F388977

General Info

Members Datasets Scaffolds Average Seq Length
289 161 259 375

Family's Representative Sequence

Representative Sequence 3300005288|Ga0065714_10012664|Ga0065714_100126642
Length 418
Sequence MSXTISTKCSLTIHFXNLDLGSAGHQAIDXLXIAPTSXFHXGNFTLSLFNDFKLGDLVLKNRFVMGPMTRSRAFQDIATEQTALYYTQRATAGLIVTEGXPISREGQGYLFNPGIYTPEQIAGWKLATDSVHSVGGKIFAQLWHVGRVSHTSLQIDGAAPVSATGKAANGATAYAYTENGEPGFMPTSTPRPLATDEVRRVVEDFAQAAANAIEAGFDGVELHGANGYLLEQFINPXVNDRTDHYGXQNLENRLRFVFEVVDAVCERIGXDRVGIRISPYGQLMDMPLYPEIDETYMALCAGLGERNIAYVHVMDQTHFFLAAENSIAREDALKALLRSCRKGLNTTALILAGNMTLERARELVEADLIDLPAFGQPFISNPDLVARLQNGWPLTPPDRDTYYQGEAEGYIDYPPYAG

Samples

Sample ID Description Type Environment
1 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
2 2511231022 Pseudomonas sp. GM79 Isolate Nodule
3 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
4 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
5 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
6 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
7 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
8 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
9 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
10 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
11 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
12 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
13 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
14 2855730933 Achromobacter sp. HZ28 Isolate Nodule
15 2855767633 Achromobacter sp. HZ34 Isolate Nodule
16 2857564685 Duganella sp. R-74599 Isolate Unclassified
17 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
18 2881955468 Edaphocola flava HME-24 Isolate Rhizosphere
19 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
20 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
21 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
22 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
23 2928163908 Burkholderia sp. 567 Isolate Unclassified
24 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
25 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
26 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
27 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
28 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
29 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
30 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
31 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
32 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
44 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
45 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
49 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
50 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
61 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
62 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
63 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
64 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
65 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
69 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
70 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
71 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
72 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
73 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
74 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
75 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
76 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
84 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
85 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
86 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
87 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
92 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
93 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
94 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
102 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
123 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
124 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
127 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
128 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
136 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
137 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
138 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
139 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
140 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
141 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
142 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
143 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
144 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
145 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
146 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
147 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
148 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
149 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
150 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
153 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
154 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
155 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
156 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
157 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
158 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
160 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
161 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.62
Metatranscriptomes 0
Isolates 10.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.96
Nodule 2.08
Rhizoplane 4.84
Rhizosphere 71.63
Stem 0
Stem Tuber 0
Unclassified 13.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10000024 3300002077 Bacteria 17915
2 JGI24744J21845_10005966 3300002077 Bacteria 2526
3 JGI25151J46595_10001118 3300003187 Bacteria 19562
4 rootH2_10039330 3300003320 Bacteria 6409
5 rootL2_10011779 3300003322 Bacteria 8494
6 Ga0055526_1002409 3300003771 Bacteria 12663
7 Ga0055537_1001625 3300003773 Bacteria 8434
8 Ga0055524_1000484 3300003775 Bacteria 31257
9 Ga0055534_1000586 3300003784 Bacteria 19095
10 Ga0065714_10012664 3300005288 Bacteria 3883
11 Ga0070658_10032645 3300005327 Bacteria 4186
12 Ga0070693_100059726 3300005547 Bacteria 2211
13 Ga0081455_10058467 3300005937 Bacteria 3262
14 Ga0105251_10000724 3300009011 Bacteria 30418
15 Ga0105244_10002782 3300009036 Bacteria 13039
16 Ga0105244_10022501 3300009036 Bacteria 3469
17 Ga0157373_10065835 3300013100 Bacteria 2564
18 Ga0157371_10000128 3300013102 Bacteria 116349
19 Ga0171463_1002 3300013249 Bacteria 1274851
20 Ga0182008_10004449 3300014497 Bacteria 8193
21 Ga0182005_1000105 3300015265 Bacteria 63475
22 Ga0182005_1001140 3300015265 Bacteria 11036
23 Ga0183365_10309 3300015684 Bacteria 1505
24 Ga0183363_1202 3300015690 Bacteria 12241
25 Ga0209565_1000069 3300025263 Bacteria 169585
26 Ga0209673_1025488 3300025273 Bacteria 1964
27 Ga0209675_1000782 3300025291 Bacteria 21175
28 Ga0209025_1000034 3300025294 Bacteria 413205
29 Ga0209025_1000259 3300025294 Bacteria 124766
30 Ga0209564_1000174 3300025295 Bacteria 154188
31 Ga0209758_1015174 3300025297 Bacteria 4017
32 Ga0209256_1000199 3300025299 Bacteria 113092
33 Ga0207655_1000418 3300025728 Bacteria 58041
34 Ga0207655_1007362 3300025728 Bacteria 7141
35 Ga0207713_1001916 3300025735 Bacteria 15761
36 Ga0207705_10101806 3300025909 Bacteria 2113
37 Ga0439456_000178 3300042013 Bacteria 18517
38 Ga0450902_004967 3300042137 Bacteria 1995
39 Ga0450905_000461 3300042142 Bacteria 4967
40 Ga0466972_0048518 3300044658 Bacteria 2051
41 Ga0466963_0011715 3300044694 Bacteria 5346
42 Ga0495617_001592 3300046452 Bacteria 9802
43 Ga0495617_002032 3300046452 Bacteria 8414
44 Ga0495603_0001674 3300046455 Bacteria 13010
45 Ga0495603_0022922 3300046455 Bacteria 3778
46 Ga0495590_0008858 3300046457 Bacteria 3824
47 Ga0495591_000042 3300046458 Bacteria 152689
48 Ga0495591_000065 3300046458 Bacteria 122203
49 Ga0495591_001279 3300046458 Bacteria 16060
50 Ga0495591_001405 3300046458 Bacteria 15005
51 Ga0495591_002927 3300046458 Bacteria 9130
52 Ga0495629_0000295 3300046459 Bacteria 42788
53 Ga0495638_0000034 3300046460 Bacteria 282038
54 Ga0495651_0128514 3300046462 Bacteria 1853
55 Ga0495653_0063340 3300046463 Bacteria 2791
56 Ga0495650_0000051 3300046471 Bacteria 318297
57 Ga0495650_0001264 3300046471 Bacteria 26083
58 Ga0495650_0007603 3300046471 Bacteria 6477
59 Ga0495650_0017809 3300046471 Bacteria 3551
60 Ga0495605_0000259 3300046474 Bacteria 61729
61 Ga0495605_0000544 3300046474 Bacteria 31022
62 Ga0495605_0001775 3300046474 Bacteria 13836
63 Ga0495605_0004814 3300046474 Bacteria 7896
64 Ga0495605_0124916 3300046474 Unclassified 1164
65 Ga0495584_0020904 3300046491 Bacteria 3322
66 Ga0495585_0004080 3300046492 Bacteria 9593
67 Ga0495585_0010645 3300046492 Bacteria 5464
68 Ga0495596_0000008 3300046500 Bacteria 150860
69 Ga0495607_0000010 3300046501 Bacteria 206525
70 Ga0495607_0000053 3300046501 Bacteria 118035
71 Ga0495607_0000091 3300046501 Bacteria 93971
72 Ga0495607_0000328 3300046501 Bacteria 49178
73 Ga0495607_0000493 3300046501 Bacteria 39452
74 Ga0495607_0000746 3300046501 Bacteria 31154
75 Ga0495607_0013534 3300046501 Bacteria 5343
76 Ga0495607_0029559 3300046501 Bacteria 3371
77 Ga0495607_0055309 3300046501 Bacteria 2283
78 Ga0495583_0001563 3300046506 Bacteria 22629
79 Ga0495583_0001661 3300046506 Bacteria 21575
80 Ga0495583_0003390 3300046506 Bacteria 12198
81 Ga0495606_0000032 3300046507 Bacteria 248690
82 Ga0495606_0000042 3300046507 Bacteria 215099
83 Ga0495606_0026433 3300046507 Bacteria 4138
84 Ga0495606_0082180 3300046507 Bacteria 2001
85 Ga0495610_0000606 3300046512 Bacteria 35491
86 Ga0495610_0001803 3300046512 Bacteria 18624
87 Ga0495610_0003754 3300046512 Bacteria 11620
88 Ga0495610_0006794 3300046512 Bacteria 7763
89 Ga0495616_0003115 3300046513 Bacteria 10723
90 Ga0495616_0008935 3300046513 Bacteria 5888
91 Ga0495616_0020646 3300046513 Bacteria 3579
92 Ga0495620_0000069 3300046515 Bacteria 86730
93 Ga0495620_0001290 3300046515 Bacteria 15268
94 Ga0495620_0001906 3300046515 Bacteria 12220
95 Ga0495620_0009068 3300046515 Bacteria 5312
96 Ga0495620_0023121 3300046515 Bacteria 2979
97 Ga0495620_0024788 3300046515 Bacteria 2848
98 Ga0495620_0035917 3300046515 Bacteria 2223
99 Ga0495630_0065543 3300046517 Bacteria 2730
100 Ga0495631_0000068 3300046518 Bacteria 64881
101 Ga0495631_0001537 3300046518 Bacteria 13880
102 Ga0495631_0008139 3300046518 Bacteria 5293
103 Ga0495632_0002471 3300046519 Bacteria 14046
104 Ga0495632_0003301 3300046519 Bacteria 11512
105 Ga0495632_0028168 3300046519 Bacteria 2933
106 Ga0495637_0000023 3300046520 Bacteria 172407
107 Ga0495637_0001639 3300046520 Bacteria 12954
108 Ga0495637_0029154 3300046520 Bacteria 2458
109 Ga0495643_0002302 3300046522 Bacteria 15423
110 Ga0495643_0011151 3300046522 Bacteria 5492
111 Ga0495643_0022695 3300046522 Bacteria 3576
112 Ga0495648_0001041 3300046524 Bacteria 28146
113 Ga0495648_0001340 3300046524 Bacteria 24355
114 Ga0495648_0003607 3300046524 Bacteria 13546
115 Ga0495648_0003959 3300046524 Bacteria 12816
116 Ga0495648_0013092 3300046524 Bacteria 6150
117 Ga0495666_0020073 3300046526 Bacteria 3314
118 Ga0495642_0041715 3300046528 Bacteria 1867
119 Ga0495642_0085979 3300046528 Bacteria 1328
120 Ga0495665_0053921 3300046531 Bacteria 2125
121 Ga0495640_0140508 3300046533 Bacteria 1557
122 Ga0495586_0032261 3300046535 Bacteria 2808
123 Ga0495609_0000033 3300046538 Bacteria 208889
124 Ga0495609_0000367 3300046538 Bacteria 38923
125 Ga0495609_0001136 3300046538 Bacteria 18419
126 Ga0495609_0073714 3300046538 Bacteria 1497
127 Ga0495597_0000099 3300046542 Bacteria 77864
128 Ga0495597_0008945 3300046542 Bacteria 4993
129 Ga0495645_0000742 3300046543 Bacteria 22298
130 Ga0495622_0047125 3300046557 Bacteria 2003
131 Ga0495633_0000165 3300046558 Bacteria 86867
132 Ga0495668_0030165 3300046616 Bacteria 3063
133 Ga0495634_0138985 3300046642 Bacteria 1543
134 Ga0495634_0212710 3300046642 Bacteria 1196
135 Ga0495611_0000001 3300046648 Bacteria 2628469
136 Ga0495611_0001043 3300046648 Bacteria 14659
137 Ga0495611_0002985 3300046648 Bacteria 7544
138 Ga0495625_0000001 3300046660 Bacteria 1641829
139 Ga0495625_0000010 3300046660 Bacteria 381775
140 Ga0495625_0000085 3300046660 Bacteria 151877
141 Ga0495625_0000091 3300046660 Bacteria 146647
142 Ga0495625_0013702 3300046660 Bacteria 6499
143 Ga0495625_0026067 3300046660 Bacteria 4421
144 Ga0495625_0038744 3300046660 Bacteria 3486
145 Ga0495659_0000045 3300046664 Bacteria 55726
146 Ga0495661_0000020 3300046665 Bacteria 196901
147 Ga0495661_0018205 3300046665 Bacteria 4624
148 Ga0495661_0074393 3300046665 Bacteria 1977
149 Ga0495661_0108566 3300046665 Bacteria 1550
150 Ga0495657_0003497 3300046675 Bacteria 12808
151 Ga0495613_0012013 3300046689 Bacteria 6435
152 Ga0495613_0048221 3300046689 Bacteria 3145
153 Ga0495624_0029358 3300046690 Bacteria 3588
154 Ga0495670_0000594 3300046691 Bacteria 17244
155 Ga0495670_0001261 3300046691 Bacteria 12379
156 Ga0495670_0003901 3300046691 Bacteria 7326
157 Ga0495670_0006536 3300046691 Bacteria 5729
158 Ga0495670_0023626 3300046691 Bacteria 3034
159 Ga0495670_0048477 3300046691 Bacteria 2125
160 Ga0495670_0143127 3300046691 Bacteria 1251
161 Ga0495671_0000951 3300046692 Bacteria 20368
162 Ga0495671_0001024 3300046692 Bacteria 19451
163 Ga0495649_0010866 3300046694 Bacteria 5361
164 Ga0495649_0014611 3300046694 Bacteria 4492
165 Ga0495589_0000068 3300046794 Bacteria 98844
166 Ga0495589_0000969 3300046794 Bacteria 17519
167 Ga0495589_0001303 3300046794 Bacteria 14683
168 Ga0495589_0013429 3300046794 Bacteria 4226
169 Ga0495589_0084347 3300046794 Bacteria 1544
170 Ga0495660_0000008 3300046810 Bacteria 435769
171 Ga0495660_0001497 3300046810 Bacteria 15799
172 Ga0495660_0012511 3300046810 Bacteria 4927
173 Ga0495660_0019707 3300046810 Bacteria 3870
174 Ga0495660_0033743 3300046810 Bacteria 2867
175 Ga0495581_0138206 3300047315 Bacteria 1421
176 Ga0495604_0016866 3300047317 Bacteria 5839
177 Ga0495636_0093736 3300047318 Bacteria 1306
178 Ga0495672_0001583 3300047320 Bacteria 22217
179 Ga0495672_0008230 3300047320 Bacteria 7731
180 Ga0495672_0153005 3300047320 Bacteria 1194
181 Ga0495676_0000002 3300047321 Bacteria 373918
182 Ga0495676_0035252 3300047321 Bacteria 4186
183 Ga0495676_0040200 3300047321 Bacteria 3863
184 Ga0495680_0059105 3300047322 Bacteria 2961
185 Ga0495683_0048329 3300047323 Bacteria 2133
186 Ga0495687_000170 3300047443 Bacteria 96886
187 Ga0495687_001821 3300047443 Bacteria 18736
188 Ga0495687_008455 3300047443 Bacteria 5890
189 Ga0495687_009529 3300047443 Bacteria 5418
190 Ga0495687_033614 3300047443 Bacteria 2324
191 Ga0495679_000001 3300047446 Bacteria 1607568
192 Ga0495679_000126 3300047446 Bacteria 68027
193 Ga0495685_006082 3300047447 Bacteria 3949
194 Ga0495673_0000762 3300047469 Bacteria 30548
195 Ga0495673_0001082 3300047469 Bacteria 23780
196 Ga0495673_0003904 3300047469 Bacteria 9585
197 Ga0495673_0003991 3300047469 Bacteria 9423
198 Ga0495673_0018338 3300047469 Bacteria 3530
199 Ga0495681_0002897 3300047470 Bacteria 12124
200 Ga0495686_0011439 3300047472 Bacteria 6251
201 Ga0495686_0024482 3300047472 Bacteria 3966
202 Ga0495593_0019002 3300047673 Bacteria 3856
203 Ga0495614_0057765 3300048089 Bacteria 1666
204 Ga0495626_0000007 3300048091 Bacteria 276374
205 Ga0495626_0009020 3300048091 Bacteria 5408
206 Ga0496102_0150982 3300048905 Bacteria 2183
207 Ga0496103_0006099 3300048906 Bacteria 7202
208 Ga0496104_0052095 3300048907 Bacteria 3865
209 Ga0496104_0138877 3300048907 Bacteria 2335
210 Ga0496105_0081540 3300048908 Bacteria 2672
211 Ga0496106_0277642 3300048909 Unclassified 1342
212 Ga0496108_0007629 3300048911 Bacteria 8764
213 Ga0496110_0191358 3300048913 Unclassified 1858
214 Ga0496112_0063310 3300048915 Bacteria 3648
215 Ga0496116_0000153 3300048919 Bacteria 141137
216 Ga0496116_0001488 3300048919 Bacteria 26126
217 Ga0496116_0082684 3300048919 Bacteria 1985
218 Ga0496117_0005942 3300048920 Bacteria 12585
219 Ga0496117_0143182 3300048920 Bacteria 1428
220 Ga0496118_0001543 3300048921 Bacteria 34234
221 Ga0496118_0011198 3300048921 Bacteria 8782
222 Ga0496118_0024286 3300048921 Bacteria 5238
223 Ga0496119_0091802 3300048922 Bacteria 1724
224 Ga0496120_0000041 3300048923 Bacteria 200518
225 Ga0496121_0004007 3300048924 Bacteria 20293
226 Ga0496121_0128040 3300048924 Bacteria 1905
227 Ga0496122_0000094 3300048925 Bacteria 202047
228 Ga0496122_0000167 3300048925 Bacteria 157130
229 Ga0496122_0001869 3300048925 Bacteria 32016
230 Ga0496123_0000116 3300048926 Bacteria 161699
231 Ga0496123_0000127 3300048926 Bacteria 154927
232 Ga0496124_0000284 3300048927 Bacteria 96345
233 Ga0496124_0000355 3300048927 Bacteria 83748
234 Ga0496124_0009170 3300048927 Bacteria 10219
235 Ga0496124_0009965 3300048927 Bacteria 9707
236 Ga0496124_0102869 3300048927 Bacteria 2311
237 Ga0496125_0000656 3300048928 Bacteria 57618
238 Ga0496126_0000058 3300048929 Bacteria 272530
239 Ga0496126_0000238 3300048929 Bacteria 118994
240 Ga0495678_001818 3300049459 Bacteria 15688
241 Ga0495678_006356 3300049459 Bacteria 6299
242 Ga0495678_006759 3300049459 Bacteria 6042
243 Ga0495678_009870 3300049459 Bacteria 4682
244 Ga0495678_017391 3300049459 Bacteria 3261
245 Ga0495678_026876 3300049459 Bacteria 2449
246 Ga0495682_0000014 3300049460 Bacteria 249706
247 Ga0495682_0000741 3300049460 Bacteria 21137
248 Ga0501034_0000489 3300049571 Bacteria 64357
249 Ga0501249_000023 3300049679 Bacteria 92139
250 Ga0501204_003355 3300049850 Bacteria 1677
251 nmdc:mga00v17_2966_c1 3300050491 Bacteria 8713
252 Ga0500643_000002 3300053087 Bacteria 1277657
253 Ga0500643_000355 3300053087 Bacteria 36417
254 Ga0500555_000019 3300053103 Bacteria 175470
255 Ga0500557_035063 3300053105 Unclassified 1544
256 Ga0500607_000052 3300053121 Bacteria 80355
257 Ga0500618_000349 3300053125 Bacteria 32348
258 Ga0500618_000623 3300053125 Bacteria 21426
259 Ga0500616_0000170 3300053153 Bacteria 108126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0212710 Ga0495634_0212710_253_1179 308
2 3300048089 Ga0495614_0057765 Ga0495614_0057765_492_1418 308
3 iso_pu_bacteria 2871451962 2871455310 321
4 3300046474 Ga0495605_0124916 Ga0495605_0124916_138_1151 325
5 3300046691 Ga0495670_0000594 Ga0495670_0000594_14218_15249 326
6 3300046691 Ga0495670_0023626 Ga0495670_0023626_33_1085 337
7 3300047320 Ga0495672_0153005 Ga0495672_0153005_124_1182 339
8 3300050491 nmdc:mga00v17_2966_c1 nmdc:mga00v17_2966_c1_7495_8565 340
9 3300049459 Ga0495678_026876 Ga0495678_026876_35_1102 341
10 iso_pu_bacteria 2903748898 2903759186 344
11 3300046538 Ga0495609_0073714 Ga0495609_0073714_71_1108 345
12 3300048911 Ga0496108_0007629 Ga0496108_0007629_2352_3497 348
13 3300049679 Ga0501249_000023 Ga0501249_000023_15429_16574 348
14 3300049850 Ga0501204_003355 Ga0501204_003355_217_1362 348
15 3300053153 Ga0500616_0000170 Ga0500616_0000170_90818_91963 348
16 3300048920 Ga0496117_0143182 Ga0496117_0143182_320_1408 349
17 3300053087 Ga0500643_000355 Ga0500643_000355_10205_11317 349
18 iso_pu_bacteria 2599185214 2599627320 352
19 iso_pu_bacteria 2599185226 2599676735 352
20 iso_pu_bacteria 2599185227 2599679971 352
21 iso_pu_bacteria 2599185229 2599691987 352
22 iso_pu_bacteria 2929177148 2929179165 352
23 iso_pu_bacteria 2945977869 2945981566 352
24 iso_pu_bacteria 2946013367 2946019028 352
25 iso_pu_bacteria 2513237165 2514045348 353
26 iso_pu_bacteria 2818991439 2819561689 353
27 iso_pu_bacteria 2844533157 2844533365 353
28 iso_pu_bacteria 2881955468 2881957466 354
29 iso_pu_bacteria 2884791551 2884793947 354
30 3300003320 rootH2_10039330 rootH2_100393305 355
31 3300048909 Ga0496106_0277642 Ga0496106_0277642_163_1230 355
32 3300014497 Ga0182008_10004449 Ga0182008_100044495 356
33 3300046462 Ga0495651_0128514 Ga0495651_0128514_652_1749 356
34 3300046675 Ga0495657_0003497 Ga0495657_0003497_1283_2353 356
35 3300046689 Ga0495613_0012013 Ga0495613_0012013_2507_3577 356
36 3300046689 Ga0495613_0048221 Ga0495613_0048221_1123_2193 356
37 3300046690 Ga0495624_0029358 Ga0495624_0029358_840_1910 356
38 3300047315 Ga0495581_0138206 Ga0495581_0138206_14_1084 356
39 3300047317 Ga0495604_0016866 Ga0495604_0016866_1721_2791 356
40 3300047318 Ga0495636_0093736 Ga0495636_0093736_30_1100 356
41 3300047321 Ga0495676_0040200 Ga0495676_0040200_1808_2878 356
42 3300047673 Ga0495593_0019002 Ga0495593_0019002_270_1340 356
43 3300049459 Ga0495678_017391 Ga0495678_017391_743_1813 356
44 iso_pu_bacteria 2511231022 2511362825 356
45 iso_pu_bacteria 2738541271 2738689173 356
46 iso_pu_bacteria 2738543016 2739264560 356
47 3300013249 Ga0171463_1002 Ga0171463_1002757 357
48 3300015684 Ga0183365_10309 Ga0183365_103092 357
49 3300015690 Ga0183363_1202 Ga0183363_12021 357
50 3300025294 Ga0209025_1000034 Ga0209025_1000034152 357
51 3300044658 Ga0466972_0048518 Ga0466972_0048518_166_1278 357
52 3300046492 Ga0495585_0004080 Ga0495585_0004080_3305_4423 357
53 3300046512 Ga0495610_0006794 Ga0495610_0006794_547_1668 357
54 3300046524 Ga0495648_0001041 Ga0495648_0001041_13863_14969 357
55 3300046524 Ga0495648_0003959 Ga0495648_0003959_5221_6333 357
56 3300049571 Ga0501034_0000489 Ga0501034_0000489_49519_50628 357
57 iso_pu_bacteria 2510917021 2511130709 357
58 iso_pu_bacteria 8047710418 8047712210 357
59 3300003322 rootL2_10011779 rootL2_100117796 358
60 3300046660 Ga0495625_0000085 Ga0495625_0000085_115558_116673 358
61 3300046691 Ga0495670_0003901 Ga0495670_0003901_5894_7009 358
62 3300048919 Ga0496116_0000153 Ga0496116_0000153_90573_91730 358
63 3300048921 Ga0496118_0011198 Ga0496118_0011198_250_1407 358
64 3300048925 Ga0496122_0000094 Ga0496122_0000094_90573_91730 358
65 3300048926 Ga0496123_0000116 Ga0496123_0000116_4843_6000 358
66 3300048929 Ga0496126_0000058 Ga0496126_0000058_7434_8591 358
67 iso_pu_bacteria 2600255283 2601623654 358
68 iso_pu_bacteria 2600255283 2601625128 358
69 iso_pu_bacteria 2687453129 2687578678 358
70 iso_pu_bacteria 2855730933 2855736436 358
71 iso_pu_bacteria 2855767633 2855773373 358
72 iso_pu_bacteria 2857564685 2857566445 358
73 iso_pu_bacteria 2912963787 2912965930 358
74 iso_pu_bacteria 2928157003 2928157010 358
75 iso_pu_bacteria 2928163908 2928168032 358
76 iso_pu_bacteria 2939651529 2939653599 358
77 iso_pu_bacteria 2981990288 2981992644 358
78 3300025728 Ga0207655_1000418 Ga0207655_100041838 360
79 3300042137 Ga0450902_004967 Ga0450902_004967_557_1678 360
80 3300042142 Ga0450905_000461 Ga0450905_000461_3722_4843 360
81 3300046471 Ga0495650_0017809 Ga0495650_0017809_603_1727 360
82 3300046501 Ga0495607_0000493 Ga0495607_0000493_17097_18218 360
83 3300046513 Ga0495616_0020646 Ga0495616_0020646_2249_3367 360
84 3300046518 Ga0495631_0000068 Ga0495631_0000068_33615_34733 360
85 3300046519 Ga0495632_0002471 Ga0495632_0002471_12563_13681 360
86 3300046660 Ga0495625_0026067 Ga0495625_0026067_1024_2142 360
87 3300046691 Ga0495670_0001261 Ga0495670_0001261_364_1485 360
88 3300046691 Ga0495670_0048477 Ga0495670_0048477_770_1888 360
89 3300046794 Ga0495589_0000068 Ga0495589_0000068_85102_86223 360
90 3300046810 Ga0495660_0033743 Ga0495660_0033743_839_1960 360
91 3300048927 Ga0496124_0000355 Ga0496124_0000355_8881_10002 360
92 3300049459 Ga0495678_001818 Ga0495678_001818_5215_6333 360
93 3300053105 Ga0500557_035063 Ga0500557_035063_44_1162 360
94 3300003187 JGI25151J46595_10001118 JGI25151J46595_1000111817 361
95 3300003771 Ga0055526_1002409 Ga0055526_10024097 361
96 3300003773 Ga0055537_1001625 Ga0055537_10016253 361
97 3300003775 Ga0055524_1000484 Ga0055524_100048430 361
98 3300003784 Ga0055534_1000586 Ga0055534_10005862 361
99 3300005288 Ga0065714_10012664 Ga0065714_100126642 361
100 3300009036 Ga0105244_10002782 Ga0105244_100027827 361
101 3300009036 Ga0105244_10022501 Ga0105244_100225013 361
102 3300025263 Ga0209565_1000069 Ga0209565_100006919 361
103 3300025273 Ga0209673_1025488 Ga0209673_10254882 361
104 3300025291 Ga0209675_1000782 Ga0209675_10007824 361
105 3300025294 Ga0209025_1000259 Ga0209025_10002592 361
106 3300025295 Ga0209564_1000174 Ga0209564_1000174146 361
107 3300025297 Ga0209758_1015174 Ga0209758_10151744 361
108 3300025299 Ga0209256_1000199 Ga0209256_100019993 361
109 3300046452 Ga0495617_001592 Ga0495617_001592_6575_7801 361
110 3300046471 Ga0495650_0000051 Ga0495650_0000051_152500_153687 361
111 3300046474 Ga0495605_0000259 Ga0495605_0000259_43013_44239 361
112 3300046501 Ga0495607_0000053 Ga0495607_0000053_67152_68276 361
113 3300046501 Ga0495607_0029559 Ga0495607_0029559_526_1752 361
114 3300046507 Ga0495606_0082180 Ga0495606_0082180_268_1392 361
115 3300046515 Ga0495620_0000069 Ga0495620_0000069_29360_30484 361
116 3300046542 Ga0495597_0008945 Ga0495597_0008945_756_1982 361
117 3300046558 Ga0495633_0000165 Ga0495633_0000165_17008_18234 361
118 3300046660 Ga0495625_0000091 Ga0495625_0000091_121583_122719 361
119 3300046664 Ga0495659_0000045 Ga0495659_0000045_23193_24419 361
120 3300046691 Ga0495670_0006536 Ga0495670_0006536_3608_4744 361
121 3300046694 Ga0495649_0010866 Ga0495649_0010866_2186_3412 361
122 3300046794 Ga0495589_0013429 Ga0495589_0013429_2525_3751 361
123 3300047322 Ga0495680_0059105 Ga0495680_0059105_940_2166 361
124 3300047443 Ga0495687_001821 Ga0495687_001821_3409_4635 361
125 3300047447 Ga0495685_006082 Ga0495685_006082_2563_3789 361
126 3300048091 Ga0495626_0009020 Ga0495626_0009020_2551_3777 361
127 3300048924 Ga0496121_0128040 Ga0496121_0128040_643_1869 361
128 3300048925 Ga0496122_0001869 Ga0496122_0001869_17536_18762 361
129 3300049460 Ga0495682_0000014 Ga0495682_0000014_138496_139620 361
130 3300005327 Ga0070658_10032645 Ga0070658_100326454 362
131 3300009011 Ga0105251_10000724 Ga0105251_100007244 362
132 3300013100 Ga0157373_10065835 Ga0157373_100658352 362
133 3300013102 Ga0157371_10000128 Ga0157371_1000012877 362
134 3300015265 Ga0182005_1000105 Ga0182005_100010544 362
135 3300015265 Ga0182005_1001140 Ga0182005_10011406 362
136 3300025728 Ga0207655_1007362 Ga0207655_10073627 362
137 3300025735 Ga0207713_1001916 Ga0207713_10019164 362
138 3300025909 Ga0207705_10101806 Ga0207705_101018062 362
139 3300042013 Ga0439456_000178 Ga0439456_000178_13479_14606 362
140 3300046455 Ga0495603_0001674 Ga0495603_0001674_1106_2236 362
141 3300046455 Ga0495603_0022922 Ga0495603_0022922_613_1701 362
142 3300046457 Ga0495590_0008858 Ga0495590_0008858_1068_2195 362
143 3300046458 Ga0495591_000042 Ga0495591_000042_34175_35302 362
144 3300046458 Ga0495591_000065 Ga0495591_000065_62565_63692 362
145 3300046458 Ga0495591_001279 Ga0495591_001279_11573_12700 362
146 3300046458 Ga0495591_001405 Ga0495591_001405_4391_5518 362
147 3300046458 Ga0495591_002927 Ga0495591_002927_52_1179 362
148 3300046459 Ga0495629_0000295 Ga0495629_0000295_19236_20366 362
149 3300046463 Ga0495653_0063340 Ga0495653_0063340_1302_2432 362
150 3300046471 Ga0495650_0001264 Ga0495650_0001264_18184_19311 362
151 3300046471 Ga0495650_0007603 Ga0495650_0007603_1828_2958 362
152 3300046474 Ga0495605_0000544 Ga0495605_0000544_18858_19985 362
153 3300046474 Ga0495605_0001775 Ga0495605_0001775_3022_4110 362
154 3300046474 Ga0495605_0004814 Ga0495605_0004814_2539_3666 362
155 3300046491 Ga0495584_0020904 Ga0495584_0020904_1581_2708 362
156 3300046492 Ga0495585_0010645 Ga0495585_0010645_3229_4356 362
157 3300046500 Ga0495596_0000008 Ga0495596_0000008_1281_2408 362
158 3300046501 Ga0495607_0000091 Ga0495607_0000091_46704_47846 362
159 3300046501 Ga0495607_0000328 Ga0495607_0000328_22623_23765 362
160 3300046501 Ga0495607_0000746 Ga0495607_0000746_12277_13455 362
161 3300046501 Ga0495607_0013534 Ga0495607_0013534_1611_2741 362
162 3300046506 Ga0495583_0001563 Ga0495583_0001563_7698_8825 362
163 3300046506 Ga0495583_0003390 Ga0495583_0003390_1700_2827 362
164 3300046507 Ga0495606_0000032 Ga0495606_0000032_200316_201443 362
165 3300046507 Ga0495606_0000042 Ga0495606_0000042_30681_31808 362
166 3300046507 Ga0495606_0026433 Ga0495606_0026433_1587_2675 362
167 3300046512 Ga0495610_0000606 Ga0495610_0000606_15464_16591 362
168 3300046512 Ga0495610_0001803 Ga0495610_0001803_12592_13719 362
169 3300046512 Ga0495610_0003754 Ga0495610_0003754_6298_7461 362
170 3300046513 Ga0495616_0008935 Ga0495616_0008935_578_1666 362
171 3300046515 Ga0495620_0001290 Ga0495620_0001290_13878_15062 362
172 3300046515 Ga0495620_0001906 Ga0495620_0001906_8127_9215 362
173 3300046515 Ga0495620_0009068 Ga0495620_0009068_4163_5290 362
174 3300046515 Ga0495620_0023121 Ga0495620_0023121_1188_2315 362
175 3300046515 Ga0495620_0035917 Ga0495620_0035917_79_1206 362
176 3300046517 Ga0495630_0065543 Ga0495630_0065543_912_2042 362
177 3300046518 Ga0495631_0001537 Ga0495631_0001537_4687_5814 362
178 3300046519 Ga0495632_0003301 Ga0495632_0003301_2976_4103 362
179 3300046519 Ga0495632_0028168 Ga0495632_0028168_1551_2678 362
180 3300046520 Ga0495637_0000023 Ga0495637_0000023_52826_53953 362
181 3300046520 Ga0495637_0001639 Ga0495637_0001639_10180_11307 362
182 3300046520 Ga0495637_0029154 Ga0495637_0029154_1017_2144 362
183 3300046522 Ga0495643_0002302 Ga0495643_0002302_3101_4228 362
184 3300046522 Ga0495643_0022695 Ga0495643_0022695_1561_2691 362
185 3300046524 Ga0495648_0001340 Ga0495648_0001340_13902_15029 362
186 3300046524 Ga0495648_0003607 Ga0495648_0003607_10776_11903 362
187 3300046524 Ga0495648_0013092 Ga0495648_0013092_991_2118 362
188 3300046528 Ga0495642_0041715 Ga0495642_0041715_563_1693 362
189 3300046531 Ga0495665_0053921 Ga0495665_0053921_376_1506 362
190 3300046533 Ga0495640_0140508 Ga0495640_0140508_366_1454 362
191 3300046535 Ga0495586_0032261 Ga0495586_0032261_1660_2790 362
192 3300046538 Ga0495609_0000033 Ga0495609_0000033_16839_17966 362
193 3300046538 Ga0495609_0000367 Ga0495609_0000367_9605_10732 362
194 3300046542 Ga0495597_0000099 Ga0495597_0000099_66145_67272 362
195 3300046543 Ga0495645_0000742 Ga0495645_0000742_19225_20355 362
196 3300046557 Ga0495622_0047125 Ga0495622_0047125_59_1186 362
197 3300046616 Ga0495668_0030165 Ga0495668_0030165_1295_2383 362
198 3300046642 Ga0495634_0138985 Ga0495634_0138985_341_1471 362
199 3300046648 Ga0495611_0001043 Ga0495611_0001043_2616_3743 362
200 3300046648 Ga0495611_0002985 Ga0495611_0002985_352_1479 362
201 3300046660 Ga0495625_0000010 Ga0495625_0000010_221759_222886 362
202 3300046660 Ga0495625_0013702 Ga0495625_0013702_1196_2323 362
203 3300046660 Ga0495625_0038744 Ga0495625_0038744_570_1697 362
204 3300046665 Ga0495661_0000020 Ga0495661_0000020_60737_61864 362
205 3300046665 Ga0495661_0018205 Ga0495661_0018205_1382_2509 362
206 3300046665 Ga0495661_0074393 Ga0495661_0074393_162_1289 362
207 3300046691 Ga0495670_0143127 Ga0495670_0143127_38_1165 362
208 3300046692 Ga0495671_0001024 Ga0495671_0001024_15777_16904 362
209 3300046694 Ga0495649_0014611 Ga0495649_0014611_1813_2901 362
210 3300046794 Ga0495589_0001303 Ga0495589_0001303_9432_10565 362
211 3300046810 Ga0495660_0001497 Ga0495660_0001497_7674_8801 362
212 3300046810 Ga0495660_0012511 Ga0495660_0012511_1014_2141 362
213 3300046810 Ga0495660_0019707 Ga0495660_0019707_1333_2460 362
214 3300047320 Ga0495672_0001583 Ga0495672_0001583_6372_7460 362
215 3300047320 Ga0495672_0008230 Ga0495672_0008230_1105_2232 362
216 3300047321 Ga0495676_0000002 Ga0495676_0000002_156901_158028 362
217 3300047321 Ga0495676_0035252 Ga0495676_0035252_2442_3530 362
218 3300047323 Ga0495683_0048329 Ga0495683_0048329_153_1307 362
219 3300047443 Ga0495687_000170 Ga0495687_000170_63189_64343 362
220 3300047446 Ga0495679_000126 Ga0495679_000126_49812_50939 362
221 3300047469 Ga0495673_0000762 Ga0495673_0000762_7589_8773 362
222 3300047469 Ga0495673_0001082 Ga0495673_0001082_13134_14261 362
223 3300047469 Ga0495673_0003904 Ga0495673_0003904_6656_7783 362
224 3300047469 Ga0495673_0003991 Ga0495673_0003991_2881_4008 362
225 3300047469 Ga0495673_0018338 Ga0495673_0018338_1409_2536 362
226 3300047470 Ga0495681_0002897 Ga0495681_0002897_6911_8038 362
227 3300047472 Ga0495686_0011439 Ga0495686_0011439_812_1939 362
228 3300048091 Ga0495626_0000007 Ga0495626_0000007_160358_161485 362
229 3300048905 Ga0496102_0150982 Ga0496102_0150982_716_1867 362
230 3300048906 Ga0496103_0006099 Ga0496103_0006099_3392_4543 362
231 3300048907 Ga0496104_0052095 Ga0496104_0052095_2321_3478 362
232 3300048907 Ga0496104_0138877 Ga0496104_0138877_1135_2292 362
233 3300048908 Ga0496105_0081540 Ga0496105_0081540_112_1269 362
234 3300048913 Ga0496110_0191358 Ga0496110_0191358_308_1435 362
235 3300048915 Ga0496112_0063310 Ga0496112_0063310_1107_2264 362
236 3300048919 Ga0496116_0001488 Ga0496116_0001488_12792_13949 362
237 3300048919 Ga0496116_0082684 Ga0496116_0082684_809_1966 362
238 3300048920 Ga0496117_0005942 Ga0496117_0005942_5051_6202 362
239 3300048921 Ga0496118_0001543 Ga0496118_0001543_29038_30189 362
240 3300048921 Ga0496118_0024286 Ga0496118_0024286_1017_2174 362
241 3300048922 Ga0496119_0091802 Ga0496119_0091802_94_1251 362
242 3300048923 Ga0496120_0000041 Ga0496120_0000041_100914_102071 362
243 3300048924 Ga0496121_0004007 Ga0496121_0004007_16726_17853 362
244 3300048925 Ga0496122_0000167 Ga0496122_0000167_112230_113357 362
245 3300048926 Ga0496123_0000127 Ga0496123_0000127_31908_33035 362
246 3300048927 Ga0496124_0000284 Ga0496124_0000284_80275_81402 362
247 3300048927 Ga0496124_0009170 Ga0496124_0009170_3597_4754 362
248 3300048927 Ga0496124_0009965 Ga0496124_0009965_225_1352 362
249 3300048927 Ga0496124_0102869 Ga0496124_0102869_191_1348 362
250 3300048928 Ga0496125_0000656 Ga0496125_0000656_6568_7725 362
251 3300048929 Ga0496126_0000238 Ga0496126_0000238_117680_118837 362
252 3300049459 Ga0495678_006356 Ga0495678_006356_244_1371 362
253 3300049459 Ga0495678_006759 Ga0495678_006759_2999_4126 362
254 3300049459 Ga0495678_009870 Ga0495678_009870_1636_2763 362
255 3300053121 Ga0500607_000052 Ga0500607_000052_7856_8986 362
256 3300053125 Ga0500618_000349 Ga0500618_000349_12106_13236 362
257 3300053125 Ga0500618_000623 Ga0500618_000623_7085_8215 362
258 3300044694 Ga0466963_0011715 Ga0466963_0011715_1217_2341 363
259 3300046452 Ga0495617_002032 Ga0495617_002032_4824_5954 365
260 3300046460 Ga0495638_0000034 Ga0495638_0000034_92556_93686 365
261 3300046501 Ga0495607_0000010 Ga0495607_0000010_123334_124464 365
262 3300046506 Ga0495583_0001661 Ga0495583_0001661_5313_6443 365
263 3300046513 Ga0495616_0003115 Ga0495616_0003115_6956_8086 365
264 3300046538 Ga0495609_0001136 Ga0495609_0001136_14492_15622 365
265 3300046648 Ga0495611_0000001 Ga0495611_0000001_1235619_1236749 365
266 3300046660 Ga0495625_0000001 Ga0495625_0000001_679290_680420 365
267 3300046665 Ga0495661_0108566 Ga0495661_0108566_206_1336 365
268 3300046692 Ga0495671_0000951 Ga0495671_0000951_10193_11323 365
269 3300046794 Ga0495589_0000969 Ga0495589_0000969_5253_6383 365
270 3300046810 Ga0495660_0000008 Ga0495660_0000008_44319_45449 365
271 3300047446 Ga0495679_000001 Ga0495679_000001_350208_351338 365
272 3300049460 Ga0495682_0000741 Ga0495682_0000741_14456_15586 365
273 3300053087 Ga0500643_000002 Ga0500643_000002_578951_580081 365
274 3300053103 Ga0500555_000019 Ga0500555_000019_160845_161975 365
275 3300046501 Ga0495607_0055309 Ga0495607_0055309_573_1679 368
276 3300046515 Ga0495620_0024788 Ga0495620_0024788_833_1939 368
277 3300046518 Ga0495631_0008139 Ga0495631_0008139_591_1697 368
278 3300046522 Ga0495643_0011151 Ga0495643_0011151_196_1302 368
279 3300046526 Ga0495666_0020073 Ga0495666_0020073_1787_2893 368
280 3300046528 Ga0495642_0085979 Ga0495642_0085979_24_1130 368
281 3300046794 Ga0495589_0084347 Ga0495589_0084347_65_1171 368
282 3300047443 Ga0495687_008455 Ga0495687_008455_626_1732 368
283 3300047443 Ga0495687_009529 Ga0495687_009529_1972_3171 368
284 3300047443 Ga0495687_033614 Ga0495687_033614_936_2042 368
285 3300047472 Ga0495686_0024482 Ga0495686_0024482_398_1504 368
286 3300002077 JGI24744J21845_10000024 JGI24744J21845_100000245 377
287 3300002077 JGI24744J21845_10005966 JGI24744J21845_100059662 377
288 3300005547 Ga0070693_100059726 Ga0070693_1000597262 377
289 3300005937 Ga0081455_10058467 Ga0081455_100584672 377

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00724

Oxidored_FMN

NADH:flavin oxidoreductase / NADH oxidase family

47

395

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s32-assembly3.cif.gz_C crystal structure of ene-reductase ctoye from chroococcidiopsis thermalis. 0.9619 14 373
6s32-assembly1.cif.gz_A crystal structure of ene-reductase ctoye from chroococcidiopsis thermalis. 0.9603 14 373
4ab4-assembly1.cif.gz_A structure of xenobiotic reductase b from pseudomonas putida in complex with tnt 0.9599 15 373
6s32-assembly4.cif.gz_D crystal structure of ene-reductase ctoye from chroococcidiopsis thermalis. 0.9594 15 373
5epd-assembly1.cif.gz_A crystal structure of glycerol trinitrate reductase xdpb from agrobacterium sp. r89-1 (apo form) 0.9593 15 375
ID Description Score Start End Superfamily
af_Q4CNI1_1_256_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9421 14 236 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9407 15 373 3.20.20.70
2r14A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9324 15 373 3.20.20.70
4a3uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.931 15 373 3.20.20.70
af_E9AGH7_3_365_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9308 14 373 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A0H4PI94-F1-model_v4 Flavoprotein NADH-dependent oxidoreductase 0.983 13 374 GO:0005829
GO:0010181
GO:0016491
AF-A0A2D7YZG0-F1-model_v4 deleted 0.9826 14 122
AF-A0A519YQS0-F1-model_v4 Alkene reductase 0.9804 54 377 GO:0010181
GO:0016491
AF-A0A1G8BSS7-F1-model_v4 N-ethylmaleimide reductase 0.9798 13 377 GO:0005829
GO:0010181
GO:0016491
AF-F7VMF0-F1-model_v4 WGS project CABT00000000 data, contig 2.2 0.9796 52 179 GO:0010181
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.54 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map