081_37573_38064 162
277 3300048912 Ga0496109_0000884 Ga0496109_0000884_818_1309 162
278 3300048912 Ga0496109_0063440 Ga0496109_0063440_815_1333 162
279 3300048916 Ga0496113_0026210 Ga0496113_0026210_2929_3447 162
280 3300048916 Ga0496113_0764961 Ga0496113_0764961_130_621 162
281 3300048922 Ga0496119_0052463 Ga0496119_0052463_1252_1815 162
282 3300048922 Ga0496119_0129425 Ga0496119_0129425_288_812 162
283 3300048923 Ga0496120_0002606 Ga0496120_0002606_8403_8927 162
284 3300053077 Ga0495601_0000096 Ga0495601_0000096_23574_24065 162
285 3300053078 Ga0495612_0015760 Ga0495612_0015760_1812_2402 162
286 3300053083 Ga0495655_0008260 Ga0495655_0008260_1288_1779 162
287 3300053084 Ga0495595_0000101 Ga0495595_0000101_34439_34963 162
288 3300053084 Ga0495595_0038007 Ga0495595_0038007_1214_1705 162
289 3300053085 Ga0495619_0058069 Ga0495619_0058069_442_966 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

80

141

0.96

PF01047

MarR

MarR family

83

142

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lb5-assembly1.cif.gz_A-2 crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) 0.9115 52 113
5w1e-assembly1.cif.gz_A pobr in complex with phb 0.9094 50 115
5cyv-assembly1.cif.gz_A crystal structure of cour from rhodococcus jostii rha1 bound to p-coumaroyl-coa 0.9072 27 154
3zpl-assembly2.cif.gz_F crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.903 17 158
3zpl-assembly1.cif.gz_B crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna 0.9029 17 156
ID Description Score Start End Superfamily
1wsuB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.986 68 96 1.10.10.10
af_Q57693_7_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9165 53 121 1.10.10.10
4lb5A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9115 52 113 1.10.10.10
5cyvA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9071 27 154 1.10.10.10
4nb5B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9026 55 114 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A536SYJ4-F1-model_v4 MarR family transcriptional regulator 0.9656 22 145 GO:0003700
GO:0006950
AF-A0A4Q5NRZ8-F1-model_v4 MarR family transcriptional regulator 0.9645 19 155 GO:0003677
GO:0003700
GO:0006950
AF-A0A536LI62-F1-model_v4 MarR family transcriptional regulator 0.9535 17 158 GO:0003700
GO:0006950
AF-A0A537ZBK3-F1-model_v4 MarR family transcriptional regulator 0.9531 22 162 GO:0003700
GO:0006950
AF-A0A3L7Y506-F1-model_v4 MarR family transcriptional regulator 0.9513 21 157 GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
91.85 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map