F389204

General Info

Members Datasets Scaffolds Average Seq Length
289 197 578 234

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10488069|Ga0157380_104880691
Length 275
Sequence MGVPHRVPSIRDRRNNEEISMPSVLQALRLLAVILTFGILAPADVLAQATTLPTARPSSVLPTGGGQALLDASDVAILLLDHQAGLFQTVKDIGVAELRSNTVMLAKLATLMKIPVITTASEPNGTNGPLMPEIHQFAPHAIYVPRKGEVNAWDNELFVKTVRDTGKKTLIMAGVWTSVCVMFPALDAKAAGFKVYAVIDASGDPSEMASRTSLARFVQGGVIPTTTNAVLSEVHRTWNRPEAAEIGGLYAHVSPNYAAVVESYMKAQEVAKQAK

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
74 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
75 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
76 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
77 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
78 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
81 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
82 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
83 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
84 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
85 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
88 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
89 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
94 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
95 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
96 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
97 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
98 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
99 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
100 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
101 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
108 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
112 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
113 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
114 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
129 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
133 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
134 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
139 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
140 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
141 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
142 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
149 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
156 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
157 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
160 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
173 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
174 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
176 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
178 2508501050 Microvirga lupini Lut6 Isolate Nodule
179 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
180 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
181 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
182 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
183 2643221607 Rhizobium sp. Root73 Isolate Unclassified
184 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
185 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
186 2738541297 Duganella sp. GV083 Isolate Unclassified
187 2738541357 Duganella sp. GV053 Isolate Unclassified
188 2738543003 Duganella sp. GV066 Isolate Unclassified
189 2738543026 Duganella sp. GV089 Isolate Unclassified
190 2738543029 Duganella sp. GV039 Isolate Unclassified
191 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
192 2842711865 Duganella sp. R-73148 Isolate Unclassified
193 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
194 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
195 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
196 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
197 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.73
Metatranscriptomes 0.35
Isolates 6.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.54
Nodule 3.11
Rhizoplane 6.57
Rhizosphere 73.7
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10488069 3300014326 Bacteria 1193
2 MBSR1b_contig_3631991 2162886012 Bacteria 845
3 ARSoilOldRDRAFT_c002762 3300000044 Bacteria 1531
4 rootL2_10047635 3300003322 Bacteria 5142
5 Ga0055526_1030107 3300003771 Bacteria 1592
6 Ga0055524_1004406 3300003775 Bacteria 6494
7 Ga0055531_10003670 3300003794 Bacteria 9671
8 Ga0068868_100006072 3300005338 Bacteria 8530
9 Ga0070660_100270782 3300005339 Bacteria 1388
10 Ga0070661_100397139 3300005344 Bacteria 1090
11 Ga0070675_100453560 3300005354 Bacteria 1150
12 Ga0070671_100018002 3300005355 Bacteria 5733
13 Ga0070671_100123935 3300005355 Bacteria 2175
14 Ga0070671_100272747 3300005355 Bacteria 1438
15 Ga0070667_100796543 3300005367 Bacteria 877
16 Ga0070663_100010824 3300005455 Bacteria 5698
17 Ga0070663_100469448 3300005455 Bacteria 1040
18 Ga0070678_100017104 3300005456 Bacteria 4659
19 Ga0070678_100189200 3300005456 Bacteria 1691
20 Ga0070678_100665335 3300005456 Unclassified 935
21 Ga0070662_100118137 3300005457 Bacteria 2029
22 Ga0070679_100069958 3300005530 Bacteria 3501
23 Ga0068853_100025231 3300005539 Bacteria 4988
24 Ga0070672_100016785 3300005543 Bacteria 5250
25 Ga0070686_100215205 3300005544 Bacteria 1386
26 Ga0070665_100609867 3300005548 Bacteria 1104
27 Ga0070664_100096947 3300005564 Bacteria 2560
28 Ga0068854_100089336 3300005578 Bacteria 2289
29 Ga0068859_100000002 3300005617 Bacteria 541370
30 Ga0068864_100004082 3300005618 Bacteria 11990
31 Ga0068851_10034290 3300005834 Bacteria 2532
32 Ga0068863_100018337 3300005841 Bacteria 6700
33 Ga0068863_100086709 3300005841 Bacteria 2967
34 Ga0081455_10044473 3300005937 Bacteria 3873
35 Ga0081455_10066665 3300005937 Bacteria 3005
36 Ga0081538_10139754 3300005981 Bacteria 1119
37 Ga0070716_100197568 3300006173 Bacteria 1334
38 Ga0075369_10032818 3300006186 Bacteria 2198
39 Ga0075366_10030284 3300006195 Bacteria 3181
40 Ga0097621_100325024 3300006237 Bacteria 1363
41 Ga0068871_100281047 3300006358 Bacteria 1456
42 Ga0068871_100633255 3300006358 Bacteria 975
43 Ga0075428_100028938 3300006844 Bacteria 6131
44 Ga0075428_100098190 3300006844 Bacteria 3193
45 Ga0075428_100286255 3300006844 Bacteria 1773
46 Ga0075428_100627409 3300006844 Bacteria 1147
47 Ga0075430_100002245 3300006846 Bacteria 16019
48 Ga0075430_100025078 3300006846 Bacteria 5073
49 Ga0075430_100038318 3300006846 Bacteria 4060
50 Ga0075430_100102874 3300006846 Bacteria 2385
51 Ga0075431_100000920 3300006847 Bacteria 25931
52 Ga0075431_100011300 3300006847 Bacteria 8994
53 Ga0075431_100013815 3300006847 Bacteria 8153
54 Ga0075431_100042392 3300006847 Bacteria 4694
55 Ga0075431_100170476 3300006847 Bacteria 2236
56 Ga0075431_100646360 3300006847 Bacteria 1038
57 Ga0075429_100188639 3300006880 Bacteria 1806
58 Ga0075429_100203520 3300006880 Bacteria 1734
59 Ga0075429_100394445 3300006880 Bacteria 1212
60 Ga0068865_100248480 3300006881 Bacteria 1403
61 Ga0097620_100000002 3300006931 Bacteria 541370
62 Ga0111539_10783906 3300009094 Bacteria 1109
63 Ga0111539_10848326 3300009094 Bacteria 1063
64 Ga0105245_10015156 3300009098 Bacteria 6716
65 Ga0105247_10051867 3300009101 Bacteria 2528
66 Ga0114129_10079248 3300009147 Bacteria 4568
67 Ga0114129_10198078 3300009147 Bacteria 2722
68 Ga0114129_10201465 3300009147 Bacteria 2695
69 Ga0114129_10494670 3300009147 Bacteria 1598
70 Ga0114129_10532504 3300009147 Bacteria 1530
71 Ga0105242_10066284 3300009176 Bacteria 2981
72 Ga0105248_10009915 3300009177 Bacteria 10488
73 Ga0105248_10183714 3300009177 Bacteria 2356
74 Ga0105249_10352407 3300009553 Bacteria 1491
75 Ga0157378_10070087 3300013297 Bacteria 3147
76 Ga0157378_10097500 3300013297 Bacteria 2680
77 Ga0163162_10046409 3300013306 Bacteria 4354
78 Ga0163162_10110796 3300013306 Bacteria 2842
79 Ga0163162_10172681 3300013306 Bacteria 2286
80 Ga0157375_10112030 3300013308 Bacteria 2828
81 Ga0157375_10170449 3300013308 Bacteria 2324
82 Ga0157380_10415068 3300014326 Bacteria 1282
83 Ga0209673_1001480 3300025273 Bacteria 21982
84 Ga0209564_1001091 3300025295 Bacteria 32361
85 Ga0209256_1000327 3300025299 Bacteria 81082
86 Ga0209257_1000773 3300025304 Bacteria 47351
87 Ga0207642_10091747 3300025899 Bacteria 1502
88 Ga0207688_10084865 3300025901 Bacteria 1813
89 Ga0207699_10213498 3300025906 Bacteria 1313
90 Ga0207657_10246008 3300025919 Bacteria 1427
91 Ga0207650_10268878 3300025925 Bacteria 1385
92 Ga0207644_10067266 3300025931 Bacteria 2611
93 Ga0207644_10084617 3300025931 Bacteria 2351
94 Ga0207644_10483021 3300025931 Bacteria 1020
95 Ga0207704_10196226 3300025938 Bacteria 1473
96 Ga0207691_10009610 3300025940 Bacteria 9280
97 Ga0207711_10010230 3300025941 Bacteria 7788
98 Ga0207711_10333805 3300025941 Bacteria 1402
99 Ga0207679_10057402 3300025945 Bacteria 2879
100 Ga0207651_10603695 3300025960 Bacteria 959
101 Ga0207640_10043087 3300025981 Bacteria 2882
102 Ga0207677_10086522 3300026023 Bacteria 2266
103 Ga0207677_10092547 3300026023 Bacteria 2201
104 Ga0207678_10005320 3300026067 Bacteria 11520
105 Ga0207641_10178829 3300026088 Bacteria 1942
106 Ga0207648_10689803 3300026089 Bacteria 946
107 Ga0207676_10076387 3300026095 Bacteria 2706
108 Ga0207676_10109755 3300026095 Bacteria 2306
109 Ga0207683_10031110 3300026121 Bacteria 4631
110 Ga0207683_10215268 3300026121 Bacteria 1749
111 Ga0209371_1003530 3300027312 Bacteria 7522
112 Ga0268256_1003797 3300030500 Bacteria 6608
113 Ga0265762_1006960 3300030760 Bacteria 2020
114 Ga0307518_10061828 3300031838 Bacteria 2719
115 Ga0307406_10767824 3300031901 Bacteria 811
116 Ga0373931_0028126 3300035691 Bacteria 2875
117 Ga0395905_0090721 3300037471 Bacteria 2865
118 Ga0451835_0488822 3300041492 Bacteria 1526
119 Ga0451839_0474661 3300041496 Bacteria 5306
120 Ga0451841_0623393 3300041498 Bacteria 4116
121 Ga0451845_0249744 3300041501 Bacteria 4100
122 Ga0451851_0918711 3300041507 Bacteria 2584
123 Ga0451855_0098169 3300041511 Bacteria 9598
124 Ga0495603_0316379 3300046455 Bacteria 896
125 Ga0495638_0057368 3300046460 Bacteria 2415
126 Ga0495653_0000008 3300046463 Bacteria 307868
127 Ga0495650_0000417 3300046471 Bacteria 69289
128 Ga0495605_0093623 3300046474 Bacteria 1389
129 Ga0495584_0006837 3300046491 Bacteria 5959
130 Ga0495584_0207094 3300046491 Bacteria 997
131 Ga0495585_0002881 3300046492 Bacteria 11951
132 Ga0495585_0164214 3300046492 Bacteria 1151
133 Ga0495596_0009922 3300046500 Bacteria 4171
134 Ga0495607_0001184 3300046501 Bacteria 23557
135 Ga0495607_0078771 3300046501 Bacteria 1817
136 Ga0495583_0011855 3300046506 Bacteria 4978
137 Ga0495606_0000048 3300046507 Bacteria 207840
138 Ga0495606_0081366 3300046507 Bacteria 2013
139 Ga0495610_0000003 3300046512 Bacteria 1203910
140 Ga0495616_0068334 3300046513 Bacteria 1725
141 Ga0495620_0033317 3300046515 Bacteria 2340
142 Ga0495632_0000181 3300046519 Bacteria 64344
143 Ga0495637_0053670 3300046520 Bacteria 1677
144 Ga0495648_0008575 3300046524 Bacteria 8026
145 Ga0495648_0068345 3300046524 Bacteria 2073
146 Ga0495642_0049881 3300046528 Bacteria 1720
147 Ga0495654_0009785 3300046530 Bacteria 5239
148 Ga0495609_0000054 3300046538 Bacteria 147369
149 Ga0495609_0000557 3300046538 Bacteria 29464
150 Ga0495609_0008447 3300046538 Bacteria 5044
151 Ga0495609_0034373 3300046538 Bacteria 2298
152 Ga0495622_0000074 3300046557 Bacteria 87846
153 Ga0495633_0005866 3300046558 Bacteria 7390
154 Ga0495633_0030233 3300046558 Bacteria 2632
155 Ga0495633_0243445 3300046558 Bacteria 821
156 Ga0495656_0001025 3300046615 Bacteria 9053
157 Ga0495668_0003011 3300046616 Bacteria 13145
158 Ga0495668_0011585 3300046616 Bacteria 5272
159 Ga0495625_0010847 3300046660 Bacteria 7492
160 Ga0495625_0021957 3300046660 Bacteria 4901
161 Ga0495625_0033804 3300046660 Bacteria 3777
162 Ga0495625_0265513 3300046660 Bacteria 1109
163 Ga0495625_0322616 3300046660 Bacteria 983
164 Ga0495659_0004571 3300046664 Bacteria 4355
165 Ga0495661_0004006 3300046665 Bacteria 10738
166 Ga0495661_0102541 3300046665 Bacteria 1608
167 Ga0495661_0103320 3300046665 Bacteria 1600
168 Ga0495669_0001086 3300046684 Bacteria 11266
169 Ga0495670_0195774 3300046691 Bacteria 1069
170 Ga0495671_0000791 3300046692 Bacteria 22665
171 Ga0495671_0048679 3300046692 Bacteria 2114
172 Ga0495649_0006598 3300046694 Bacteria 7215
173 Ga0495660_0000341 3300046810 Bacteria 41400
174 Ga0495660_0001954 3300046810 Bacteria 13411
175 Ga0495660_0005868 3300046810 Bacteria 7321
176 Ga0495660_0041819 3300046810 Bacteria 2535
177 Ga0495660_0049646 3300046810 Bacteria 2289
178 Ga0495636_0000911 3300047318 Bacteria 11002
179 Ga0495636_0000979 3300047318 Bacteria 10693
180 Ga0495672_0000019 3300047320 Bacteria 448153
181 Ga0495672_0004428 3300047320 Bacteria 11510
182 Ga0495683_0033590 3300047323 Bacteria 2610
183 Ga0495683_0050501 3300047323 Bacteria 2081
184 Ga0495687_003269 3300047443 Bacteria 11941
185 Ga0495687_013008 3300047443 Bacteria 4365
186 Ga0495677_0001270 3300047445 Bacteria 10120
187 Ga0495679_016909 3300047446 Bacteria 2625
188 Ga0495679_023036 3300047446 Bacteria 2120
189 Ga0495685_000196 3300047447 Bacteria 20363
190 Ga0495673_0000016 3300047469 Bacteria 580643
191 Ga0495681_0001485 3300047470 Bacteria 17509
192 Ga0495681_0006298 3300047470 Bacteria 7820
193 Ga0495686_0035462 3300047472 Bacteria 3206
194 Ga0495686_0055247 3300047472 Bacteria 2484
195 Ga0496100_0009938 3300048903 Bacteria 5366
196 Ga0496101_0021571 3300048904 Bacteria 4426
197 Ga0496101_0187557 3300048904 Unclassified 1595
198 Ga0496102_0649851 3300048905 Bacteria 978
199 Ga0496104_0065691 3300048907 Bacteria 3443
200 Ga0496105_0021052 3300048908 Bacteria 5274
201 Ga0496106_0020271 3300048909 Bacteria 4933
202 Ga0496107_0010107 3300048910 Bacteria 6546
203 Ga0496108_0047275 3300048911 Bacteria 3597
204 Ga0496108_0142767 3300048911 Bacteria 2063
205 Ga0496108_0325163 3300048911 Bacteria 1341
206 Ga0496109_0155957 3300048912 Bacteria 2138
207 Ga0496110_0034664 3300048913 Bacteria 4374
208 Ga0496112_0040830 3300048915 Bacteria 4537
209 Ga0496112_0055094 3300048915 Bacteria 3909
210 Ga0496113_0079199 3300048916 Bacteria 2515
211 Ga0496114_0005814 3300048917 Bacteria 9687
212 Ga0496115_0019262 3300048918 Bacteria 5250
213 Ga0496115_0034055 3300048918 Bacteria 4025
214 Ga0496116_0001108 3300048919 Bacteria 32260
215 Ga0496116_0112454 3300048919 Bacteria 1596
216 Ga0496121_0035591 3300048924 Bacteria 4458
217 Ga0496121_0183716 3300048924 Bacteria 1506
218 Ga0496122_0007782 3300048925 Bacteria 11786
219 Ga0496122_0026894 3300048925 Bacteria 4940
220 Ga0496122_0033397 3300048925 Bacteria 4233
221 Ga0496122_0096765 3300048925 Bacteria 1989
222 Ga0496123_0004224 3300048926 Bacteria 15325
223 Ga0496123_0059642 3300048926 Bacteria 2465
224 Ga0496124_0001626 3300048927 Bacteria 32229
225 Ga0496124_0015463 3300048927 Bacteria 7313
226 Ga0496124_0052261 3300048927 Bacteria 3472
227 Ga0496125_0066144 3300048928 Bacteria 2859
228 Ga0495678_005658 3300049459 Bacteria 6815
229 Ga0495682_0002065 3300049460 Bacteria 9806
230 Ga0501039_0060231 3300049575 Bacteria 2940
231 Ga0501042_0034827 3300049578 Bacteria 3572
232 Ga0501043_0238720 3300049579 Bacteria 1402
233 Ga0501072_0039059 3300049588 Bacteria 3727
234 Ga0501073_0399363 3300049589 Bacteria 950
235 Ga0501075_0041283 3300049591 Bacteria 3457
236 Ga0501076_0002164 3300049592 Bacteria 13475
237 Ga0501077_0067279 3300049593 Bacteria 2272
238 Ga0501080_0154464 3300049742 Bacteria 2120
239 Ga0501279_000545 3300049775 Bacteria 4936
240 Ga0501045_0018507 3300049824 Bacteria 4956
241 nmdc:mga0k408_17665_c1 3300050493 Bacteria 3975
242 nmdc:mga07m45_33485_c2 3300050496 Bacteria 1566
243 nmdc:mga05p37_152699_c1 3300050507 Bacteria 2823
244 nmdc:mga05p37_235849_c1 3300050507 Bacteria 2202
245 nmdc:mga05p37_488359_c1 3300050507 Bacteria 1416
246 nmdc:mga05p37_62955_c1 3300050507 Bacteria 4565
247 nmdc:mga05p37_659448_c1 3300050507 Bacteria 1170
248 nmdc:mga09592_23147_c1 3300050508 Bacteria 5129
249 nmdc:mga09592_51625_c1 3300050508 Bacteria 3469
250 nmdc:mga09592_797567_c1 3300050508 Unclassified 799
251 nmdc:mga0qj67_3743_c1 3300050509 Bacteria 10982
252 nmdc:mga0qj67_9652_c1 3300050509 Bacteria 7192
253 nmdc:mga06r32_126298_c1 3300050510 Bacteria 2527
254 nmdc:mga06r32_212874_c1 3300050510 Bacteria 1920
255 nmdc:mga06r32_31240_c1 3300050510 Bacteria 5001
256 nmdc:mga06r32_56837_c1 3300050510 Bacteria 3757
257 nmdc:mga06r32_67573_c1 3300050510 Bacteria 3451
258 nmdc:mga06r32_938_c1 3300050510 Bacteria 25955
259 nmdc:mga08y16_908587_c1 3300050511 Bacteria 866
260 nmdc:mga08x19_159817_c1 3300050514 Bacteria 1530
261 nmdc:mga0sz30_18447_c1 3300050516 Bacteria 2792
262 Ga0495619_0132403 3300053085 Bacteria 1714
263 Ga0500618_000293 3300053125 Bacteria 38081
264 Ga0500658_0011806 3300053134 Bacteria 3220
265 Ga0500586_090324 3300053145 Bacteria 1075
266 Ga0500622_0034450 3300053156 Bacteria 2652
267 Ga0501084_0156762 3300054114 Bacteria 1920
268 Ga0501082_0021600 3300060353 Bacteria 5550
269 Ga0530510_0075297 3300061734 Bacteria 2451
270 2508735458 2508501050 Bacteria 9633614
271 2510899559 2510461076 Bacteria 8618824
272 2514024118 2513237162 Bacteria 7468464
273 2515645239 2515154114 Bacteria 7848616
274 2515661786 2515154116 Bacteria 7552979
275 2644049031 2643221607 Bacteria 6314006
276 2644195073 2643221634 Bacteria 6705461
277 2644481781 2643221686 Bacteria 6310811
278 2738829686 2738541297 Bacteria 6549566
279 2739153482 2738541357 Bacteria 6549408
280 2739195402 2738543003 Bacteria 6549560
281 2739321878 2738543026 Bacteria 6549408
282 2739340119 2738543029 Bacteria 6549249
283 2819683426 2818991461 Bacteria 7026071
284 2842716626 2842711865 Bacteria 7155354
285 2885317667 2885312484 Bacteria 6415165
286 2935830362 2935827899 Bacteria 10038562
287 8005486347 8005484373 Bacteria 6297373
288 8005647629 8005645114 Bacteria 6950293
289 8056378850 8056375014 Bacteria 7006639
290 Ga0157380_10488069
291 MBSR1b_contig_3631991
292 ARSoilOldRDRAFT_c002762
293 rootL2_10047635
294 Ga0055526_1030107
295 Ga0055524_1004406
296 Ga0055531_10003670
297 Ga0068868_100006072
298 Ga0070660_100270782
299 Ga0070661_100397139
300 Ga0070675_100453560
301 Ga0070671_100018002
302 Ga0070671_100123935
303 Ga0070671_100272747
304 Ga0070667_100796543
305 Ga0070663_100010824
306 Ga0070663_100469448
307 Ga0070678_100017104
308 Ga0070678_100189200
309 Ga0070678_100665335
310 Ga0070662_100118137
311 Ga0070679_100069958
312 Ga0068853_100025231
313 Ga0070672_100016785
314 Ga0070686_100215205
315 Ga0070665_100609867
316 Ga0070664_100096947
317 Ga0068854_100089336
318 Ga0068859_100000002
319 Ga0068864_100004082
320 Ga0068851_10034290
321 Ga0068863_100018337
322 Ga0068863_100086709
323 Ga0081455_10044473
324 Ga0081455_10066665
325 Ga0081538_10139754
326 Ga0070716_100197568
327 Ga0075369_10032818
328 Ga0075366_10030284
329 Ga0097621_100325024
330 Ga0068871_100281047
331 Ga0068871_100633255
332 Ga0075428_100028938
333 Ga0075428_100098190
334 Ga0075428_100286255
335 Ga0075428_100627409
336 Ga0075430_100002245
337 Ga0075430_100025078
338 Ga0075430_100038318
339 Ga0075430_100102874
340 Ga0075431_100000920
341 Ga0075431_100011300
342 Ga0075431_100013815
343 Ga0075431_100042392
344 Ga0075431_100170476
345 Ga0075431_100646360
346 Ga0075429_100188639
347 Ga0075429_100203520
348 Ga0075429_100394445
349 Ga0068865_100248480
350 Ga0097620_100000002
351 Ga0111539_10783906
352 Ga0111539_10848326
353 Ga0105245_10015156
354 Ga0105247_10051867
355 Ga0114129_10079248
356 Ga0114129_10198078
357 Ga0114129_10201465
358 Ga0114129_10494670
359 Ga0114129_10532504
360 Ga0105242_10066284
361 Ga0105248_10009915
362 Ga0105248_10183714
363 Ga0105249_10352407
364 Ga0157378_10070087
365 Ga0157378_10097500
366 Ga0163162_10046409
367 Ga0163162_10110796
368 Ga0163162_10172681
369 Ga0157375_10112030
370 Ga0157375_10170449
371 Ga0157380_10415068
372 Ga0209673_1001480
373 Ga0209564_1001091
374 Ga0209256_1000327
375 Ga0209257_1000773
376 Ga0207642_10091747
377 Ga0207688_10084865
378 Ga0207699_10213498
379 Ga0207657_10246008
380 Ga0207650_10268878
381 Ga0207644_10067266
382 Ga0207644_10084617
383 Ga0207644_10483021
384 Ga0207704_10196226
385 Ga0207691_10009610
386 Ga0207711_10010230
387 Ga0207711_10333805
388 Ga0207679_10057402
389 Ga0207651_10603695
390 Ga0207640_10043087
391 Ga0207677_10086522
392 Ga0207677_10092547
393 Ga0207678_10005320
394 Ga0207641_10178829
395 Ga0207648_10689803
396 Ga0207676_10076387
397 Ga0207676_10109755
398 Ga0207683_10031110
399 Ga0207683_10215268
400 Ga0209371_1003530
401 Ga0268256_1003797
402 Ga0265762_1006960
403 Ga0307518_10061828
404 Ga0307406_10767824
405 Ga0373931_0028126
406 Ga0395905_0090721
407 Ga0451835_0488822
408 Ga0451839_0474661
409 Ga0451841_0623393
410 Ga0451845_0249744
411 Ga0451851_0918711
412 Ga0451855_0098169
413 Ga0495603_0316379
414 Ga0495638_0057368
415 Ga0495653_0000008
416 Ga0495650_0000417
417 Ga0495605_0093623
418 Ga0495584_0006837
419 Ga0495584_0207094
420 Ga0495585_0002881
421 Ga0495585_0164214
422 Ga0495596_0009922
423 Ga0495607_0001184
424 Ga0495607_0078771
425 Ga0495583_0011855
426 Ga0495606_0000048
427 Ga0495606_0081366
428 Ga0495610_0000003
429 Ga0495616_0068334
430 Ga0495620_0033317
431 Ga0495632_0000181
432 Ga0495637_0053670
433 Ga0495648_0008575
434 Ga0495648_0068345
435 Ga0495642_0049881
436 Ga0495654_0009785
437 Ga0495609_0000054
438 Ga0495609_0000557
439 Ga0495609_0008447
440 Ga0495609_0034373
441 Ga0495622_0000074
442 Ga0495633_0005866
443 Ga0495633_0030233
444 Ga0495633_0243445
445 Ga0495656_0001025
446 Ga0495668_0003011
447 Ga0495668_0011585
448 Ga0495625_0010847
449 Ga0495625_0021957
450 Ga0495625_0033804
451 Ga0495625_0265513
452 Ga0495625_0322616
453 Ga0495659_0004571
454 Ga0495661_0004006
455 Ga0495661_0102541
456 Ga0495661_0103320
457 Ga0495669_0001086
458 Ga0495670_0195774
459 Ga0495671_0000791
460 Ga0495671_0048679
461 Ga0495649_0006598
462 Ga0495660_0000341
463 Ga0495660_0001954
464 Ga0495660_0005868
465 Ga0495660_0041819
466 Ga0495660_0049646
467 Ga0495636_0000911
468 Ga0495636_0000979
469 Ga0495672_0000019
470 Ga0495672_0004428
471 Ga0495683_0033590
472 Ga0495683_0050501
473 Ga0495687_003269
474 Ga0495687_013008
475 Ga0495677_0001270
476 Ga0495679_016909
477 Ga0495679_023036
478 Ga0495685_000196
479 Ga0495673_0000016
480 Ga0495681_0001485
481 Ga0495681_0006298
482 Ga0495686_0035462
483 Ga0495686_0055247
484 Ga0496100_0009938
485 Ga0496101_0021571
486 Ga0496101_0187557
487 Ga0496102_0649851
488 Ga0496104_0065691
489 Ga0496105_0021052
490 Ga0496106_0020271
491 Ga0496107_0010107
492 Ga0496108_0047275
493 Ga0496108_0142767
494 Ga0496108_0325163
495 Ga0496109_0155957
496 Ga0496110_0034664
497 Ga0496112_0040830
498 Ga0496112_0055094
499 Ga0496113_0079199
500 Ga0496114_0005814
501 Ga0496115_0019262
502 Ga0496115_0034055
503 Ga0496116_0001108
504 Ga0496116_0112454
505 Ga0496121_0035591
506 Ga0496121_0183716
507 Ga0496122_0007782
508 Ga0496122_0026894
509 Ga0496122_0033397
510 Ga0496122_0096765
511 Ga0496123_0004224
512 Ga0496123_0059642
513 Ga0496124_0001626
514 Ga0496124_0015463
515 Ga0496124_0052261
516 Ga0496125_0066144
517 Ga0495678_005658
518 Ga0495682_0002065
519 Ga0501039_0060231
520 Ga0501042_0034827
521 Ga0501043_0238720
522 Ga0501072_0039059
523 Ga0501073_0399363
524 Ga0501075_0041283
525 Ga0501076_0002164
526 Ga0501077_0067279
527 Ga0501080_0154464
528 Ga0501279_000545
529 Ga0501045_0018507
530 nmdc:mga0k408_17665_c1
531 nmdc:mga07m45_33485_c2
532 nmdc:mga05p37_152699_c1
533 nmdc:mga05p37_235849_c1
534 nmdc:mga05p37_488359_c1
535 nmdc:mga05p37_62955_c1
536 nmdc:mga05p37_659448_c1
537 nmdc:mga09592_23147_c1
538 nmdc:mga09592_51625_c1
539 nmdc:mga09592_797567_c1
540 nmdc:mga0qj67_3743_c1
541 nmdc:mga0qj67_9652_c1
542 nmdc:mga06r32_126298_c1
543 nmdc:mga06r32_212874_c1
544 nmdc:mga06r32_31240_c1
545 nmdc:mga06r32_56837_c1
546 nmdc:mga06r32_67573_c1
547 nmdc:mga06r32_938_c1
548 nmdc:mga08y16_908587_c1
549 nmdc:mga08x19_159817_c1
550 nmdc:mga0sz30_18447_c1
551 Ga0495619_0132403
552 Ga0500618_000293
553 Ga0500658_0011806
554 Ga0500586_090324
555 Ga0500622_0034450
556 Ga0501084_0156762
557 Ga0501082_0021600
558 Ga0530510_0075297
559 2508735458
560 2510899559
561 2514024118
562 2515645239
563 2515661786
564 2644049031
565 2644195073
566 2644481781
567 2738829686
568 2739153482
569 2739195402
570 2739321878
571 2739340119
572 2819683426
573 2842716626
574 2885317667
575 2935830362
576 8005486347
577 8005647629
578 8056378850

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

75

229

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wgf-assembly1.cif.gz_C ycac from pseudomonas aeruginosa with hexane-2,5-diol and covalent acrylamide 0.9587 46 242
4wh0-assembly1.cif.gz_A ycac from pseudomonas aeruginosa with s-mercaptocysteine active site cysteine 0.9555 46 242
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9427 36 244
1yac-assembly1.cif.gz_A the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity 0.9293 36 244
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.9269 46 226
ID Description Score Start End Superfamily
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9536 46 242 3.40.50.850
4wh0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9209 46 242 3.40.50.850
af_Q54RF0_1_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9 47 226 3.40.50.850
af_Q9W127_4_199_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8938 46 231 3.40.50.850
1xn4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8921 51 226 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A746ND84-F1-model_v4 Isochorismatase family protein 0.994 47 204
AF-A0A2N8MDV2-F1-model_v4 Amidohydrolase 0.9917 38 251 GO:0016787
AF-A0A4P6S0P4-F1-model_v4 deleted 0.9913 49 250
AF-A0A1H3P4S7-F1-model_v4 Nicotinamidase-related amidase 0.9912 46 232
AF-A0A751SU60-F1-model_v4 Isochorismatase family protein 0.9907 46 227

Map