F388875

General Info

Members Datasets Scaffolds Average Seq Length
288 171 576 322

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_145137_c1|nmdc:mga08y16_145137_c1_646_1746
Length 366
Sequence VPSEVTNANAQRCLFKKRLTSSSFAIERQDNLAARFPDGVLMKRRQFIVLLGGAAVSWPVSARAQQPRIPAVGWLALGQFGPVNAFRQGLGEAGYVEGRNVAIEFRLADQLSLLPGLAADLVSREVDVIFANGSPSAALAAKAATPTIPIVFISPEDPRKYGLVTRLNRPEGNLTGVNFRVAELAGKRLQLLSEIVPQTTTIAYLSGPPNSVVFENLKSDILAAARTLGRDLLIVPVYQGNYDVAFSTIAKRGAGALIVGDYTIFFVPHNRKKILELVARYNIPAIYPNVVFAEDDGLMSYGPDAVALYRRLGSDYVGSILKGAMPSDLPVQQPSKFEFVINLKTAKAMGVNIPRILFAAATQVIE

Samples

Sample ID Description Type Environment
1 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
77 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
118 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
119 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
120 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
128 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
151 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
152 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
153 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
161 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.39
Nodule 0
Rhizoplane 21.88
Rhizosphere 76.04
Stem 0
Stem Tuber 0
Unclassified 17.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga08y16_145137_c1 3300050511 Unclassified 2467
2 Ga0070690_100062280 3300005330 Unclassified 2405
3 Ga0070670_100064899 3300005331 Unclassified 3132
4 Ga0068869_100131136 3300005334 Bacteria 1927
5 Ga0070666_10002063 3300005335 Bacteria 12201
6 Ga0070680_100086312 3300005336 Bacteria 2594
7 Ga0070682_100384868 3300005337 Unclassified 1056
8 Ga0068868_100113052 3300005338 Bacteria 2207
9 Ga0070689_100022911 3300005340 Unclassified 4669
10 Ga0070661_100174220 3300005344 Bacteria 1635
11 Ga0070675_100065181 3300005354 Bacteria 3011
12 Ga0070671_100140948 3300005355 Unclassified 2034
13 Ga0070674_100047509 3300005356 Unclassified 2942
14 Ga0070674_100059644 3300005356 Unclassified 2657
15 Ga0070674_100487602 3300005356 Unclassified 1024
16 Ga0070673_100031489 3300005364 Unclassified 3980
17 Ga0070688_100007059 3300005365 Bacteria 6041
18 Ga0070667_100113016 3300005367 Bacteria 2356
19 Ga0070709_10008480 3300005434 Bacteria 5647
20 Ga0070709_10172275 3300005434 Bacteria 1513
21 Ga0070714_100002064 3300005435 Bacteria 14708
22 Ga0070713_100005004 3300005436 Bacteria 9001
23 Ga0070710_10016008 3300005437 Unclassified 3806
24 Ga0070701_10104324 3300005438 Bacteria 1575
25 Ga0070711_100009910 3300005439 Bacteria 5874
26 Ga0070711_100133371 3300005439 Unclassified 1853
27 Ga0070711_100356815 3300005439 Bacteria 1176
28 Ga0070711_100375636 3300005439 Bacteria 1148
29 Ga0070711_100393299 3300005439 Unclassified 1123
30 Ga0070708_100235946 3300005445 Bacteria 1716
31 Ga0070708_100324090 3300005445 Bacteria 1451
32 Ga0070678_100041028 3300005456 Unclassified 3278
33 Ga0070662_100245921 3300005457 Unclassified 1436
34 Ga0070685_10004799 3300005466 Bacteria 6845
35 Ga0070706_100013572 3300005467 Bacteria 7532
36 Ga0070706_100076126 3300005467 Bacteria 3106
37 Ga0070706_100130437 3300005467 Bacteria 2345
38 Ga0070706_100214504 3300005467 Bacteria 1797
39 Ga0070707_100185794 3300005468 Bacteria 2027
40 Ga0070707_100312508 3300005468 Bacteria 1527
41 Ga0070707_100458549 3300005468 Bacteria 1235
42 Ga0070698_100000271 3300005471 Bacteria 52585
43 Ga0070698_100042345 3300005471 Bacteria 4670
44 Ga0070699_100155393 3300005518 Bacteria 2024
45 Ga0070699_100174246 3300005518 Bacteria 1907
46 Ga0070697_100013954 3300005536 Bacteria 6309
47 Ga0070697_100069774 3300005536 Bacteria 2879
48 Ga0070697_100284359 3300005536 Bacteria 1419
49 Ga0070686_100036570 3300005544 Unclassified 3042
50 Ga0070665_100049423 3300005548 Bacteria 4219
51 Ga0070665_100056287 3300005548 Unclassified 3943
52 Ga0070664_100086469 3300005564 Unclassified 2709
53 Ga0068856_100205734 3300005614 Bacteria 1983
54 Ga0068852_100043856 3300005616 Bacteria 3795
55 Ga0068864_100075229 3300005618 Unclassified 2948
56 Ga0068866_10068956 3300005718 Bacteria 1861
57 Ga0068863_100118208 3300005841 Bacteria 2526
58 Ga0068860_100234591 3300005843 Bacteria 1783
59 Ga0081455_10005468 3300005937 Bacteria 13924
60 Ga0081455_10021818 3300005937 Bacteria 5998
61 Ga0081455_10282814 3300005937 Bacteria 1198
62 Ga0081538_10038300 3300005981 Bacteria 3096
63 Ga0081540_1014302 3300005983 Bacteria 5093
64 Ga0070717_10001899 3300006028 Bacteria 14613
65 Ga0070717_10389577 3300006028 Bacteria 1250
66 Ga0075365_10028267 3300006038 Bacteria 3576
67 Ga0070715_10000408 3300006163 Bacteria 10941
68 Ga0070716_100002885 3300006173 Bacteria 8011
69 Ga0070712_100001451 3300006175 Bacteria 14455
70 Ga0070712_100008867 3300006175 Bacteria 6332
71 Ga0070712_100008996 3300006175 Bacteria 6290
72 Ga0075362_10038636 3300006177 Unclassified 2097
73 Ga0097621_100002973 3300006237 Bacteria 11638
74 Ga0068871_100005221 3300006358 Bacteria 9086
75 Ga0075428_100020239 3300006844 Bacteria 7369
76 Ga0075428_100504074 3300006844 Bacteria 1295
77 Ga0075428_100535305 3300006844 Bacteria 1253
78 Ga0075428_100669226 3300006844 Bacteria 1106
79 Ga0075431_100023148 3300006847 Bacteria 6353
80 Ga0075431_100097881 3300006847 Bacteria 3029
81 Ga0075431_100253523 3300006847 Bacteria 1787
82 Ga0075431_100366574 3300006847 Bacteria 1446
83 Ga0075431_100392143 3300006847 Bacteria 1391
84 Ga0075434_100083956 3300006871 Bacteria 3183
85 Ga0075434_100450987 3300006871 Bacteria 1307
86 Ga0075429_100057859 3300006880 Bacteria 3376
87 Ga0068865_100058339 3300006881 Bacteria 2695
88 Ga0111539_10059745 3300009094 Bacteria 4520
89 Ga0111539_10121201 3300009094 Bacteria 3065
90 Ga0111539_10606492 3300009094 Bacteria 1275
91 Ga0111539_10820269 3300009094 Bacteria 1082
92 Ga0105245_10064403 3300009098 Unclassified 3312
93 Ga0105245_10133837 3300009098 Bacteria 2328
94 Ga0105247_10051064 3300009101 Unclassified 2545
95 Ga0114129_10278723 3300009147 Bacteria 2234
96 Ga0114129_10512036 3300009147 Bacteria 1566
97 Ga0114129_10824223 3300009147 Bacteria 1182
98 Ga0105243_10011659 3300009148 Bacteria 6649
99 Ga0105242_10015862 3300009176 Bacteria 5854
100 Ga0105248_10048005 3300009177 Bacteria 4788
101 Ga0105238_10332642 3300009551 Bacteria 1506
102 Ga0105249_10138857 3300009553 Bacteria 2328
103 Ga0105249_10588447 3300009553 Bacteria 1166
104 Ga0105239_10328438 3300010375 Unclassified 1725
105 Ga0105246_10047665 3300011119 Unclassified 2927
106 Ga0105246_10597866 3300011119 Bacteria 953
107 Ga0157342_1002438 3300012507 Unclassified 1509
108 Ga0157374_10113807 3300013296 Unclassified 2604
109 Ga0157378_10036959 3300013297 Unclassified 4323
110 Ga0163162_10032186 3300013306 Bacteria 5206
111 Ga0163162_10391865 3300013306 Bacteria 1522
112 Ga0163162_10395562 3300013306 Bacteria 1514
113 Ga0163162_10813057 3300013306 Bacteria 1051
114 Ga0157375_10141257 3300013308 Unclassified 2535
115 Ga0163163_10696689 3300014325 Bacteria 1079
116 Ga0157379_10050836 3300014968 Bacteria 3700
117 Ga0157379_10090732 3300014968 Bacteria 2741
118 Ga0157376_10036390 3300014969 Unclassified 3988
119 Ga0157376_10241534 3300014969 Bacteria 1683
120 Ga0163161_10023121 3300017792 Bacteria 4381
121 Ga0207692_10014589 3300025898 Unclassified 3435
122 Ga0207692_10254297 3300025898 Bacteria 1054
123 Ga0207710_10005686 3300025900 Bacteria 5364
124 Ga0207680_10010708 3300025903 Unclassified 4600
125 Ga0207685_10117327 3300025905 Bacteria 1163
126 Ga0207699_10001083 3300025906 Bacteria 12847
127 Ga0207684_10027799 3300025910 Bacteria 4818
128 Ga0207684_10047884 3300025910 Bacteria 3625
129 Ga0207684_10305316 3300025910 Bacteria 1372
130 Ga0207654_10311700 3300025911 Bacteria 1073
131 Ga0207693_10000506 3300025915 Bacteria 35208
132 Ga0207693_10087444 3300025915 Bacteria 2442
133 Ga0207693_10305999 3300025915 Bacteria 1245
134 Ga0207663_10045792 3300025916 Unclassified 2692
135 Ga0207663_10060550 3300025916 Unclassified 2399
136 Ga0207660_10263088 3300025917 Bacteria 1365
137 Ga0207649_10015679 3300025920 Unclassified 4258
138 Ga0207646_10062693 3300025922 Bacteria 3319
139 Ga0207694_10139415 3300025924 Bacteria 1949
140 Ga0207687_10020452 3300025927 Bacteria 4390
141 Ga0207700_10000723 3300025928 Bacteria 19055
142 Ga0207700_10299163 3300025928 Unclassified 1389
143 Ga0207664_10011330 3300025929 Bacteria 6329
144 Ga0207644_10001277 3300025931 Bacteria 16196
145 Ga0207644_10273301 3300025931 Bacteria 1355
146 Ga0207690_10200657 3300025932 Bacteria 1515
147 Ga0207706_10180431 3300025933 Bacteria 1854
148 Ga0207686_10010077 3300025934 Bacteria 5141
149 Ga0207670_10127301 3300025936 Bacteria 1860
150 Ga0207669_10107803 3300025937 Bacteria 1859
151 Ga0207665_10000534 3300025939 Bacteria 25614
152 Ga0207711_10028066 3300025941 Unclassified 4733
153 Ga0207689_10138716 3300025942 Bacteria 2003
154 Ga0207661_10162359 3300025944 Bacteria 1939
155 Ga0207667_10370133 3300025949 Bacteria 1460
156 Ga0207651_10056215 3300025960 Bacteria 2707
157 Ga0207712_10162572 3300025961 Bacteria 1737
158 Ga0207658_10097784 3300025986 Unclassified 2292
159 Ga0207677_10188000 3300026023 Bacteria 1631
160 Ga0207703_10017371 3300026035 Bacteria 5616
161 Ga0207639_10317748 3300026041 Bacteria 1382
162 Ga0207678_10006412 3300026067 Bacteria 10448
163 Ga0207708_10223437 3300026075 Bacteria 1510
164 Ga0207641_10030609 3300026088 Unclassified 4458
165 Ga0207676_10109152 3300026095 Bacteria 2311
166 Ga0207683_10006511 3300026121 Bacteria 9997
167 Ga0268266_10009787 3300028379 Bacteria 8432
168 Ga0268266_10094686 3300028379 Bacteria 2622
169 Ga0268264_10033912 3300028381 Bacteria 4196
170 Ga0373932_0022945 3300035112 Bacteria 1663
171 Ga0373945_0104699 3300035116 Bacteria 1111
172 Ga0373953_0007615 3300035117 Bacteria 3636
173 Ga0373943_0002944 3300035170 Bacteria 7726
174 Ga0373943_0089919 3300035170 Bacteria 1589
175 Ga0373943_0199500 3300035170 Unclassified 1107
176 Ga0373946_0001850 3300035171 Bacteria 7399
177 Ga0373935_0030450 3300035692 Bacteria 3345
178 Ga0373935_0071494 3300035692 Bacteria 2239
179 Ga0373935_0291722 3300035692 Bacteria 1151
180 Ga0373927_0009302 3300035695 Bacteria 6590
181 Ga0373947_0003044 3300035725 Bacteria 9971
182 Ga0373947_0020148 3300035725 Bacteria 3849
183 Ga0373947_0290154 3300035725 Unclassified 1089
184 Ga0373937_0666960 3300036401 Bacteria 986
185 Ga0373925_0002670 3300037068 Bacteria 14157
186 Ga0373925_0079646 3300037068 Bacteria 2489
187 Ga0373925_0358480 3300037068 Bacteria 1185
188 Ga0436363_0119773 3300039450 Bacteria 1780
189 Ga0495603_0114667 3300046455 Bacteria 1571
190 Ga0495580_0026339 3300046472 Bacteria 4240
191 Ga0495580_0239407 3300046472 Bacteria 1245
192 Ga0495618_0058490 3300046514 Bacteria 2442
193 Ga0495630_0128319 3300046517 Bacteria 1925
194 Ga0495665_0030120 3300046531 Bacteria 2904
195 Ga0495598_0056083 3300046537 Bacteria 1202
196 Ga0495609_0123769 3300046538 Archaea 1111
197 Ga0495635_0110081 3300046663 Bacteria 1881
198 Ga0495669_0189053 3300046684 Bacteria 983
199 Ga0495613_0122569 3300046689 Unclassified 1866
200 Ga0495624_0009277 3300046690 Bacteria 6818
201 Ga0495649_0169523 3300046694 Bacteria 1143
202 Ga0495581_0006482 3300047315 Bacteria 6788
203 Ga0495674_0193318 3300047319 Bacteria 1690
204 Ga0495684_0002880 3300047471 Bacteria 13540
205 Ga0496100_0003958 3300048903 Bacteria 7786
206 Ga0496100_0065855 3300048903 Bacteria 2402
207 Ga0496101_0016959 3300048904 Bacteria 4931
208 Ga0496101_0060437 3300048904 Unclassified 2749
209 Ga0496101_0148787 3300048904 Bacteria 1790
210 Ga0496101_0230946 3300048904 Bacteria 1438
211 Ga0496102_0003363 3300048905 Bacteria 13560
212 Ga0496102_0016018 3300048905 Bacteria 6544
213 Ga0496102_0059613 3300048905 Bacteria 3490
214 Ga0496102_0082277 3300048905 Bacteria 2969
215 Ga0496102_0164272 3300048905 Bacteria 2089
216 Ga0496103_0171183 3300048906 Bacteria 1394
217 Ga0496104_0056415 3300048907 Bacteria 3714
218 Ga0496104_0063278 3300048907 Bacteria 3508
219 Ga0496105_0009704 3300048908 Bacteria 7538
220 Ga0496105_0011909 3300048908 Bacteria 6887
221 Ga0496105_0035552 3300048908 Bacteria 4100
222 Ga0496105_0078704 3300048908 Bacteria 2722
223 Ga0496105_0152062 3300048908 Bacteria 1902
224 Ga0496106_0009339 3300048909 Bacteria 7250
225 Ga0496106_0077421 3300048909 Bacteria 2550
226 Ga0496106_0236732 3300048909 Bacteria 1458
227 Ga0496107_0019069 3300048910 Bacteria 4838
228 Ga0496107_0123539 3300048910 Unclassified 1907
229 Ga0496107_0206955 3300048910 Bacteria 1458
230 Ga0496107_0294824 3300048910 Bacteria 1207
231 Ga0496108_0012731 3300048911 Bacteria 6850
232 Ga0496108_0032554 3300048911 Bacteria 4331
233 Ga0496108_0045117 3300048911 Unclassified 3680
234 Ga0496108_0093788 3300048911 Bacteria 2554
235 Ga0496109_0001086 3300048912 Bacteria 22599
236 Ga0496109_0021193 3300048912 Bacteria 5745
237 Ga0496109_0062060 3300048912 Bacteria 3417
238 Ga0496109_0088706 3300048912 Bacteria 2858
239 Ga0496109_0107297 3300048912 Bacteria 2594
240 Ga0496109_0185169 3300048912 Bacteria 1956
241 Ga0496109_0294111 3300048912 Bacteria 1531
242 Ga0496109_0362114 3300048912 Bacteria 1370
243 Ga0496110_0000177 3300048913 Bacteria 39388
244 Ga0496110_0008104 3300048913 Bacteria 8438
245 Ga0496110_0091799 3300048913 Bacteria 2717
246 Ga0496110_0098399 3300048913 Unclassified 2621
247 Ga0496110_0275387 3300048913 Bacteria 1532
248 Ga0496110_0476805 3300048913 Bacteria 1137
249 Ga0496111_0001355 3300048914 Bacteria 13857
250 Ga0496111_0008212 3300048914 Bacteria 6901
251 Ga0496111_0033114 3300048914 Unclassified 3685
252 Ga0496112_0007646 3300048915 Bacteria 9608
253 Ga0496112_0024957 3300048915 Bacteria 5735
254 Ga0496112_0091551 3300048915 Bacteria 3010
255 Ga0496112_0095576 3300048915 Bacteria 2942
256 Ga0496112_0101927 3300048915 Bacteria 2840
257 Ga0496112_0143001 3300048915 Bacteria 2361
258 Ga0496112_0145485 3300048915 Unclassified 2339
259 Ga0496112_0171972 3300048915 Bacteria 2131
260 Ga0496112_0294509 3300048915 Bacteria 1568
261 Ga0496113_0090046 3300048916 Bacteria 2362
262 Ga0496113_0393566 3300048916 Unclassified 1112
263 Ga0496114_0006695 3300048917 Bacteria 9076
264 Ga0496114_0013838 3300048917 Bacteria 6470
265 Ga0496115_0024782 3300048918 Bacteria 4665
266 Ga0496115_0131123 3300048918 Bacteria 2066
267 Ga0496115_0399601 3300048918 Bacteria 1115
268 Ga0496121_0137273 3300048924 Bacteria 1820
269 Ga0501077_0064144 3300049593 Bacteria 2330
270 nmdc:mga0yw44_20047_c1 3300050492 Bacteria 3702
271 nmdc:mga0yw44_27940_c1 3300050492 Bacteria 3239
272 nmdc:mga05p37_161129_c1 3300050507 Bacteria 2740
273 nmdc:mga09592_131543_c1 3300050508 Bacteria 2153
274 nmdc:mga0qj67_278437_c1 3300050509 Bacteria 1356
275 nmdc:mga0qj67_350024_c1 3300050509 Bacteria 1194
276 nmdc:mga0qj67_56480_c1 3300050509 Bacteria 3111
277 nmdc:mga06r32_31996_c1 3300050510 Bacteria 4944
278 nmdc:mga06r32_369908_c1 3300050510 Bacteria 1417
279 nmdc:mga06r32_377764_c1 3300050510 Bacteria 1400
280 nmdc:mga06r32_92552_c1 3300050510 Bacteria 2956
281 nmdc:mga08y16_461027_c1 3300050511 Bacteria 1295
282 nmdc:mga0n895_175874_c1 3300050512 Unclassified 2171
283 nmdc:mga0rr50_4067_c1 3300050513 Bacteria 8539
284 nmdc:mga08x19_226675_c1 3300050514 Bacteria 1285
285 nmdc:mga0a205_17777_c1 3300050515 Bacteria 6671
286 Ga0495601_0004577 3300053077 Bacteria 8000
287 Ga0495601_0051330 3300053077 Bacteria 2603
288 Ga0495619_0341684 3300053085 Unclassified 1036
289 nmdc:mga08y16_145137_c1
290 Ga0070690_100062280
291 Ga0070670_100064899
292 Ga0068869_100131136
293 Ga0070666_10002063
294 Ga0070680_100086312
295 Ga0070682_100384868
296 Ga0068868_100113052
297 Ga0070689_100022911
298 Ga0070661_100174220
299 Ga0070675_100065181
300 Ga0070671_100140948
301 Ga0070674_100047509
302 Ga0070674_100059644
303 Ga0070674_100487602
304 Ga0070673_100031489
305 Ga0070688_100007059
306 Ga0070667_100113016
307 Ga0070709_10008480
308 Ga0070709_10172275
309 Ga0070714_100002064
310 Ga0070713_100005004
311 Ga0070710_10016008
312 Ga0070701_10104324
313 Ga0070711_100009910
314 Ga0070711_100133371
315 Ga0070711_100356815
316 Ga0070711_100375636
317 Ga0070711_100393299
318 Ga0070708_100235946
319 Ga0070708_100324090
320 Ga0070678_100041028
321 Ga0070662_100245921
322 Ga0070685_10004799
323 Ga0070706_100013572
324 Ga0070706_100076126
325 Ga0070706_100130437
326 Ga0070706_100214504
327 Ga0070707_100185794
328 Ga0070707_100312508
329 Ga0070707_100458549
330 Ga0070698_100000271
331 Ga0070698_100042345
332 Ga0070699_100155393
333 Ga0070699_100174246
334 Ga0070697_100013954
335 Ga0070697_100069774
336 Ga0070697_100284359
337 Ga0070686_100036570
338 Ga0070665_100049423
339 Ga0070665_100056287
340 Ga0070664_100086469
341 Ga0068856_100205734
342 Ga0068852_100043856
343 Ga0068864_100075229
344 Ga0068866_10068956
345 Ga0068863_100118208
346 Ga0068860_100234591
347 Ga0081455_10005468
348 Ga0081455_10021818
349 Ga0081455_10282814
350 Ga0081538_10038300
351 Ga0081540_1014302
352 Ga0070717_10001899
353 Ga0070717_10389577
354 Ga0075365_10028267
355 Ga0070715_10000408
356 Ga0070716_100002885
357 Ga0070712_100001451
358 Ga0070712_100008867
359 Ga0070712_100008996
360 Ga0075362_10038636
361 Ga0097621_100002973
362 Ga0068871_100005221
363 Ga0075428_100020239
364 Ga0075428_100504074
365 Ga0075428_100535305
366 Ga0075428_100669226
367 Ga0075431_100023148
368 Ga0075431_100097881
369 Ga0075431_100253523
370 Ga0075431_100366574
371 Ga0075431_100392143
372 Ga0075434_100083956
373 Ga0075434_100450987
374 Ga0075429_100057859
375 Ga0068865_100058339
376 Ga0111539_10059745
377 Ga0111539_10121201
378 Ga0111539_10606492
379 Ga0111539_10820269
380 Ga0105245_10064403
381 Ga0105245_10133837
382 Ga0105247_10051064
383 Ga0114129_10278723
384 Ga0114129_10512036
385 Ga0114129_10824223
386 Ga0105243_10011659
387 Ga0105242_10015862
388 Ga0105248_10048005
389 Ga0105238_10332642
390 Ga0105249_10138857
391 Ga0105249_10588447
392 Ga0105239_10328438
393 Ga0105246_10047665
394 Ga0105246_10597866
395 Ga0157342_1002438
396 Ga0157374_10113807
397 Ga0157378_10036959
398 Ga0163162_10032186
399 Ga0163162_10391865
400 Ga0163162_10395562
401 Ga0163162_10813057
402 Ga0157375_10141257
403 Ga0163163_10696689
404 Ga0157379_10050836
405 Ga0157379_10090732
406 Ga0157376_10036390
407 Ga0157376_10241534
408 Ga0163161_10023121
409 Ga0207692_10014589
410 Ga0207692_10254297
411 Ga0207710_10005686
412 Ga0207680_10010708
413 Ga0207685_10117327
414 Ga0207699_10001083
415 Ga0207684_10027799
416 Ga0207684_10047884
417 Ga0207684_10305316
418 Ga0207654_10311700
419 Ga0207693_10000506
420 Ga0207693_10087444
421 Ga0207693_10305999
422 Ga0207663_10045792
423 Ga0207663_10060550
424 Ga0207660_10263088
425 Ga0207649_10015679
426 Ga0207646_10062693
427 Ga0207694_10139415
428 Ga0207687_10020452
429 Ga0207700_10000723
430 Ga0207700_10299163
431 Ga0207664_10011330
432 Ga0207644_10001277
433 Ga0207644_10273301
434 Ga0207690_10200657
435 Ga0207706_10180431
436 Ga0207686_10010077
437 Ga0207670_10127301
438 Ga0207669_10107803
439 Ga0207665_10000534
440 Ga0207711_10028066
441 Ga0207689_10138716
442 Ga0207661_10162359
443 Ga0207667_10370133
444 Ga0207651_10056215
445 Ga0207712_10162572
446 Ga0207658_10097784
447 Ga0207677_10188000
448 Ga0207703_10017371
449 Ga0207639_10317748
450 Ga0207678_10006412
451 Ga0207708_10223437
452 Ga0207641_10030609
453 Ga0207676_10109152
454 Ga0207683_10006511
455 Ga0268266_10009787
456 Ga0268266_10094686
457 Ga0268264_10033912
458 Ga0373932_0022945
459 Ga0373945_0104699
460 Ga0373953_0007615
461 Ga0373943_0002944
462 Ga0373943_0089919
463 Ga0373943_0199500
464 Ga0373946_0001850
465 Ga0373935_0030450
466 Ga0373935_0071494
467 Ga0373935_0291722
468 Ga0373927_0009302
469 Ga0373947_0003044
470 Ga0373947_0020148
471 Ga0373947_0290154
472 Ga0373937_0666960
473 Ga0373925_0002670
474 Ga0373925_0079646
475 Ga0373925_0358480
476 Ga0436363_0119773
477 Ga0495603_0114667
478 Ga0495580_0026339
479 Ga0495580_0239407
480 Ga0495618_0058490
481 Ga0495630_0128319
482 Ga0495665_0030120
483 Ga0495598_0056083
484 Ga0495609_0123769
485 Ga0495635_0110081
486 Ga0495669_0189053
487 Ga0495613_0122569
488 Ga0495624_0009277
489 Ga0495649_0169523
490 Ga0495581_0006482
491 Ga0495674_0193318
492 Ga0495684_0002880
493 Ga0496100_0003958
494 Ga0496100_0065855
495 Ga0496101_0016959
496 Ga0496101_0060437
497 Ga0496101_0148787
498 Ga0496101_0230946
499 Ga0496102_0003363
500 Ga0496102_0016018
501 Ga0496102_0059613
502 Ga0496102_0082277
503 Ga0496102_0164272
504 Ga0496103_0171183
505 Ga0496104_0056415
506 Ga0496104_0063278
507 Ga0496105_0009704
508 Ga0496105_0011909
509 Ga0496105_0035552
510 Ga0496105_0078704
511 Ga0496105_0152062
512 Ga0496106_0009339
513 Ga0496106_0077421
514 Ga0496106_0236732
515 Ga0496107_0019069
516 Ga0496107_0123539
517 Ga0496107_0206955
518 Ga0496107_0294824
519 Ga0496108_0012731
520 Ga0496108_0032554
521 Ga0496108_0045117
522 Ga0496108_0093788
523 Ga0496109_0001086
524 Ga0496109_0021193
525 Ga0496109_0062060
526 Ga0496109_0088706
527 Ga0496109_0107297
528 Ga0496109_0185169
529 Ga0496109_0294111
530 Ga0496109_0362114
531 Ga0496110_0000177
532 Ga0496110_0008104
533 Ga0496110_0091799
534 Ga0496110_0098399
535 Ga0496110_0275387
536 Ga0496110_0476805
537 Ga0496111_0001355
538 Ga0496111_0008212
539 Ga0496111_0033114
540 Ga0496112_0007646
541 Ga0496112_0024957
542 Ga0496112_0091551
543 Ga0496112_0095576
544 Ga0496112_0101927
545 Ga0496112_0143001
546 Ga0496112_0145485
547 Ga0496112_0171972
548 Ga0496112_0294509
549 Ga0496113_0090046
550 Ga0496113_0393566
551 Ga0496114_0006695
552 Ga0496114_0013838
553 Ga0496115_0024782
554 Ga0496115_0131123
555 Ga0496115_0399601
556 Ga0496121_0137273
557 Ga0501077_0064144
558 nmdc:mga0yw44_20047_c1
559 nmdc:mga0yw44_27940_c1
560 nmdc:mga05p37_161129_c1
561 nmdc:mga09592_131543_c1
562 nmdc:mga0qj67_278437_c1
563 nmdc:mga0qj67_350024_c1
564 nmdc:mga0qj67_56480_c1
565 nmdc:mga06r32_31996_c1
566 nmdc:mga06r32_369908_c1
567 nmdc:mga06r32_377764_c1
568 nmdc:mga06r32_92552_c1
569 nmdc:mga08y16_461027_c1
570 nmdc:mga0n895_175874_c1
571 nmdc:mga0rr50_4067_c1
572 nmdc:mga08x19_226675_c1
573 nmdc:mga0a205_17777_c1
574 Ga0495601_0004577
575 Ga0495601_0051330
576 Ga0495619_0341684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

80

365

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8845 28 324
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8763 28 324
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.844 27 325
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8414 27 325
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8363 31 325
ID Description Score Start End Superfamily
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8863 28 296 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8769 149 325 3.40.50.2300
3lkvA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8751 28 296 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8746 149 324 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8601 149 325 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A317GWG2-F1-model_v4 ABC transporter substrate-binding protein 0.9739 29 326
AF-A0A537L3R4-F1-model_v4 ABC transporter substrate-binding protein 0.9694 47 326
AF-A0A317GWG2-F1-model_v4 ABC transporter substrate-binding protein 0.9643 29 326
AF-A0A1N6H715-F1-model_v4 deleted 0.9561 73 322
AF-A0A537MV30-F1-model_v4 ABC transporter substrate-binding protein 0.955 88 326

Map