F389148

General Info

Members Datasets Scaffolds Average Seq Length
289 192 578 97

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_12166879|Ga0105245_121668791
Length 97
Sequence VNTYVILRRNGWRTPGDLEEAAARSTAEGDSTPDDIRWIRSYVLDERDGSLGTVCIYQASSADAIRAHATAADLPVDEIIPVADTVIVRPDPAATTA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
105 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
106 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
112 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
120 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
121 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
122 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
123 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
124 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
127 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
128 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
129 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
130 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
133 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
134 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
135 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
136 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
137 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
143 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
165 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
166 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
167 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
168 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
171 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
172 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
173 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
174 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
183 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.3
Nodule 0
Rhizoplane 13.15
Rhizosphere 77.51
Stem 0
Stem Tuber 0
Unclassified 16.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_12166879 3300009098 Bacteria 610
2 Ga0070658_10344050 3300005327 Bacteria 1276
3 Ga0070683_101877688 3300005329 Bacteria 576
4 Ga0068868_100252126 3300005338 Bacteria 1486
5 Ga0068868_100666552 3300005338 Bacteria 928
6 Ga0070660_100000625 3300005339 Bacteria 23573
7 Ga0070689_100132508 3300005340 Bacteria 1999
8 Ga0070691_10135485 3300005341 Bacteria 1251
9 Ga0070675_101933669 3300005354 Unclassified 544
10 Ga0070674_100178339 3300005356 Bacteria 1625
11 Ga0070674_101429420 3300005356 Unclassified 620
12 Ga0070673_101100757 3300005364 Unclassified 742
13 Ga0070688_100105911 3300005365 Bacteria 1862
14 Ga0070667_100695480 3300005367 Bacteria 941
15 Ga0070703_10441162 3300005406 Bacteria 575
16 Ga0070714_100196770 3300005435 Unclassified 1842
17 Ga0070710_10911333 3300005437 Bacteria 635
18 Ga0070711_100033664 3300005439 Bacteria 3413
19 Ga0070711_100514255 3300005439 Bacteria 989
20 Ga0070705_100076516 3300005440 Bacteria 2041
21 Ga0070700_100630573 3300005441 Bacteria 844
22 Ga0070694_100175861 3300005444 Bacteria 1580
23 Ga0070678_100047506 3300005456 Bacteria 3084
24 Ga0070662_101735334 3300005457 Unclassified 539
25 Ga0070685_10933071 3300005466 Bacteria 648
26 Ga0070707_101144159 3300005468 Unclassified 744
27 Ga0070698_100352726 3300005471 Bacteria 1403
28 Ga0070698_101351611 3300005471 Bacteria 663
29 Ga0070699_100598539 3300005518 Bacteria 1005
30 Ga0070697_100299921 3300005536 Bacteria 1381
31 Ga0070672_101730854 3300005543 Unclassified 562
32 Ga0070686_100024835 3300005544 Bacteria 3595
33 Ga0070696_100536006 3300005546 Bacteria 936
34 Ga0070665_102553108 3300005548 Bacteria 512
35 Ga0070704_100042400 3300005549 Bacteria 3148
36 Ga0068857_100450664 3300005577 Bacteria 1203
37 Ga0068857_100597311 3300005577 Bacteria 1043
38 Ga0068870_11023973 3300005840 Unclassified 590
39 Ga0068860_101056125 3300005843 Unclassified 831
40 Ga0081455_10069837 3300005937 Bacteria 2919
41 Ga0081538_10002991 3300005981 Bacteria 16110
42 Ga0081538_10038357 3300005981 Bacteria 3092
43 Ga0075365_10926913 3300006038 Bacteria 614
44 Ga0075363_100051992 3300006048 Bacteria 2186
45 Ga0075363_100287084 3300006048 Bacteria 953
46 Ga0075363_100904236 3300006048 Unclassified 541
47 Ga0075363_100992770 3300006048 Bacteria 517
48 Ga0075364_10837840 3300006051 Bacteria 626
49 Ga0075364_11103779 3300006051 Bacteria 538
50 Ga0070715_10291044 3300006163 Bacteria 870
51 Ga0070716_100195669 3300006173 Bacteria 1339
52 Ga0070712_100039511 3300006175 Bacteria 3229
53 Ga0070712_100093938 3300006175 Bacteria 2203
54 Ga0070712_101274721 3300006175 Bacteria 640
55 Ga0075367_10046408 3300006178 Bacteria 2552
56 Ga0075367_10588270 3300006178 Bacteria 707
57 Ga0075367_10693834 3300006178 Bacteria 647
58 Ga0075367_11086674 3300006178 Unclassified 511
59 Ga0075369_10030975 3300006186 Bacteria 2255
60 Ga0075431_101498362 3300006847 Unclassified 633
61 Ga0075434_101642505 3300006871 Bacteria 651
62 Ga0068865_100053121 3300006881 Bacteria 2811
63 Ga0111539_10039553 3300009094 Bacteria 5683
64 Ga0111539_10818358 3300009094 Bacteria 1084
65 Ga0111539_13538389 3300009094 Bacteria 501
66 Ga0105245_10012197 3300009098 Bacteria 7475
67 Ga0105245_10186673 3300009098 Unclassified 1984
68 Ga0105245_10212912 3300009098 Bacteria 1861
69 Ga0114129_10225917 3300009147 Bacteria 2523
70 Ga0114129_11087440 3300009147 Bacteria 1002
71 Ga0114129_11627518 3300009147 Bacteria 790
72 Ga0114129_12321055 3300009147 Bacteria 644
73 Ga0105243_10020963 3300009148 Bacteria 4959
74 Ga0105242_10033275 3300009176 Bacteria 4127
75 Ga0105242_12692434 3300009176 Unclassified 547
76 Ga0105248_10365618 3300009177 Bacteria 1624
77 Ga0105249_10120774 3300009553 Bacteria 2490
78 Ga0105249_10244904 3300009553 Bacteria 1774
79 Ga0105246_10753008 3300011119 Unclassified 859
80 Ga0157371_11383684 3300013102 Bacteria 546
81 Ga0157374_10825328 3300013296 Bacteria 943
82 Ga0157378_10288497 3300013297 Bacteria 1584
83 Ga0163162_11371356 3300013306 Bacteria 804
84 Ga0157372_10273154 3300013307 Bacteria 1965
85 Ga0157375_10267487 3300013308 Bacteria 1871
86 Ga0157380_10740384 3300014326 Unclassified 993
87 Ga0157380_11452676 3300014326 Bacteria 738
88 Ga0157379_10389464 3300014968 Bacteria 1280
89 Ga0207692_10258774 3300025898 Bacteria 1045
90 Ga0207688_10075067 3300025901 Bacteria 1924
91 Ga0207688_10168801 3300025901 Bacteria 1300
92 Ga0207705_10380991 3300025909 Bacteria 1089
93 Ga0207693_10001174 3300025915 Bacteria 23373
94 Ga0207693_10025613 3300025915 Bacteria 4676
95 Ga0207663_10318123 3300025916 Bacteria 1169
96 Ga0207663_10962069 3300025916 Bacteria 684
97 Ga0207657_10002120 3300025919 Bacteria 21471
98 Ga0207646_11364716 3300025922 Bacteria 617
99 Ga0207646_11432746 3300025922 Unclassified 600
100 Ga0207687_10060125 3300025927 Bacteria 2679
101 Ga0207664_10217103 3300025929 Bacteria 1657
102 Ga0207664_10222974 3300025929 Unclassified 1636
103 Ga0207706_10591914 3300025933 Unclassified 953
104 Ga0207709_10511479 3300025935 Bacteria 939
105 Ga0207669_11494556 3300025937 Unclassified 576
106 Ga0207665_10414130 3300025939 Bacteria 1028
107 Ga0207691_10231960 3300025940 Bacteria 1598
108 Ga0207691_11755216 3300025940 Bacteria 501
109 Ga0207711_10540271 3300025941 Bacteria 1087
110 Ga0207651_11099838 3300025960 Unclassified 712
111 Ga0207712_10132398 3300025961 Bacteria 1902
112 Ga0207658_10447006 3300025986 Bacteria 1144
113 Ga0207677_10539647 3300026023 Bacteria 1015
114 Ga0207677_11898807 3300026023 Bacteria 553
115 Ga0207708_10612677 3300026075 Bacteria 923
116 Ga0207702_10188909 3300026078 Unclassified 1902
117 Ga0207641_11368875 3300026088 Bacteria 709
118 Ga0207648_10923337 3300026089 Bacteria 816
119 Ga0207676_10696726 3300026095 Bacteria 984
120 Ga0207674_10533781 3300026116 Bacteria 1133
121 Ga0207683_10047010 3300026121 Bacteria 3779
122 Ga0207698_11536093 3300026142 Bacteria 681
123 Ga0268266_11686952 3300028379 Bacteria 609
124 Ga0268264_11282536 3300028381 Unclassified 742
125 Ga0268264_11731254 3300028381 Bacteria 635
126 Ga0265338_10040423 3300028800 Bacteria 4380
127 Ga0265338_10955693 3300028800 Unclassified 581
128 Ga0316575_10024476 3300031665 Unclassified 2338
129 Ga0316579_10062203 3300031691 Unclassified 1758
130 Ga0316576_10045767 3300031727 Bacteria 3165
131 Ga0316576_10051929 3300031727 Unclassified 2984
132 Ga0316578_10100612 3300031728 Unclassified 1733
133 Ga0316578_10155858 3300031728 Bacteria 1376
134 Ga0316578_10322208 3300031728 Bacteria 922
135 Ga0316578_10812330 3300031728 Bacteria 542
136 Ga0316577_10058073 3300031733 Bacteria 2160
137 Ga0316577_10215423 3300031733 Bacteria 1085
138 Ga0316577_10736572 3300031733 Bacteria 560
139 Ga0307413_11500930 3300031824 Bacteria 596
140 Ga0307410_11451925 3300031852 Bacteria 603
141 Ga0307406_10053357 3300031901 Bacteria 2575
142 Ga0307406_11095580 3300031901 Unclassified 687
143 Ga0307412_11224715 3300031911 Bacteria 673
144 Ga0307409_100672195 3300031995 Bacteria 1032
145 Ga0307409_102928757 3300031995 Unclassified 504
146 Ga0307415_101632094 3300032126 Bacteria 620
147 Ga0316583_10300358 3300032133 Unclassified 555
148 Ga0316585_10161682 3300032137 Unclassified 740
149 Ga0316580_10014083 3300032139 Unclassified 2440
150 Ga0316580_10020242 3300032139 Unclassified 2049
151 Ga0373926_0247418 3300035083 Bacteria 691
152 Ga0373932_0184301 3300035112 Unclassified 734
153 Ga0316574_0001730 3300035398 Bacteria 10566
154 Ga0316574_0161757 3300035398 Bacteria 1441
155 Ga0316574_0169395 3300035398 Bacteria 1406
156 Ga0316574_0329603 3300035398 Bacteria 968
157 Ga0316574_0767870 3300035398 Unclassified 588
158 Ga0373931_0364027 3300035691 Bacteria 908
159 Ga0316582_0496101 3300036647 Bacteria 841
160 Ga0316582_0739684 3300036647 Unclassified 675
161 Ga0316582_0985667 3300036647 Unclassified 575
162 Ga0316584_0020038 3300036712 Bacteria 4844
163 Ga0316584_0177903 3300036712 Unclassified 1575
164 Ga0316584_0318869 3300036712 Unclassified 1122
165 Ga0316584_0402502 3300036712 Bacteria 975
166 Ga0395900_0222683 3300037418 Bacteria 1901
167 Ga0395900_0375276 3300037418 Unclassified 1391
168 Ga0395900_1147057 3300037418 Bacteria 694
169 Ga0395900_1448463 3300037418 Bacteria 599
170 Ga0395898_0071108 3300037466 Bacteria 3363
171 Ga0395898_0364799 3300037466 Bacteria 1377
172 Ga0395905_0189312 3300037471 Bacteria 1931
173 Ga0395905_0519969 3300037471 Bacteria 1091
174 Ga0395905_0635191 3300037471 Bacteria 970
175 Ga0395901_0003638 3300038443 Bacteria 15549
176 Ga0395901_0470176 3300038443 Bacteria 1284
177 Ga0395901_0598249 3300038443 Unclassified 1112
178 Ga0395901_0869963 3300038443 Bacteria 885
179 Ga0436365_1515299 3300039437 Bacteria 1105
180 Ga0436363_0285959 3300039450 Bacteria 542
181 Ga0439438_065268 3300041405 Bacteria 906
182 Ga0439438_159490 3300041405 Bacteria 537
183 Ga0439439_0198026 3300041406 Bacteria 583
184 Ga0439461_0006203 3300041410 Bacteria 2076
185 Ga0439466_0053826 3300041411 Bacteria 1312
186 Ga0451802_0443543 3300041460 Bacteria 529
187 Ga0451855_0761934 3300041511 Bacteria 601
188 Ga0439431_0098913 3300041997 Bacteria 800
189 Ga0439437_002930 3300042000 Bacteria 1839
190 Ga0439448_0045735 3300042005 Bacteria 1425
191 Ga0439452_060429 3300042010 Bacteria 850
192 Ga0439455_0045109 3300042012 Bacteria 1139
193 Ga0450917_025134 3300042120 Bacteria 549
194 Ga0450920_007939 3300042122 Unclassified 1931
195 Ga0450898_077271 3300042134 Bacteria 673
196 Ga0450905_043103 3300042142 Bacteria 721
197 Ga0450910_006705 3300042147 Bacteria 1596
198 Ga0439446_0002624 3300042156 Bacteria 4341
199 Ga0439446_0025368 3300042156 Bacteria 1694
200 Ga0439446_0149011 3300042156 Bacteria 768
201 Ga0439446_0155278 3300042156 Bacteria 754
202 Ga0450908_008527 3300042184 Unclassified 1920
203 Ga0439434_0009052 3300042435 Bacteria 2927
204 Ga0439434_0037487 3300042435 Bacteria 1484
205 Ga0466966_0169281 3300044684 Unclassified 1328
206 Ga0466961_0694562 3300044693 Bacteria 610
207 Ga0466964_0727069 3300044706 Bacteria 555
208 Ga0466970_0229923 3300044765 Bacteria 1036
209 Ga0466960_0078031 3300044901 Bacteria 1662
210 Ga0466960_0236693 3300044901 Bacteria 1010
211 Ga0466960_0673613 3300044901 Bacteria 619
212 Ga0495603_0190413 3300046455 Bacteria 1186
213 Ga0495590_0442184 3300046457 Unclassified 502
214 Ga0495641_0049769 3300046461 Bacteria 1917
215 Ga0495662_0011349 3300046476 Bacteria 4354
216 Ga0495584_0526893 3300046491 Bacteria 602
217 Ga0495594_0021520 3300046499 Bacteria 3442
218 Ga0495594_0224993 3300046499 Bacteria 1070
219 Ga0495628_0022079 3300046516 Bacteria 5231
220 Ga0495631_0119791 3300046518 Bacteria 1132
221 Ga0495663_0064724 3300046525 Bacteria 1155
222 Ga0495656_0227534 3300046615 Bacteria 935
223 Ga0495658_0190525 3300046683 Bacteria 1275
224 Ga0495670_0162395 3300046691 Bacteria 1174
225 Ga0495589_0593883 3300046794 Bacteria 504
226 Ga0495676_0038792 3300047321 Bacteria 3953
227 Ga0495680_0794176 3300047322 Bacteria 619
228 Ga0495685_258101 3300047447 Bacteria 552
229 Ga0495602_0027087 3300048088 Bacteria 5516
230 Ga0495614_0023978 3300048089 Bacteria 2633
231 Ga0496100_0003402 3300048903 Bacteria 8291
232 Ga0496100_0487516 3300048903 Bacteria 948
233 Ga0496100_0488779 3300048903 Bacteria 947
234 Ga0496101_0011714 3300048904 Bacteria 5828
235 Ga0496101_0025966 3300048904 Bacteria 4069
236 Ga0496101_0252694 3300048904 Bacteria 1374
237 Ga0496101_1195164 3300048904 Bacteria 596
238 Ga0496101_1205524 3300048904 Bacteria 593
239 Ga0496102_0159342 3300048905 Bacteria 2122
240 Ga0496103_0001299 3300048906 Bacteria 17003
241 Ga0496104_0000230 3300048907 Bacteria 49225
242 Ga0496104_0046089 3300048907 Bacteria 4103
243 Ga0496104_0342211 3300048907 Bacteria 1408
244 Ga0496104_0411144 3300048907 Bacteria 1265
245 Ga0496105_0000051 3300048908 Bacteria 90365
246 Ga0496105_0014438 3300048908 Bacteria 6287
247 Ga0496105_0195379 3300048908 Bacteria 1653
248 Ga0496105_1239277 3300048908 Bacteria 547
249 Ga0496106_0035977 3300048909 Bacteria 3703
250 Ga0496107_0006242 3300048910 Bacteria 8193
251 Ga0496107_0928736 3300048910 Bacteria 633
252 Ga0496108_0010881 3300048911 Bacteria 7387
253 Ga0496108_0960173 3300048911 Bacteria 731
254 Ga0496109_0032726 3300048912 Bacteria 4675
255 Ga0496109_0463814 3300048912 Bacteria 1196
256 Ga0496109_1232933 3300048912 Bacteria 684
257 Ga0496110_0087620 3300048913 Bacteria 2780
258 Ga0496110_0719469 3300048913 Bacteria 900
259 Ga0496111_0008293 3300048914 Bacteria 6870
260 Ga0496111_0039276 3300048914 Bacteria 3393
261 Ga0496112_0011311 3300048915 Bacteria 8143
262 Ga0496112_0244106 3300048915 Bacteria 1748
263 Ga0496113_0048288 3300048916 Bacteria 3166
264 Ga0496113_0054062 3300048916 Bacteria 3004
265 Ga0496114_0015069 3300048917 Bacteria 6216
266 Ga0496114_0380291 3300048917 Bacteria 1250
267 Ga0496115_0010891 3300048918 Bacteria 6808
268 Ga0501042_1357153 3300049578 Bacteria 518
269 Ga0501043_1047122 3300049579 Bacteria 579
270 Ga0501080_0290605 3300049742 Bacteria 1484
271 Ga0501045_0985669 3300049824 Bacteria 618
272 nmdc:mga03n38_361832_c1 3300050490 Bacteria 792
273 nmdc:mga03n38_828889_c1 3300050490 Unclassified 540
274 nmdc:mga00v17_397407_c1 3300050491 Bacteria 896
275 nmdc:mga00v17_80362_c1 3300050491 Bacteria 2035
276 nmdc:mga0yw44_183018_c1 3300050492 Bacteria 1380
277 nmdc:mga0yw44_727826_c1 3300050492 Bacteria 674
278 nmdc:mga06z11_263397_c1 3300050494 Bacteria 1018
279 nmdc:mga06z11_498186_c1 3300050494 Bacteria 738
280 nmdc:mga06z11_951279_c1 3300050494 Unclassified 523
281 nmdc:mga04h51_103066_c1 3300050495 Bacteria 1042
282 nmdc:mga04h51_141069_c1 3300050495 Bacteria 914
283 nmdc:mga05p37_156429_c1 3300050507 Bacteria 2785
284 nmdc:mga08y16_63376_c1 3300050511 Bacteria 3860
285 nmdc:mga0sz30_51568_c1 3300050516 Bacteria 1745
286 Ga0495601_0003205 3300053077 Bacteria 9362
287 Ga0495612_0031658 3300053078 Bacteria 2133
288 Ga0590071_049383 3300059421 Bacteria 1019
289 Ga0590075_055209 3300059424 Unclassified 1021
290 Ga0105245_12166879
291 Ga0070658_10344050
292 Ga0070683_101877688
293 Ga0068868_100252126
294 Ga0068868_100666552
295 Ga0070660_100000625
296 Ga0070689_100132508
297 Ga0070691_10135485
298 Ga0070675_101933669
299 Ga0070674_100178339
300 Ga0070674_101429420
301 Ga0070673_101100757
302 Ga0070688_100105911
303 Ga0070667_100695480
304 Ga0070703_10441162
305 Ga0070714_100196770
306 Ga0070710_10911333
307 Ga0070711_100033664
308 Ga0070711_100514255
309 Ga0070705_100076516
310 Ga0070700_100630573
311 Ga0070694_100175861
312 Ga0070678_100047506
313 Ga0070662_101735334
314 Ga0070685_10933071
315 Ga0070707_101144159
316 Ga0070698_100352726
317 Ga0070698_101351611
318 Ga0070699_100598539
319 Ga0070697_100299921
320 Ga0070672_101730854
321 Ga0070686_100024835
322 Ga0070696_100536006
323 Ga0070665_102553108
324 Ga0070704_100042400
325 Ga0068857_100450664
326 Ga0068857_100597311
327 Ga0068870_11023973
328 Ga0068860_101056125
329 Ga0081455_10069837
330 Ga0081538_10002991
331 Ga0081538_10038357
332 Ga0075365_10926913
333 Ga0075363_100051992
334 Ga0075363_100287084
335 Ga0075363_100904236
336 Ga0075363_100992770
337 Ga0075364_10837840
338 Ga0075364_11103779
339 Ga0070715_10291044
340 Ga0070716_100195669
341 Ga0070712_100039511
342 Ga0070712_100093938
343 Ga0070712_101274721
344 Ga0075367_10046408
345 Ga0075367_10588270
346 Ga0075367_10693834
347 Ga0075367_11086674
348 Ga0075369_10030975
349 Ga0075431_101498362
350 Ga0075434_101642505
351 Ga0068865_100053121
352 Ga0111539_10039553
353 Ga0111539_10818358
354 Ga0111539_13538389
355 Ga0105245_10012197
356 Ga0105245_10186673
357 Ga0105245_10212912
358 Ga0114129_10225917
359 Ga0114129_11087440
360 Ga0114129_11627518
361 Ga0114129_12321055
362 Ga0105243_10020963
363 Ga0105242_10033275
364 Ga0105242_12692434
365 Ga0105248_10365618
366 Ga0105249_10120774
367 Ga0105249_10244904
368 Ga0105246_10753008
369 Ga0157371_11383684
370 Ga0157374_10825328
371 Ga0157378_10288497
372 Ga0163162_11371356
373 Ga0157372_10273154
374 Ga0157375_10267487
375 Ga0157380_10740384
376 Ga0157380_11452676
377 Ga0157379_10389464
378 Ga0207692_10258774
379 Ga0207688_10075067
380 Ga0207688_10168801
381 Ga0207705_10380991
382 Ga0207693_10001174
383 Ga0207693_10025613
384 Ga0207663_10318123
385 Ga0207663_10962069
386 Ga0207657_10002120
387 Ga0207646_11364716
388 Ga0207646_11432746
389 Ga0207687_10060125
390 Ga0207664_10217103
391 Ga0207664_10222974
392 Ga0207706_10591914
393 Ga0207709_10511479
394 Ga0207669_11494556
395 Ga0207665_10414130
396 Ga0207691_10231960
397 Ga0207691_11755216
398 Ga0207711_10540271
399 Ga0207651_11099838
400 Ga0207712_10132398
401 Ga0207658_10447006
402 Ga0207677_10539647
403 Ga0207677_11898807
404 Ga0207708_10612677
405 Ga0207702_10188909
406 Ga0207641_11368875
407 Ga0207648_10923337
408 Ga0207676_10696726
409 Ga0207674_10533781
410 Ga0207683_10047010
411 Ga0207698_11536093
412 Ga0268266_11686952
413 Ga0268264_11282536
414 Ga0268264_11731254
415 Ga0265338_10040423
416 Ga0265338_10955693
417 Ga0316575_10024476
418 Ga0316579_10062203
419 Ga0316576_10045767
420 Ga0316576_10051929
421 Ga0316578_10100612
422 Ga0316578_10155858
423 Ga0316578_10322208
424 Ga0316578_10812330
425 Ga0316577_10058073
426 Ga0316577_10215423
427 Ga0316577_10736572
428 Ga0307413_11500930
429 Ga0307410_11451925
430 Ga0307406_10053357
431 Ga0307406_11095580
432 Ga0307412_11224715
433 Ga0307409_100672195
434 Ga0307409_102928757
435 Ga0307415_101632094
436 Ga0316583_10300358
437 Ga0316585_10161682
438 Ga0316580_10014083
439 Ga0316580_10020242
440 Ga0373926_0247418
441 Ga0373932_0184301
442 Ga0316574_0001730
443 Ga0316574_0161757
444 Ga0316574_0169395
445 Ga0316574_0329603
446 Ga0316574_0767870
447 Ga0373931_0364027
448 Ga0316582_0496101
449 Ga0316582_0739684
450 Ga0316582_0985667
451 Ga0316584_0020038
452 Ga0316584_0177903
453 Ga0316584_0318869
454 Ga0316584_0402502
455 Ga0395900_0222683
456 Ga0395900_0375276
457 Ga0395900_1147057
458 Ga0395900_1448463
459 Ga0395898_0071108
460 Ga0395898_0364799
461 Ga0395905_0189312
462 Ga0395905_0519969
463 Ga0395905_0635191
464 Ga0395901_0003638
465 Ga0395901_0470176
466 Ga0395901_0598249
467 Ga0395901_0869963
468 Ga0436365_1515299
469 Ga0436363_0285959
470 Ga0439438_065268
471 Ga0439438_159490
472 Ga0439439_0198026
473 Ga0439461_0006203
474 Ga0439466_0053826
475 Ga0451802_0443543
476 Ga0451855_0761934
477 Ga0439431_0098913
478 Ga0439437_002930
479 Ga0439448_0045735
480 Ga0439452_060429
481 Ga0439455_0045109
482 Ga0450917_025134
483 Ga0450920_007939
484 Ga0450898_077271
485 Ga0450905_043103
486 Ga0450910_006705
487 Ga0439446_0002624
488 Ga0439446_0025368
489 Ga0439446_0149011
490 Ga0439446_0155278
491 Ga0450908_008527
492 Ga0439434_0009052
493 Ga0439434_0037487
494 Ga0466966_0169281
495 Ga0466961_0694562
496 Ga0466964_0727069
497 Ga0466970_0229923
498 Ga0466960_0078031
499 Ga0466960_0236693
500 Ga0466960_0673613
501 Ga0495603_0190413
502 Ga0495590_0442184
503 Ga0495641_0049769
504 Ga0495662_0011349
505 Ga0495584_0526893
506 Ga0495594_0021520
507 Ga0495594_0224993
508 Ga0495628_0022079
509 Ga0495631_0119791
510 Ga0495663_0064724
511 Ga0495656_0227534
512 Ga0495658_0190525
513 Ga0495670_0162395
514 Ga0495589_0593883
515 Ga0495676_0038792
516 Ga0495680_0794176
517 Ga0495685_258101
518 Ga0495602_0027087
519 Ga0495614_0023978
520 Ga0496100_0003402
521 Ga0496100_0487516
522 Ga0496100_0488779
523 Ga0496101_0011714
524 Ga0496101_0025966
525 Ga0496101_0252694
526 Ga0496101_1195164
527 Ga0496101_1205524
528 Ga0496102_0159342
529 Ga0496103_0001299
530 Ga0496104_0000230
531 Ga0496104_0046089
532 Ga0496104_0342211
533 Ga0496104_0411144
534 Ga0496105_0000051
535 Ga0496105_0014438
536 Ga0496105_0195379
537 Ga0496105_1239277
538 Ga0496106_0035977
539 Ga0496107_0006242
540 Ga0496107_0928736
541 Ga0496108_0010881
542 Ga0496108_0960173
543 Ga0496109_0032726
544 Ga0496109_0463814
545 Ga0496109_1232933
546 Ga0496110_0087620
547 Ga0496110_0719469
548 Ga0496111_0008293
549 Ga0496111_0039276
550 Ga0496112_0011311
551 Ga0496112_0244106
552 Ga0496113_0048288
553 Ga0496113_0054062
554 Ga0496114_0015069
555 Ga0496114_0380291
556 Ga0496115_0010891
557 Ga0501042_1357153
558 Ga0501043_1047122
559 Ga0501080_0290605
560 Ga0501045_0985669
561 nmdc:mga03n38_361832_c1
562 nmdc:mga03n38_828889_c1
563 nmdc:mga00v17_397407_c1
564 nmdc:mga00v17_80362_c1
565 nmdc:mga0yw44_183018_c1
566 nmdc:mga0yw44_727826_c1
567 nmdc:mga06z11_263397_c1
568 nmdc:mga06z11_498186_c1
569 nmdc:mga06z11_951279_c1
570 nmdc:mga04h51_103066_c1
571 nmdc:mga04h51_141069_c1
572 nmdc:mga05p37_156429_c1
573 nmdc:mga08y16_63376_c1
574 nmdc:mga0sz30_51568_c1
575 Ga0495601_0003205
576 Ga0495612_0031658
577 Ga0590071_049383
578 Ga0590075_055209

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14026

SCO4226-like

Nickel responsive protein SCO4226-like

4

82

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.7898 3 87
4oi3-assembly1.cif.gz_B crystal structure analysis of sco4226 from streptomyces coelicolor a3(2) 0.773 3 87
2nyi-assembly1.cif.gz_A crystal structure of an unknown protein from galdieria sulphuraria 0.6958 2 88
2zho-assembly3.cif.gz_E crystal structure of the regulatory subunit of aspartate kinase from thermus thermophilus (ligand free form) 0.684 2 80
2wvc-assembly1.cif.gz_A structural and mechanistic insights into helicobacter pylori nikr function 0.6787 2 84
ID Description Score Start End Superfamily
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7935 4 87 3.30.70.3090
4oi3B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7764 4 87 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.776 1 83 3.30.70.3090
af_Q2G1I7_88_170_3.30.70.3090 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ORF SCO4226, nickel-binding ferredoxin-like monomer 0.7347 1 83 3.30.70.3090
af_E9QGU9_259_454_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7274 32 60 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A7Y2XFY1-F1-model_v4 DUF4242 domain-containing protein 0.9549 1 93
AF-A0A369TIF7-F1-model_v4 DUF4242 domain-containing protein 0.9459 1 94
AF-A0A1G7HQU9-F1-model_v4 DUF4242 domain-containing protein 0.9454 1 94
AF-A0A7Y2XFY1-F1-model_v4 DUF4242 domain-containing protein 0.945 1 93
AF-A0A369TIF7-F1-model_v4 DUF4242 domain-containing protein 0.9362 1 94

Map