F389457
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 289 | 192 | 289 | 164 |
Family's Representative Sequence
| Representative Sequence | 3300053078|Ga0495612_0015760|Ga0495612_0015760_1812_2402 |
| Length | 196 |
| Sequence | MIAAEIIVAEIVGKTNIVPTTFICDNGQAMNEQATATRHEEETSPEPVAGHTPHGDAWGALTRTHAAIVGRLQEALSSADFPPLPWYEVLATLAEAPDERMKMGDLAEAMVITRGGLTKLVDRLVKAGLLERTFCETDRRVSYATLLPAGRDLLAEMRPVVVAELRVSFSEKLSVEEAEELRSSLERVRASACDIS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 36 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 37 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 44 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 45 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 46 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 49 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 50 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 72 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 112 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 113 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 115 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 116 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 117 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 118 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 119 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 120 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 124 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 172 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 173 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 174 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 175 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 176 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 178 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 181 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 182 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 183 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 184 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.96 |
| Metatranscriptomes | 1.04 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 8.65 |
| Rhizosphere | 90.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNAas_1002628 | 3300000532 | Unclassified | 1257 |
| 2 | JGI24746J21847_1000093 | 3300001977 | Bacteria | 9920 |
| 3 | JGI24740J21852_10002620 | 3300001979 | Bacteria | 8100 |
| 4 | JGI24751J29686_10009898 | 3300002459 | Bacteria | 1964 |
| 5 | Ga0070658_10125411 | 3300005327 | Bacteria | 2137 |
| 6 | Ga0070683_100005810 | 3300005329 | Bacteria | 10319 |
| 7 | Ga0070683_100011121 | 3300005329 | Bacteria | 7762 |
| 8 | Ga0070683_100071261 | 3300005329 | Bacteria | 3243 |
| 9 | Ga0070683_100098363 | 3300005329 | Bacteria | 2754 |
| 10 | Ga0070690_100684957 | 3300005330 | Unclassified | 786 |
| 11 | Ga0070670_100150143 | 3300005331 | Bacteria | 2017 |
| 12 | Ga0070677_10000153 | 3300005333 | Bacteria | 23244 |
| 13 | Ga0070666_10009423 | 3300005335 | Bacteria | 6088 |
| 14 | Ga0070682_100000086 | 3300005337 | Bacteria | 83703 |
| 15 | Ga0068868_100003507 | 3300005338 | Bacteria | 10929 |
| 16 | Ga0070660_100125941 | 3300005339 | Bacteria | 2047 |
| 17 | Ga0070689_100360324 | 3300005340 | Bacteria | 1222 |
| 18 | Ga0070689_100737137 | 3300005340 | Bacteria | 863 |
| 19 | Ga0070691_10002759 | 3300005341 | Bacteria | 7836 |
| 20 | Ga0070661_100000633 | 3300005344 | Bacteria | 26147 |
| 21 | Ga0070675_100000063 | 3300005354 | Bacteria | 64820 |
| 22 | Ga0070674_100000144 | 3300005356 | Bacteria | 33016 |
| 23 | Ga0070673_100066959 | 3300005364 | Bacteria | 2871 |
| 24 | Ga0070688_100003080 | 3300005365 | Bacteria | 8520 |
| 25 | Ga0070688_100033158 | 3300005365 | Bacteria | 3120 |
| 26 | Ga0070688_100041350 | 3300005365 | Bacteria | 2829 |
| 27 | Ga0070659_100003464 | 3300005366 | Bacteria | 11233 |
| 28 | Ga0070714_100394063 | 3300005435 | Bacteria | 1308 |
| 29 | Ga0070713_100000080 | 3300005436 | Bacteria | 60198 |
| 30 | Ga0070713_100123164 | 3300005436 | Bacteria | 2276 |
| 31 | Ga0070711_100034629 | 3300005439 | Bacteria | 3370 |
| 32 | Ga0070663_100642270 | 3300005455 | Bacteria | 897 |
| 33 | Ga0070678_100017734 | 3300005456 | Bacteria | 4593 |
| 34 | Ga0068867_100000145 | 3300005459 | Bacteria | 45547 |
| 35 | Ga0070685_10000340 | 3300005466 | Bacteria | 28675 |
| 36 | Ga0070685_10009982 | 3300005466 | Bacteria | 4926 |
| 37 | Ga0070684_100038032 | 3300005535 | Bacteria | 4132 |
| 38 | Ga0070684_100060602 | 3300005535 | Bacteria | 3311 |
| 39 | Ga0070684_100062924 | 3300005535 | Bacteria | 3251 |
| 40 | Ga0070684_100310242 | 3300005535 | Bacteria | 1448 |
| 41 | Ga0068853_100357804 | 3300005539 | Bacteria | 1359 |
| 42 | Ga0068853_100458789 | 3300005539 | Bacteria | 1199 |
| 43 | Ga0070686_100243318 | 3300005544 | Bacteria | 1311 |
| 44 | Ga0070686_100633780 | 3300005544 | Bacteria | 846 |
| 45 | Ga0070696_100788242 | 3300005546 | Bacteria | 781 |
| 46 | Ga0070665_100160305 | 3300005548 | Bacteria | 2251 |
| 47 | Ga0070665_100543586 | 3300005548 | Bacteria | 1174 |
| 48 | Ga0070664_100037876 | 3300005564 | Bacteria | 4056 |
| 49 | Ga0068857_100038576 | 3300005577 | Bacteria | 4231 |
| 50 | Ga0068854_100000091 | 3300005578 | Bacteria | 63568 |
| 51 | Ga0068854_100221319 | 3300005578 | Bacteria | 1498 |
| 52 | Ga0068854_100929873 | 3300005578 | Bacteria | 766 |
| 53 | Ga0068856_100001180 | 3300005614 | Bacteria | 27504 |
| 54 | Ga0068856_100712613 | 3300005614 | Bacteria | 1024 |
| 55 | Ga0070702_100083830 | 3300005615 | Bacteria | 1916 |
| 56 | Ga0068852_100000035 | 3300005616 | Bacteria | 99721 |
| 57 | Ga0068852_100128819 | 3300005616 | Bacteria | 2328 |
| 58 | Ga0068852_100225069 | 3300005616 | Bacteria | 1786 |
| 59 | Ga0068866_10000014 | 3300005718 | Bacteria | 72482 |
| 60 | Ga0068866_11078768 | 3300005718 | Bacteria | 574 |
| 61 | Ga0068861_100998968 | 3300005719 | Bacteria | 798 |
| 62 | Ga0068851_10003586 | 3300005834 | Bacteria | 6920 |
| 63 | Ga0081455_10013246 | 3300005937 | Bacteria | 8167 |
| 64 | Ga0081540_1000564 | 3300005983 | Bacteria | 35930 |
| 65 | Ga0081539_10004745 | 3300005985 | Bacteria | 14693 |
| 66 | Ga0070717_11288509 | 3300006028 | Unclassified | 664 |
| 67 | Ga0070712_100003110 | 3300006175 | Bacteria | 10236 |
| 68 | Ga0070712_100917060 | 3300006175 | Bacteria | 756 |
| 69 | Ga0075430_100651669 | 3300006846 | Bacteria | 868 |
| 70 | Ga0075433_10306746 | 3300006852 | Bacteria | 1405 |
| 71 | Ga0068865_100000260 | 3300006881 | Bacteria | 29219 |
| 72 | Ga0105245_10000262 | 3300009098 | Bacteria | 50073 |
| 73 | Ga0105245_10007535 | 3300009098 | Bacteria | 9536 |
| 74 | Ga0105245_10055348 | 3300009098 | Bacteria | 3563 |
| 75 | Ga0105247_10000576 | 3300009101 | Bacteria | 29813 |
| 76 | Ga0105243_10024504 | 3300009148 | Bacteria | 4602 |
| 77 | Ga0105241_11108581 | 3300009174 | Unclassified | 746 |
| 78 | Ga0105248_10000547 | 3300009177 | Bacteria | 42972 |
| 79 | Ga0105238_10000051 | 3300009551 | Bacteria | 141705 |
| 80 | Ga0105249_10000708 | 3300009553 | Bacteria | 30229 |
| 81 | Ga0105249_10164726 | 3300009553 | Bacteria | 2145 |
| 82 | Ga0105239_10204170 | 3300010375 | Bacteria | 2214 |
| 83 | Ga0105239_10451105 | 3300010375 | Bacteria | 1459 |
| 84 | Ga0157371_10029889 | 3300013102 | Bacteria | 3934 |
| 85 | Ga0157370_10032862 | 3300013104 | Bacteria | 5063 |
| 86 | Ga0157370_10039812 | 3300013104 | Bacteria | 4540 |
| 87 | Ga0157369_10000348 | 3300013105 | Bacteria | 61516 |
| 88 | Ga0157378_10026356 | 3300013297 | Bacteria | 5124 |
| 89 | Ga0157378_10386945 | 3300013297 | Bacteria | 1375 |
| 90 | Ga0157372_10000435 | 3300013307 | Bacteria | 45997 |
| 91 | Ga0157375_10017809 | 3300013308 | Bacteria | 6425 |
| 92 | Ga0157375_10162809 | 3300013308 | Bacteria | 2374 |
| 93 | Ga0157375_10353922 | 3300013308 | Bacteria | 1634 |
| 94 | Ga0157375_10371839 | 3300013308 | Bacteria | 1596 |
| 95 | Ga0157375_11075977 | 3300013308 | Bacteria | 941 |
| 96 | Ga0163163_10095359 | 3300014325 | Bacteria | 2995 |
| 97 | Ga0157380_10000092 | 3300014326 | Bacteria | 48994 |
| 98 | Ga0157380_10002621 | 3300014326 | Bacteria | 12167 |
| 99 | Ga0157379_10033747 | 3300014968 | Bacteria | 4565 |
| 100 | Ga0157379_10202746 | 3300014968 | Bacteria | 1794 |
| 101 | Ga0157376_10244112 | 3300014969 | Bacteria | 1674 |
| 102 | Ga0163161_10000018 | 3300017792 | Bacteria | 228801 |
| 103 | Ga0206356_10600948 | 3300020070 | Bacteria | 2955 |
| 104 | Ga0154015_1235223 | 3300020610 | Bacteria | 1178 |
| 105 | Ga0224712_10062352 | 3300022467 | Bacteria | 1489 |
| 106 | Ga0207656_10000314 | 3300025321 | Bacteria | 16753 |
| 107 | Ga0207656_10037458 | 3300025321 | Bacteria | 2041 |
| 108 | Ga0207682_10000756 | 3300025893 | Bacteria | 14892 |
| 109 | Ga0207642_10000001 | 3300025899 | Bacteria | 714030 |
| 110 | Ga0207642_10747347 | 3300025899 | Bacteria | 619 |
| 111 | Ga0207710_10000154 | 3300025900 | Bacteria | 73881 |
| 112 | Ga0207680_10008301 | 3300025903 | Bacteria | 5089 |
| 113 | Ga0207685_10000001 | 3300025905 | Bacteria | 604473 |
| 114 | Ga0207705_10041752 | 3300025909 | Bacteria | 3291 |
| 115 | Ga0207671_10370665 | 3300025914 | Archaea | 1137 |
| 116 | Ga0207693_10021324 | 3300025915 | Bacteria | 5149 |
| 117 | Ga0207663_10033321 | 3300025916 | Bacteria | 3068 |
| 118 | Ga0207663_10085774 | 3300025916 | Bacteria | 2074 |
| 119 | Ga0207649_10000333 | 3300025920 | Bacteria | 35819 |
| 120 | Ga0207694_10000035 | 3300025924 | Bacteria | 195870 |
| 121 | Ga0207650_10057334 | 3300025925 | Bacteria | 2897 |
| 122 | Ga0207659_10000054 | 3300025926 | Bacteria | 76823 |
| 123 | Ga0207687_10000027 | 3300025927 | Bacteria | 168505 |
| 124 | Ga0207687_10000058 | 3300025927 | Bacteria | 85860 |
| 125 | Ga0207687_10024861 | 3300025927 | Bacteria | 4004 |
| 126 | Ga0207700_10000013 | 3300025928 | Bacteria | 230462 |
| 127 | Ga0207700_10276903 | 3300025928 | Bacteria | 1442 |
| 128 | Ga0207690_10003028 | 3300025932 | Bacteria | 10114 |
| 129 | Ga0207709_10012647 | 3300025935 | Bacteria | 4652 |
| 130 | Ga0207670_10246054 | 3300025936 | Bacteria | 1380 |
| 131 | Ga0207670_10617345 | 3300025936 | Bacteria | 891 |
| 132 | Ga0207669_10013849 | 3300025937 | Bacteria | 4023 |
| 133 | Ga0207704_10002108 | 3300025938 | Bacteria | 8921 |
| 134 | Ga0207711_10000019 | 3300025941 | Bacteria | 412779 |
| 135 | Ga0207661_10008279 | 3300025944 | Bacteria | 7429 |
| 136 | Ga0207661_10010934 | 3300025944 | Bacteria | 6553 |
| 137 | Ga0207661_10053213 | 3300025944 | Bacteria | 3238 |
| 138 | Ga0207661_10075662 | 3300025944 | Bacteria | 2763 |
| 139 | Ga0207679_10011056 | 3300025945 | Bacteria | 5829 |
| 140 | Ga0207667_10402383 | 3300025949 | Bacteria | 1394 |
| 141 | Ga0207651_10045867 | 3300025960 | Bacteria | 2934 |
| 142 | Ga0207712_10000033 | 3300025961 | Bacteria | 209336 |
| 143 | Ga0207712_11222749 | 3300025961 | Unclassified | 670 |
| 144 | Ga0207640_10000140 | 3300025981 | Bacteria | 53451 |
| 145 | Ga0207640_10695047 | 3300025981 | Bacteria | 871 |
| 146 | Ga0207640_10801738 | 3300025981 | Bacteria | 816 |
| 147 | Ga0207677_10000440 | 3300026023 | Bacteria | 28097 |
| 148 | Ga0207677_10001509 | 3300026023 | Bacteria | 12292 |
| 149 | Ga0207703_10000028 | 3300026035 | Bacteria | 208682 |
| 150 | Ga0207639_10237912 | 3300026041 | Bacteria | 1582 |
| 151 | Ga0207702_10000737 | 3300026078 | Bacteria | 34960 |
| 152 | Ga0207702_10018709 | 3300026078 | Bacteria | 5730 |
| 153 | Ga0207702_10041360 | 3300026078 | Bacteria | 3865 |
| 154 | Ga0207648_10000573 | 3300026089 | Bacteria | 41295 |
| 155 | Ga0207674_10046568 | 3300026116 | Bacteria | 4452 |
| 156 | Ga0207683_10070285 | 3300026121 | Bacteria | 3093 |
| 157 | Ga0207698_10000044 | 3300026142 | Bacteria | 94471 |
| 158 | Ga0207698_10047805 | 3300026142 | Bacteria | 3245 |
| 159 | Ga0207698_10081487 | 3300026142 | Bacteria | 2613 |
| 160 | Ga0268266_10001920 | 3300028379 | Bacteria | 23363 |
| 161 | Ga0268266_10017705 | 3300028379 | Bacteria | 6073 |
| 162 | Ga0268266_10084798 | 3300028379 | Bacteria | 2767 |
| 163 | Ga0268264_10017018 | 3300028381 | Bacteria | 5953 |
| 164 | Ga0265337_1002120 | 3300028556 | Bacteria | 9359 |
| 165 | Ga0265326_10000038 | 3300028558 | Bacteria | 88362 |
| 166 | Ga0265322_10000006 | 3300028654 | Bacteria | 231685 |
| 167 | Ga0265324_10000342 | 3300029957 | Bacteria | 34146 |
| 168 | Ga0265332_10024262 | 3300031238 | Bacteria | 2669 |
| 169 | Ga0265328_10001699 | 3300031239 | Bacteria | 10075 |
| 170 | Ga0265320_10000001 | 3300031240 | Bacteria | 847191 |
| 171 | Ga0265329_10003084 | 3300031242 | Bacteria | 7379 |
| 172 | Ga0265331_10027028 | 3300031250 | Bacteria | 2880 |
| 173 | Ga0265327_10000003 | 3300031251 | Bacteria | 852750 |
| 174 | Ga0265316_10043738 | 3300031344 | Bacteria | 3567 |
| 175 | Ga0265314_10000103 | 3300031711 | Bacteria | 127956 |
| 176 | Ga0466963_0000035 | 3300044694 | Bacteria | 44364 |
| 177 | Ga0466963_0017737 | 3300044694 | Bacteria | 4440 |
| 178 | Ga0466963_0074254 | 3300044694 | Bacteria | 2293 |
| 179 | Ga0466967_0000003 | 3300045976 | Bacteria | 169144 |
| 180 | Ga0466967_0072194 | 3300045976 | Bacteria | 3093 |
| 181 | Ga0495592_0000782 | 3300046454 | Bacteria | 22058 |
| 182 | Ga0495592_0074732 | 3300046454 | Bacteria | 2462 |
| 183 | Ga0495603_0003155 | 3300046455 | Bacteria | 9803 |
| 184 | Ga0495603_0010184 | 3300046455 | Bacteria | 5690 |
| 185 | Ga0495641_0014780 | 3300046461 | Bacteria | 4209 |
| 186 | Ga0495653_0021594 | 3300046463 | Bacteria | 5215 |
| 187 | Ga0495653_0149993 | 3300046463 | Bacteria | 1630 |
| 188 | Ga0495582_0000007 | 3300046473 | Bacteria | 139882 |
| 189 | Ga0495662_0000031 | 3300046476 | Bacteria | 47907 |
| 190 | Ga0495664_0189838 | 3300046477 | Bacteria | 1246 |
| 191 | Ga0495594_0000017 | 3300046499 | Bacteria | 88992 |
| 192 | Ga0495606_0015106 | 3300046507 | Bacteria | 5974 |
| 193 | Ga0495608_0000528 | 3300046511 | Bacteria | 26176 |
| 194 | Ga0495608_0009658 | 3300046511 | Bacteria | 6732 |
| 195 | Ga0495618_0000838 | 3300046514 | Bacteria | 21350 |
| 196 | Ga0495628_0032408 | 3300046516 | Bacteria | 4219 |
| 197 | Ga0495628_0049946 | 3300046516 | Bacteria | 3310 |
| 198 | Ga0495630_0000053 | 3300046517 | Bacteria | 93065 |
| 199 | Ga0495630_0047979 | 3300046517 | Bacteria | 3195 |
| 200 | Ga0495652_0031087 | 3300046529 | Bacteria | 4678 |
| 201 | Ga0495640_0003562 | 3300046533 | Bacteria | 12507 |
| 202 | Ga0495586_0160638 | 3300046535 | Bacteria | 1267 |
| 203 | Ga0495587_0365286 | 3300046536 | Bacteria | 803 |
| 204 | Ga0495598_0000956 | 3300046537 | Bacteria | 5565 |
| 205 | Ga0495621_0471001 | 3300046539 | Unclassified | 539 |
| 206 | Ga0495645_0002206 | 3300046543 | Bacteria | 13245 |
| 207 | Ga0495645_0121303 | 3300046543 | Bacteria | 1840 |
| 208 | Ga0495622_0000107 | 3300046557 | Bacteria | 72476 |
| 209 | Ga0495633_0126999 | 3300046558 | Bacteria | 1180 |
| 210 | Ga0495667_0000086 | 3300046559 | Bacteria | 67148 |
| 211 | Ga0495667_0056080 | 3300046559 | Bacteria | 2591 |
| 212 | Ga0495634_0000030 | 3300046642 | Bacteria | 110741 |
| 213 | Ga0495635_0000026 | 3300046663 | Bacteria | 142517 |
| 214 | Ga0495657_0000019 | 3300046675 | Bacteria | 168441 |
| 215 | Ga0495657_0013264 | 3300046675 | Bacteria | 6086 |
| 216 | Ga0495647_0000688 | 3300046681 | Bacteria | 10085 |
| 217 | Ga0495647_0003681 | 3300046681 | Bacteria | 4921 |
| 218 | Ga0495658_0000007 | 3300046683 | Bacteria | 139822 |
| 219 | Ga0495658_0022946 | 3300046683 | Bacteria | 3307 |
| 220 | Ga0495669_0000045 | 3300046684 | Bacteria | 84113 |
| 221 | Ga0495613_0000066 | 3300046689 | Bacteria | 102122 |
| 222 | Ga0495613_0000861 | 3300046689 | Bacteria | 23279 |
| 223 | Ga0495613_0064929 | 3300046689 | Bacteria | 2668 |
| 224 | Ga0495624_0000699 | 3300046690 | Bacteria | 26337 |
| 225 | Ga0495624_0096769 | 3300046690 | Bacteria | 1818 |
| 226 | Ga0495670_0005477 | 3300046691 | Bacteria | 6230 |
| 227 | Ga0495600_0009323 | 3300046809 | Bacteria | 6061 |
| 228 | Ga0495600_0017169 | 3300046809 | Bacteria | 4601 |
| 229 | Ga0495600_0202300 | 3300046809 | Bacteria | 1275 |
| 230 | Ga0495581_0094852 | 3300047315 | Bacteria | 1732 |
| 231 | Ga0495604_0044651 | 3300047317 | Bacteria | 3460 |
| 232 | Ga0495672_0169630 | 3300047320 | Bacteria | 1114 |
| 233 | Ga0495676_0167068 | 3300047321 | Bacteria | 1551 |
| 234 | Ga0495680_0002059 | 3300047322 | Bacteria | 20963 |
| 235 | Ga0495680_0003939 | 3300047322 | Bacteria | 14356 |
| 236 | Ga0495675_0000141 | 3300047444 | Bacteria | 50168 |
| 237 | Ga0495679_113226 | 3300047446 | Bacteria | 745 |
| 238 | Ga0495685_022293 | 3300047447 | Bacteria | 2179 |
| 239 | Ga0495684_0236223 | 3300047471 | Bacteria | 1335 |
| 240 | Ga0495684_0550939 | 3300047471 | Bacteria | 785 |
| 241 | Ga0495593_0031920 | 3300047673 | Bacteria | 2874 |
| 242 | Ga0495593_0100625 | 3300047673 | Bacteria | 1482 |
| 243 | Ga0495602_0000008 | 3300048088 | Bacteria | 260157 |
| 244 | Ga0495602_0144537 | 3300048088 | Bacteria | 1878 |
| 245 | Ga0496100_0000003 | 3300048903 | Bacteria | 360802 |
| 246 | Ga0496101_0000003 | 3300048904 | Bacteria | 406565 |
| 247 | Ga0496104_0000120 | 3300048907 | Bacteria | 72797 |
| 248 | Ga0496105_0000020 | 3300048908 | Bacteria | 181484 |
| 249 | Ga0496105_0038043 | 3300048908 | Bacteria | 3963 |
| 250 | Ga0496106_0000146 | 3300048909 | Bacteria | 52294 |
| 251 | Ga0496107_0000026 | 3300048910 | Bacteria | 108989 |
| 252 | Ga0496108_0000025 | 3300048911 | Bacteria | 177919 |
| 253 | Ga0496108_0000032 | 3300048911 | Bacteria | 158930 |
| 254 | Ga0496108_0000163 | 3300048911 | Bacteria | 62902 |
| 255 | Ga0496108_0009252 | 3300048911 | Bacteria | 7971 |
| 256 | Ga0496108_0279467 | 3300048911 | Bacteria | 1453 |
| 257 | Ga0496109_0000070 | 3300048912 | Bacteria | 108889 |
| 258 | Ga0496109_0000081 | 3300048912 | Bacteria | 99723 |
| 259 | Ga0496109_0000291 | 3300048912 | Bacteria | 47681 |
| 260 | Ga0496109_0000884 | 3300048912 | Bacteria | 25037 |
| 261 | Ga0496109_0063440 | 3300048912 | Bacteria | 3380 |
| 262 | Ga0496110_0080947 | 3300048913 | Bacteria | 2895 |
| 263 | Ga0496111_0000024 | 3300048914 | Bacteria | 62369 |
| 264 | Ga0496112_0000003 | 3300048915 | Bacteria | 660147 |
| 265 | Ga0496112_0000668 | 3300048915 | Bacteria | 23904 |
| 266 | Ga0496113_0000025 | 3300048916 | Bacteria | 64773 |
| 267 | Ga0496113_0026210 | 3300048916 | Bacteria | 4165 |
| 268 | Ga0496113_0764961 | 3300048916 | Bacteria | 768 |
| 269 | Ga0496115_0006417 | 3300048918 | Bacteria | 8616 |
| 270 | Ga0496119_0052463 | 3300048922 | Bacteria | 2497 |
| 271 | Ga0496119_0129425 | 3300048922 | Bacteria | 1377 |
| 272 | Ga0496120_0002606 | 3300048923 | Bacteria | 17878 |
| 273 | Ga0501042_0054259 | 3300049578 | Bacteria | 2858 |
| 274 | Ga0501068_0538114 | 3300049584 | Bacteria | 759 |
| 275 | Ga0501070_0036206 | 3300049586 | Bacteria | 4122 |
| 276 | Ga0501070_0042720 | 3300049586 | Bacteria | 3775 |
| 277 | nmdc:mga0a205_70565_c1 | 3300050515 | Bacteria | 3373 |
| 278 | Ga0495601_0000096 | 3300053077 | Bacteria | 48420 |
| 279 | Ga0495612_0001210 | 3300053078 | Bacteria | 10641 |
| 280 | Ga0495612_0015760 | 3300053078 | Bacteria | 3029 |
| 281 | Ga0495655_0008260 | 3300053083 | Bacteria | 1970 |
| 282 | Ga0495595_0000004 | 3300053084 | Bacteria | 260821 |
| 283 | Ga0495595_0000101 | 3300053084 | Bacteria | 38966 |
| 284 | Ga0495595_0038007 | 3300053084 | Bacteria | 2191 |
| 285 | Ga0495619_0000015 | 3300053085 | Bacteria | 252787 |
| 286 | Ga0495619_0000080 | 3300053085 | Bacteria | 72201 |
| 287 | Ga0495619_0000278 | 3300053085 | Bacteria | 36705 |
| 288 | Ga0495619_0000336 | 3300053085 | Bacteria | 32967 |
| 289 | Ga0495619_0058069 | 3300053085 | Bacteria | 2568 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005435 | Ga0070714_100394063 | Ga0070714_1003940632 | 148 |
| 2 | 3300013308 | Ga0157375_10162809 | Ga0157375_101628093 | 154 |
| 3 | 3300005340 | Ga0070689_100737137 | Ga0070689_1007371372 | 155 |
| 4 | 3300005364 | Ga0070673_100066959 | Ga0070673_1000669593 | 155 |
| 5 | 3300005459 | Ga0068867_100000145 | Ga0068867_1000001457 | 155 |
| 6 | 3300006846 | Ga0075430_100651669 | Ga0075430_1006516691 | 155 |
| 7 | 3300014326 | Ga0157380_10002621 | Ga0157380_100026215 | 155 |
| 8 | 3300025936 | Ga0207670_10617345 | Ga0207670_106173452 | 155 |
| 9 | 3300025960 | Ga0207651_10045867 | Ga0207651_100458673 | 155 |
| 10 | 3300026089 | Ga0207648_10000573 | Ga0207648_100005737 | 155 |
| 11 | 3300046455 | Ga0495603_0003155 | Ga0495603_0003155_5652_6164 | 155 |
| 12 | 3300046455 | Ga0495603_0010184 | Ga0495603_0010184_2175_2684 | 155 |
| 13 | 3300046463 | Ga0495653_0021594 | Ga0495653_0021594_994_1467 | 155 |
| 14 | 3300046476 | Ga0495662_0000031 | Ga0495662_0000031_29367_29840 | 155 |
| 15 | 3300046514 | Ga0495618_0000838 | Ga0495618_0000838_5489_5962 | 155 |
| 16 | 3300046516 | Ga0495628_0032408 | Ga0495628_0032408_1547_2020 | 155 |
| 17 | 3300046517 | Ga0495630_0047979 | Ga0495630_0047979_2563_3036 | 155 |
| 18 | 3300046533 | Ga0495640_0003562 | Ga0495640_0003562_2735_3208 | 155 |
| 19 | 3300046535 | Ga0495586_0160638 | Ga0495586_0160638_12_485 | 155 |
| 20 | 3300046537 | Ga0495598_0000956 | Ga0495598_0000956_3170_3661 | 155 |
| 21 | 3300046539 | Ga0495621_0471001 | Ga0495621_0471001_37_522 | 155 |
| 22 | 3300046558 | Ga0495633_0126999 | Ga0495633_0126999_521_1006 | 155 |
| 23 | 3300046663 | Ga0495635_0000026 | Ga0495635_0000026_21397_21870 | 155 |
| 24 | 3300046675 | Ga0495657_0013264 | Ga0495657_0013264_2851_3336 | 155 |
| 25 | 3300046681 | Ga0495647_0000688 | Ga0495647_0000688_4117_4590 | 155 |
| 26 | 3300046690 | Ga0495624_0096769 | Ga0495624_0096769_284_757 | 155 |
| 27 | 3300046691 | Ga0495670_0005477 | Ga0495670_0005477_1146_1631 | 155 |
| 28 | 3300046809 | Ga0495600_0009323 | Ga0495600_0009323_3604_4077 | 155 |
| 29 | 3300047315 | Ga0495581_0094852 | Ga0495581_0094852_168_641 | 155 |
| 30 | 3300047322 | Ga0495680_0002059 | Ga0495680_0002059_14768_15241 | 155 |
| 31 | 3300047447 | Ga0495685_022293 | Ga0495685_022293_1499_2056 | 155 |
| 32 | 3300047471 | Ga0495684_0550939 | Ga0495684_0550939_236_709 | 155 |
| 33 | 3300047673 | Ga0495593_0031920 | Ga0495593_0031920_784_1287 | 155 |
| 34 | 3300048088 | Ga0495602_0144537 | Ga0495602_0144537_1142_1645 | 155 |
| 35 | 3300048915 | Ga0496112_0000003 | Ga0496112_0000003_479048_479524 | 155 |
| 36 | 3300005439 | Ga0070711_100034629 | Ga0070711_1000346292 | 156 |
| 37 | 3300025914 | Ga0207671_10370665 | Ga0207671_103706651 | 156 |
| 38 | 3300025916 | Ga0207663_10033321 | Ga0207663_100333214 | 156 |
| 39 | 3300046516 | Ga0495628_0049946 | Ga0495628_0049946_226_702 | 156 |
| 40 | 3300005329 | Ga0070683_100071261 | Ga0070683_1000712615 | 157 |
| 41 | 3300005535 | Ga0070684_100060602 | Ga0070684_1000606024 | 157 |
| 42 | 3300006852 | Ga0075433_10306746 | Ga0075433_103067462 | 157 |
| 43 | 3300009551 | Ga0105238_10000051 | Ga0105238_10000051101 | 157 |
| 44 | 3300009553 | Ga0105249_10164726 | Ga0105249_101647262 | 157 |
| 45 | 3300025924 | Ga0207694_10000035 | Ga0207694_1000003536 | 157 |
| 46 | 3300025944 | Ga0207661_10053213 | Ga0207661_100532135 | 157 |
| 47 | 3300025961 | Ga0207712_11222749 | Ga0207712_112227491 | 157 |
| 48 | 3300050515 | nmdc:mga0a205_70565_c1 | nmdc:mga0a205_70565_c1_597_1076 | 157 |
| 49 | 3300001977 | JGI24746J21847_1000093 | JGI24746J21847_10000935 | 158 |
| 50 | 3300005333 | Ga0070677_10000153 | Ga0070677_1000015316 | 158 |
| 51 | 3300005578 | Ga0068854_100221319 | Ga0068854_1002213192 | 158 |
| 52 | 3300005718 | Ga0068866_11078768 | Ga0068866_110787681 | 158 |
| 53 | 3300009098 | Ga0105245_10000262 | Ga0105245_1000026244 | 158 |
| 54 | 3300009553 | Ga0105249_10000708 | Ga0105249_100007084 | 158 |
| 55 | 3300013308 | Ga0157375_10371839 | Ga0157375_103718392 | 158 |
| 56 | 3300014968 | Ga0157379_10033747 | Ga0157379_100337475 | 158 |
| 57 | 3300025893 | Ga0207682_10000756 | Ga0207682_100007568 | 158 |
| 58 | 3300025899 | Ga0207642_10747347 | Ga0207642_107473471 | 158 |
| 59 | 3300025927 | Ga0207687_10000058 | Ga0207687_1000005880 | 158 |
| 60 | 3300025961 | Ga0207712_10000033 | Ga0207712_10000033167 | 158 |
| 61 | 3300025981 | Ga0207640_10695047 | Ga0207640_106950472 | 158 |
| 62 | 3300046684 | Ga0495669_0000045 | Ga0495669_0000045_68749_69240 | 158 |
| 63 | 3300048903 | Ga0496100_0000003 | Ga0496100_0000003_48164_48655 | 158 |
| 64 | 3300048904 | Ga0496101_0000003 | Ga0496101_0000003_48164_48655 | 158 |
| 65 | 3300048907 | Ga0496104_0000120 | Ga0496104_0000120_58141_58632 | 158 |
| 66 | 3300048908 | Ga0496105_0000020 | Ga0496105_0000020_14166_14657 | 158 |
| 67 | 3300048909 | Ga0496106_0000146 | Ga0496106_0000146_48154_48645 | 158 |
| 68 | 3300048910 | Ga0496107_0000026 | Ga0496107_0000026_48164_48655 | 158 |
| 69 | 3300048911 | Ga0496108_0000032 | Ga0496108_0000032_81665_82147 | 158 |
| 70 | 3300048912 | Ga0496109_0000070 | Ga0496109_0000070_76784_77266 | 158 |
| 71 | 3300048915 | Ga0496112_0000668 | Ga0496112_0000668_868_1398 | 158 |
| 72 | 3300048916 | Ga0496113_0000025 | Ga0496113_0000025_35445_35975 | 158 |
| 73 | 3300049586 | Ga0501070_0042720 | Ga0501070_0042720_3066_3548 | 158 |
| 74 | 3300005337 | Ga0070682_100000086 | Ga0070682_10000008682 | 159 |
| 75 | 3300005456 | Ga0070678_100017734 | Ga0070678_1000177347 | 159 |
| 76 | 3300005578 | Ga0068854_100000091 | Ga0068854_10000009149 | 159 |
| 77 | 3300006175 | Ga0070712_100917060 | Ga0070712_1009170602 | 159 |
| 78 | 3300009098 | Ga0105245_10055348 | Ga0105245_100553484 | 159 |
| 79 | 3300010375 | Ga0105239_10204170 | Ga0105239_102041702 | 159 |
| 80 | 3300013307 | Ga0157372_10000435 | Ga0157372_100004357 | 159 |
| 81 | 3300025321 | Ga0207656_10000314 | Ga0207656_1000031411 | 159 |
| 82 | 3300025927 | Ga0207687_10024861 | Ga0207687_100248614 | 159 |
| 83 | 3300025981 | Ga0207640_10000140 | Ga0207640_1000014048 | 159 |
| 84 | 3300026121 | Ga0207683_10070285 | Ga0207683_100702855 | 159 |
| 85 | 3300044694 | Ga0466963_0000035 | Ga0466963_0000035_29996_30481 | 159 |
| 86 | 3300044694 | Ga0466963_0017737 | Ga0466963_0017737_1091_1582 | 159 |
| 87 | 3300047320 | Ga0495672_0169630 | Ga0495672_0169630_335_817 | 159 |
| 88 | 3300048914 | Ga0496111_0000024 | Ga0496111_0000024_36549_37130 | 159 |
| 89 | 3300049578 | Ga0501042_0054259 | Ga0501042_0054259_2041_2526 | 159 |
| 90 | 3300053085 | Ga0495619_0000336 | Ga0495619_0000336_5197_5679 | 159 |
| 91 | 3300002459 | JGI24751J29686_10009898 | JGI24751J29686_100098982 | 160 |
| 92 | 3300005330 | Ga0070690_100684957 | Ga0070690_1006849571 | 160 |
| 93 | 3300005335 | Ga0070666_10009423 | Ga0070666_100094235 | 160 |
| 94 | 3300005338 | Ga0068868_100003507 | Ga0068868_1000035078 | 160 |
| 95 | 3300005455 | Ga0070663_100642270 | Ga0070663_1006422701 | 160 |
| 96 | 3300005544 | Ga0070686_100633780 | Ga0070686_1006337802 | 160 |
| 97 | 3300005548 | Ga0070665_100160305 | Ga0070665_1001603053 | 160 |
| 98 | 3300005548 | Ga0070665_100543586 | Ga0070665_1005435862 | 160 |
| 99 | 3300005616 | Ga0068852_100128819 | Ga0068852_1001288193 | 160 |
| 100 | 3300005719 | Ga0068861_100998968 | Ga0068861_1009989682 | 160 |
| 101 | 3300005834 | Ga0068851_10003586 | Ga0068851_100035865 | 160 |
| 102 | 3300009174 | Ga0105241_11108581 | Ga0105241_111085812 | 160 |
| 103 | 3300014325 | Ga0163163_10095359 | Ga0163163_100953593 | 160 |
| 104 | 3300014969 | Ga0157376_10244112 | Ga0157376_102441123 | 160 |
| 105 | 3300025321 | Ga0207656_10037458 | Ga0207656_100374583 | 160 |
| 106 | 3300025903 | Ga0207680_10008301 | Ga0207680_100083013 | 160 |
| 107 | 3300026023 | Ga0207677_10000440 | Ga0207677_1000044011 | 160 |
| 108 | 3300026142 | Ga0207698_10081487 | Ga0207698_100814874 | 160 |
| 109 | 3300028379 | Ga0268266_10001920 | Ga0268266_100019205 | 160 |
| 110 | 3300028379 | Ga0268266_10084798 | Ga0268266_100847984 | 160 |
| 111 | 3300028381 | Ga0268264_10017018 | Ga0268264_100170185 | 160 |
| 112 | 3300046461 | Ga0495641_0014780 | Ga0495641_0014780_3328_3813 | 160 |
| 113 | 3300046517 | Ga0495630_0000053 | Ga0495630_0000053_22095_22589 | 160 |
| 114 | 3300046642 | Ga0495634_0000030 | Ga0495634_0000030_10604_11092 | 160 |
| 115 | 3300046681 | Ga0495647_0003681 | Ga0495647_0003681_1277_1762 | 160 |
| 116 | 3300046690 | Ga0495624_0000699 | Ga0495624_0000699_837_1322 | 160 |
| 117 | 3300047321 | Ga0495676_0167068 | Ga0495676_0167068_223_717 | 160 |
| 118 | 3300047471 | Ga0495684_0236223 | Ga0495684_0236223_549_1034 | 160 |
| 119 | 3300048908 | Ga0496105_0038043 | Ga0496105_0038043_3424_3912 | 160 |
| 120 | 3300049584 | Ga0501068_0538114 | Ga0501068_0538114_207_692 | 160 |
| 121 | 3300005327 | Ga0070658_10125411 | Ga0070658_101254112 | 161 |
| 122 | 3300005329 | Ga0070683_100098363 | Ga0070683_1000983632 | 161 |
| 123 | 3300005331 | Ga0070670_100150143 | Ga0070670_1001501433 | 161 |
| 124 | 3300005340 | Ga0070689_100360324 | Ga0070689_1003603242 | 161 |
| 125 | 3300005341 | Ga0070691_10002759 | Ga0070691_100027595 | 161 |
| 126 | 3300005344 | Ga0070661_100000633 | Ga0070661_10000063320 | 161 |
| 127 | 3300005365 | Ga0070688_100041350 | Ga0070688_1000413503 | 161 |
| 128 | 3300005436 | Ga0070713_100000080 | Ga0070713_10000008053 | 161 |
| 129 | 3300005535 | Ga0070684_100038032 | Ga0070684_1000380324 | 161 |
| 130 | 3300005544 | Ga0070686_100243318 | Ga0070686_1002433182 | 161 |
| 131 | 3300005546 | Ga0070696_100788242 | Ga0070696_1007882421 | 161 |
| 132 | 3300005564 | Ga0070664_100037876 | Ga0070664_1000378764 | 161 |
| 133 | 3300005578 | Ga0068854_100929873 | Ga0068854_1009298731 | 161 |
| 134 | 3300005614 | Ga0068856_100712613 | Ga0068856_1007126132 | 161 |
| 135 | 3300005616 | Ga0068852_100000035 | Ga0068852_10000003545 | 161 |
| 136 | 3300005985 | Ga0081539_10004745 | Ga0081539_1000474514 | 161 |
| 137 | 3300009148 | Ga0105243_10024504 | Ga0105243_100245042 | 161 |
| 138 | 3300013104 | Ga0157370_10032862 | Ga0157370_100328625 | 161 |
| 139 | 3300013297 | Ga0157378_10386945 | Ga0157378_103869452 | 161 |
| 140 | 3300013308 | Ga0157375_10017809 | Ga0157375_100178095 | 161 |
| 141 | 3300013308 | Ga0157375_10353922 | Ga0157375_103539223 | 161 |
| 142 | 3300013308 | Ga0157375_11075977 | Ga0157375_110759772 | 161 |
| 143 | 3300020070 | Ga0206356_10600948 | Ga0206356_106009483 | 161 |
| 144 | 3300022467 | Ga0224712_10062352 | Ga0224712_100623522 | 161 |
| 145 | 3300025909 | Ga0207705_10041752 | Ga0207705_100417524 | 161 |
| 146 | 3300025920 | Ga0207649_10000333 | Ga0207649_1000033327 | 161 |
| 147 | 3300025925 | Ga0207650_10057334 | Ga0207650_100573344 | 161 |
| 148 | 3300025928 | Ga0207700_10000013 | Ga0207700_10000013167 | 161 |
| 149 | 3300025935 | Ga0207709_10012647 | Ga0207709_100126476 | 161 |
| 150 | 3300025936 | Ga0207670_10246054 | Ga0207670_102460542 | 161 |
| 151 | 3300025944 | Ga0207661_10075662 | Ga0207661_100756624 | 161 |
| 152 | 3300025945 | Ga0207679_10011056 | Ga0207679_100110563 | 161 |
| 153 | 3300025981 | Ga0207640_10801738 | Ga0207640_108017382 | 161 |
| 154 | 3300026023 | Ga0207677_10001509 | Ga0207677_100015095 | 161 |
| 155 | 3300026035 | Ga0207703_10000028 | Ga0207703_10000028165 | 161 |
| 156 | 3300026078 | Ga0207702_10018709 | Ga0207702_100187092 | 161 |
| 157 | 3300026078 | Ga0207702_10041360 | Ga0207702_100413604 | 161 |
| 158 | 3300026142 | Ga0207698_10000044 | Ga0207698_1000004415 | 161 |
| 159 | 3300028556 | Ga0265337_1002120 | Ga0265337_10021201 | 161 |
| 160 | 3300028558 | Ga0265326_10000038 | Ga0265326_1000003854 | 161 |
| 161 | 3300028654 | Ga0265322_10000006 | Ga0265322_10000006186 | 161 |
| 162 | 3300029957 | Ga0265324_10000342 | Ga0265324_1000034227 | 161 |
| 163 | 3300031238 | Ga0265332_10024262 | Ga0265332_100242624 | 161 |
| 164 | 3300031239 | Ga0265328_10001699 | Ga0265328_100016999 | 161 |
| 165 | 3300031240 | Ga0265320_10000001 | Ga0265320_10000001655 | 161 |
| 166 | 3300031242 | Ga0265329_10003084 | Ga0265329_100030844 | 161 |
| 167 | 3300031250 | Ga0265331_10027028 | Ga0265331_100270283 | 161 |
| 168 | 3300031251 | Ga0265327_10000003 | Ga0265327_10000003655 | 161 |
| 169 | 3300031344 | Ga0265316_10043738 | Ga0265316_100437382 | 161 |
| 170 | 3300031711 | Ga0265314_10000103 | Ga0265314_1000010344 | 161 |
| 171 | 3300044694 | Ga0466963_0074254 | Ga0466963_0074254_1325_1822 | 161 |
| 172 | 3300045976 | Ga0466967_0000003 | Ga0466967_0000003_119442_119930 | 161 |
| 173 | 3300046454 | Ga0495592_0074732 | Ga0495592_0074732_828_1328 | 161 |
| 174 | 3300046507 | Ga0495606_0015106 | Ga0495606_0015106_4665_5153 | 161 |
| 175 | 3300046511 | Ga0495608_0009658 | Ga0495608_0009658_2993_3484 | 161 |
| 176 | 3300046529 | Ga0495652_0031087 | Ga0495652_0031087_1082_1579 | 161 |
| 177 | 3300046543 | Ga0495645_0121303 | Ga0495645_0121303_371_868 | 161 |
| 178 | 3300046557 | Ga0495622_0000107 | Ga0495622_0000107_52448_52948 | 161 |
| 179 | 3300046559 | Ga0495667_0000086 | Ga0495667_0000086_22558_23100 | 161 |
| 180 | 3300046559 | Ga0495667_0056080 | Ga0495667_0056080_1329_1820 | 161 |
| 181 | 3300046675 | Ga0495657_0000019 | Ga0495657_0000019_167089_167595 | 161 |
| 182 | 3300046689 | Ga0495613_0064929 | Ga0495613_0064929_551_1042 | 161 |
| 183 | 3300047322 | Ga0495680_0003939 | Ga0495680_0003939_1114_1656 | 161 |
| 184 | 3300047444 | Ga0495675_0000141 | Ga0495675_0000141_1281_1787 | 161 |
| 185 | 3300047446 | Ga0495679_113226 | Ga0495679_113226_37_540 | 161 |
| 186 | 3300048911 | Ga0496108_0000163 | Ga0496108_0000163_4741_5256 | 161 |
| 187 | 3300048912 | Ga0496109_0000291 | Ga0496109_0000291_18158_18673 | 161 |
| 188 | 3300048913 | Ga0496110_0080947 | Ga0496110_0080947_1734_2222 | 161 |
| 189 | 3300048918 | Ga0496115_0006417 | Ga0496115_0006417_2252_2740 | 161 |
| 190 | 3300049586 | Ga0501070_0036206 | Ga0501070_0036206_979_1500 | 161 |
| 191 | 3300053078 | Ga0495612_0001210 | Ga0495612_0001210_827_1315 | 161 |
| 192 | 3300053084 | Ga0495595_0000004 | Ga0495595_0000004_167089_167595 | 161 |
| 193 | 3300053085 | Ga0495619_0000015 | Ga0495619_0000015_235357_235848 | 161 |
| 194 | 3300053085 | Ga0495619_0000080 | Ga0495619_0000080_851_1357 | 161 |
| 195 | 3300053085 | Ga0495619_0000278 | Ga0495619_0000278_3117_3626 | 161 |
| 196 | 3300000532 | CNAas_1002628 | CNAas_10026281 | 162 |
| 197 | 3300001979 | JGI24740J21852_10002620 | JGI24740J21852_100026206 | 162 |
| 198 | 3300005329 | Ga0070683_100005810 | Ga0070683_10000581010 | 162 |
| 199 | 3300005329 | Ga0070683_100011121 | Ga0070683_1000111212 | 162 |
| 200 | 3300005339 | Ga0070660_100125941 | Ga0070660_1001259411 | 162 |
| 201 | 3300005354 | Ga0070675_100000063 | Ga0070675_10000006355 | 162 |
| 202 | 3300005356 | Ga0070674_100000144 | Ga0070674_1000001445 | 162 |
| 203 | 3300005365 | Ga0070688_100003080 | Ga0070688_1000030804 | 162 |
| 204 | 3300005365 | Ga0070688_100033158 | Ga0070688_1000331582 | 162 |
| 205 | 3300005366 | Ga0070659_100003464 | Ga0070659_1000034645 | 162 |
| 206 | 3300005436 | Ga0070713_100123164 | Ga0070713_1001231643 | 162 |
| 207 | 3300005466 | Ga0070685_10000340 | Ga0070685_1000034031 | 162 |
| 208 | 3300005466 | Ga0070685_10009982 | Ga0070685_100099822 | 162 |
| 209 | 3300005535 | Ga0070684_100062924 | Ga0070684_1000629244 | 162 |
| 210 | 3300005535 | Ga0070684_100310242 | Ga0070684_1003102423 | 162 |
| 211 | 3300005539 | Ga0068853_100357804 | Ga0068853_1003578042 | 162 |
| 212 | 3300005539 | Ga0068853_100458789 | Ga0068853_1004587892 | 162 |
| 213 | 3300005577 | Ga0068857_100038576 | Ga0068857_1000385765 | 162 |
| 214 | 3300005614 | Ga0068856_100001180 | Ga0068856_10000118011 | 162 |
| 215 | 3300005615 | Ga0070702_100083830 | Ga0070702_1000838303 | 162 |
| 216 | 3300005616 | Ga0068852_100225069 | Ga0068852_1002250691 | 162 |
| 217 | 3300005718 | Ga0068866_10000014 | Ga0068866_100000145 | 162 |
| 218 | 3300005937 | Ga0081455_10013246 | Ga0081455_100132463 | 162 |
| 219 | 3300005983 | Ga0081540_1000564 | Ga0081540_100056416 | 162 |
| 220 | 3300006028 | Ga0070717_11288509 | Ga0070717_112885091 | 162 |
| 221 | 3300006175 | Ga0070712_100003110 | Ga0070712_1000031102 | 162 |
| 222 | 3300006881 | Ga0068865_100000260 | Ga0068865_10000026027 | 162 |
| 223 | 3300009098 | Ga0105245_10007535 | Ga0105245_100075354 | 162 |
| 224 | 3300009101 | Ga0105247_10000576 | Ga0105247_1000057632 | 162 |
| 225 | 3300009177 | Ga0105248_10000547 | Ga0105248_1000054728 | 162 |
| 226 | 3300010375 | Ga0105239_10451105 | Ga0105239_104511052 | 162 |
| 227 | 3300013102 | Ga0157371_10029889 | Ga0157371_100298893 | 162 |
| 228 | 3300013104 | Ga0157370_10039812 | Ga0157370_100398125 | 162 |
| 229 | 3300013105 | Ga0157369_10000348 | Ga0157369_1000034826 | 162 |
| 230 | 3300013297 | Ga0157378_10026356 | Ga0157378_100263564 | 162 |
| 231 | 3300014326 | Ga0157380_10000092 | Ga0157380_100000925 | 162 |
| 232 | 3300014968 | Ga0157379_10202746 | Ga0157379_102027462 | 162 |
| 233 | 3300017792 | Ga0163161_10000018 | Ga0163161_10000018164 | 162 |
| 234 | 3300020610 | Ga0154015_1235223 | Ga0154015_12352232 | 162 |
| 235 | 3300025899 | Ga0207642_10000001 | Ga0207642_10000001685 | 162 |
| 236 | 3300025900 | Ga0207710_10000154 | Ga0207710_1000015450 | 162 |
| 237 | 3300025905 | Ga0207685_10000001 | Ga0207685_10000001187 | 162 |
| 238 | 3300025915 | Ga0207693_10021324 | Ga0207693_100213245 | 162 |
| 239 | 3300025916 | Ga0207663_10085774 | Ga0207663_100857741 | 162 |
| 240 | 3300025926 | Ga0207659_10000054 | Ga0207659_1000005424 | 162 |
| 241 | 3300025927 | Ga0207687_10000027 | Ga0207687_1000002764 | 162 |
| 242 | 3300025928 | Ga0207700_10276903 | Ga0207700_102769032 | 162 |
| 243 | 3300025932 | Ga0207690_10003028 | Ga0207690_100030285 | 162 |
| 244 | 3300025937 | Ga0207669_10013849 | Ga0207669_100138492 | 162 |
| 245 | 3300025938 | Ga0207704_10002108 | Ga0207704_100021089 | 162 |
| 246 | 3300025941 | Ga0207711_10000019 | Ga0207711_10000019417 | 162 |
| 247 | 3300025944 | Ga0207661_10008279 | Ga0207661_100082795 | 162 |
| 248 | 3300025944 | Ga0207661_10010934 | Ga0207661_100109342 | 162 |
| 249 | 3300025949 | Ga0207667_10402383 | Ga0207667_104023832 | 162 |
| 250 | 3300026041 | Ga0207639_10237912 | Ga0207639_102379123 | 162 |
| 251 | 3300026078 | Ga0207702_10000737 | Ga0207702_1000073731 | 162 |
| 252 | 3300026116 | Ga0207674_10046568 | Ga0207674_100465682 | 162 |
| 253 | 3300026142 | Ga0207698_10047805 | Ga0207698_100478051 | 162 |
| 254 | 3300028379 | Ga0268266_10017705 | Ga0268266_100177056 | 162 |
| 255 | 3300045976 | Ga0466967_0072194 | Ga0466967_0072194_35_532 | 162 |
| 256 | 3300046454 | Ga0495592_0000782 | Ga0495592_0000782_5653_6150 | 162 |
| 257 | 3300046463 | Ga0495653_0149993 | Ga0495653_0149993_951_1475 | 162 |
| 258 | 3300046473 | Ga0495582_0000007 | Ga0495582_0000007_98032_98556 | 162 |
| 259 | 3300046477 | Ga0495664_0189838 | Ga0495664_0189838_434_940 | 162 |
| 260 | 3300046499 | Ga0495594_0000017 | Ga0495594_0000017_49149_49640 | 162 |
| 261 | 3300046511 | Ga0495608_0000528 | Ga0495608_0000528_5446_5970 | 162 |
| 262 | 3300046536 | Ga0495587_0365286 | Ga0495587_0365286_162_686 | 162 |
| 263 | 3300046543 | Ga0495645_0002206 | Ga0495645_0002206_5542_6048 | 162 |
| 264 | 3300046683 | Ga0495658_0000007 | Ga0495658_0000007_97987_98511 | 162 |
| 265 | 3300046683 | Ga0495658_0022946 | Ga0495658_0022946_1290_1781 | 162 |
| 266 | 3300046689 | Ga0495613_0000066 | Ga0495613_0000066_72164_72688 | 162 |
| 267 | 3300046689 | Ga0495613_0000861 | Ga0495613_0000861_21161_21652 | 162 |
| 268 | 3300046809 | Ga0495600_0017169 | Ga0495600_0017169_4048_4539 | 162 |
| 269 | 3300046809 | Ga0495600_0202300 | Ga0495600_0202300_438_962 | 162 |
| 270 | 3300047317 | Ga0495604_0044651 | Ga0495604_0044651_1710_2201 | 162 |
| 271 | 3300047673 | Ga0495593_0100625 | Ga0495593_0100625_148_639 | 162 |
| 272 | 3300048088 | Ga0495602_0000008 | Ga0495602_0000008_232351_232842 | 162 |
| 273 | 3300048911 | Ga0496108_0000025 | Ga0496108_0000025_151502_151993 | 162 |
| 274 | 3300048911 | Ga0496108_0009252 | Ga0496108_0009252_6003_6521 | 162 |
| 275 | 3300048911 | Ga0496108_0279467 | Ga0496108_0279467_138_629 | 162 |
| 276 | 3300048912 | Ga0496109_0000081 | Ga0496109_0000081_37573_38064 | 162 |
| 277 | 3300048912 | Ga0496109_0000884 | Ga0496109_0000884_818_1309 | 162 |
| 278 | 3300048912 | Ga0496109_0063440 | Ga0496109_0063440_815_1333 | 162 |
| 279 | 3300048916 | Ga0496113_0026210 | Ga0496113_0026210_2929_3447 | 162 |
| 280 | 3300048916 | Ga0496113_0764961 | Ga0496113_0764961_130_621 | 162 |
| 281 | 3300048922 | Ga0496119_0052463 | Ga0496119_0052463_1252_1815 | 162 |
| 282 | 3300048922 | Ga0496119_0129425 | Ga0496119_0129425_288_812 | 162 |
| 283 | 3300048923 | Ga0496120_0002606 | Ga0496120_0002606_8403_8927 | 162 |
| 284 | 3300053077 | Ga0495601_0000096 | Ga0495601_0000096_23574_24065 | 162 |
| 285 | 3300053078 | Ga0495612_0015760 | Ga0495612_0015760_1812_2402 | 162 |
| 286 | 3300053083 | Ga0495655_0008260 | Ga0495655_0008260_1288_1779 | 162 |
| 287 | 3300053084 | Ga0495595_0000101 | Ga0495595_0000101_34439_34963 | 162 |
| 288 | 3300053084 | Ga0495595_0038007 | Ga0495595_0038007_1214_1705 | 162 |
| 289 | 3300053085 | Ga0495619_0058069 | Ga0495619_0058069_442_966 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lb5-assembly1.cif.gz_A-2 | crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form) | 0.9115 | 52 | 113 |
| 5w1e-assembly1.cif.gz_A | pobr in complex with phb | 0.9094 | 50 | 115 |
| 5cyv-assembly1.cif.gz_A | crystal structure of cour from rhodococcus jostii rha1 bound to p-coumaroyl-coa | 0.9072 | 27 | 154 |
| 3zpl-assembly2.cif.gz_F | crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna | 0.903 | 17 | 158 |
| 3zpl-assembly1.cif.gz_B | crystal structure of sco3205, a marr family transcriptional regulator from streptomyces coelicolor, in complex with dna | 0.9029 | 17 | 156 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1wsuB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.986 | 68 | 96 | 1.10.10.10 |
| af_Q57693_7_69_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9165 | 53 | 121 | 1.10.10.10 |
| 4lb5A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9115 | 52 | 113 | 1.10.10.10 |
| 5cyvA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9071 | 27 | 154 | 1.10.10.10 |
| 4nb5B01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9026 | 55 | 114 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536SYJ4-F1-model_v4 | MarR family transcriptional regulator | 0.9656 | 22 | 145 |
GO:0003700
GO:0006950 |
| AF-A0A4Q5NRZ8-F1-model_v4 | MarR family transcriptional regulator | 0.9645 | 19 | 155 |
GO:0003677
GO:0003700 GO:0006950 |
| AF-A0A536LI62-F1-model_v4 | MarR family transcriptional regulator | 0.9535 | 17 | 158 |
GO:0003700
GO:0006950 |
| AF-A0A537ZBK3-F1-model_v4 | MarR family transcriptional regulator | 0.9531 | 22 | 162 |
GO:0003700
GO:0006950 |
| AF-A0A3L7Y506-F1-model_v4 | MarR family transcriptional regulator | 0.9513 | 21 | 157 |
GO:0003700
GO:0006950 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar