F388847

General Info

Members Datasets Scaffolds Average Seq Length
288 165 576 791

Family's Representative Sequence

Representative Sequence 3300049575|Ga0501039_0007520|Ga0501039_0007520_3655_6183
Length 842
Sequence MAGILGLAVALSLASPSGQAVTSESSERAAATLAAHANVVERPAVAARLRQAGRAVPSTEKPRALLDQYCVTCHNDRVKTANLSLQGLDLTQVADRAELWEKVVRKLRAGVMPPPDVPRPPLAEYEGLRDWLEAAIDRTAAAQAHPGSVVLHRLNRTEYGNAIRDLFAVRIDATTLLPADDSAHGFDNIAGSLTLSPTLLESYTTAAARVARMAVGYWQSPTEATYLASSDASQNQRLEGMPFGTRGGIVARHEFPADGEYRFSIQNFGIGSFIPGEQLALIIDGERAHVWPYRGVGLAVGMTADTDGTLEVTVPVRAGSRTVGATFIATNYRPSLDIIRQYDRKSLENNSIPQLQYHPAIGFIRVQGPFNARRPTDSASRRRVFICRPRMPSQEIDCARQILTTLARRAYRRPPTPEEIATLLSFFEEGRKGTIFDDGIEFALRFLLASPQFLVRAEREPTSRVPADQAYRLSDLELASRLSFFLWSSIPDDELVTIAAQARLRQPAVLDRQVRRMLKDPRVEALVTNFAQQLLYLRNLPATSPDGIFYPNWDDELRQSFKSESELFFESIMREDRSILDLLTADYTFVNERLARHYGIPGVYGSRLRRVTLPPGMNHRFGLLGKGSFLAVTWTQNFRSSPVKRGVWVLENILGTPPPEXXXNVPALEDTKSDSGKALTLREQMTRHRANPTCAGCHKIMDPIGFALENFDADGSWRVKQGGEGGSLIDAKVKLFDGQEVDGPVELRKALLRYSPQFVRTFIEKMMTYATGRGMEYTDMPTIRAIARDVAADDNRFSAIVLGVVRSAQFQMRAKDDERVASTSATENAFDLTSPAAVRDRP

Samples

Sample ID Description Type Environment
1 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
113 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
116 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
117 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
118 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
149 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
150 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
151 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
154 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
155 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
156 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
157 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
158 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
159 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
160 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
161 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
162 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
163 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
164 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
165 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 1.04
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 0
Rhizosphere 98.61
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501039_0007520 3300049575 Bacteria 8323
2 Ga0058862_12772827 3300004803 Bacteria 6253
3 Ga0065712_10074085 3300005290 Bacteria 4190
4 Ga0070683_100003267 3300005329 Bacteria 13106
5 Ga0070690_100009087 3300005330 Bacteria 5749
6 Ga0070670_100001248 3300005331 Bacteria 20248
7 Ga0070670_100004490 3300005331 Bacteria 11690
8 Ga0070670_100004593 3300005331 Bacteria 11591
9 Ga0070670_100035458 3300005331 Bacteria 4294
10 Ga0070677_10011299 3300005333 Bacteria 3076
11 Ga0070666_10000509 3300005335 Bacteria 23456
12 Ga0070666_10007081 3300005335 Bacteria 6914
13 Ga0070680_100025858 3300005336 Bacteria 4694
14 Ga0068868_100004131 3300005338 Bacteria 10147
15 Ga0070689_100014543 3300005340 Bacteria 5719
16 Ga0070691_10000499 3300005341 Bacteria 14752
17 Ga0070661_100034338 3300005344 Bacteria 3678
18 Ga0070675_100000668 3300005354 Bacteria 23745
19 Ga0070675_100001599 3300005354 Bacteria 16703
20 Ga0070675_100013818 3300005354 Bacteria 6356
21 Ga0070671_100012402 3300005355 Bacteria 6865
22 Ga0070673_100006750 3300005364 Bacteria 7490
23 Ga0070667_100001600 3300005367 Bacteria 20255
24 Ga0070667_100006223 3300005367 Bacteria 9932
25 Ga0070714_100001826 3300005435 Bacteria 15478
26 Ga0070713_100000935 3300005436 Bacteria 18648
27 Ga0070713_100003116 3300005436 Bacteria 10909
28 Ga0070713_100012227 3300005436 Bacteria 6288
29 Ga0070681_10014491 3300005458 Bacteria 7845
30 Ga0070681_10097324 3300005458 Bacteria 2890
31 Ga0068867_100033399 3300005459 Bacteria 3726
32 Ga0070685_10016570 3300005466 Bacteria 3929
33 Ga0070707_100002149 3300005468 Bacteria 18873
34 Ga0070679_100001946 3300005530 Bacteria 18558
35 Ga0070684_100019094 3300005535 Bacteria 5666
36 Ga0070684_100023829 3300005535 Bacteria 5127
37 Ga0070684_100039163 3300005535 Bacteria 4076
38 Ga0070697_100023038 3300005536 Bacteria 4952
39 Ga0068853_100012196 3300005539 Bacteria 6991
40 Ga0070672_100024759 3300005543 Bacteria 4442
41 Ga0070672_100027035 3300005543 Bacteria 4277
42 Ga0070665_100075066 3300005548 Bacteria 3387
43 Ga0070665_100105700 3300005548 Bacteria 2817
44 Ga0068855_100014204 3300005563 Bacteria 9593
45 Ga0070664_100002614 3300005564 Bacteria 14536
46 Ga0070664_100004059 3300005564 Bacteria 11760
47 Ga0070664_100004462 3300005564 Bacteria 11240
48 Ga0070664_100007111 3300005564 Bacteria 9028
49 Ga0070664_100018428 3300005564 Bacteria 5736
50 Ga0068857_100021578 3300005577 Bacteria 5666
51 Ga0068857_100098811 3300005577 Bacteria 2618
52 Ga0068856_100004659 3300005614 Bacteria 13627
53 Ga0068856_100031776 3300005614 Bacteria 5166
54 Ga0068859_100006552 3300005617 Bacteria 11819
55 Ga0068864_100004037 3300005618 Bacteria 12060
56 Ga0068864_100017400 3300005618 Bacteria 5994
57 Ga0068863_100001234 3300005841 Bacteria 25509
58 Ga0068863_100030948 3300005841 Bacteria 5111
59 Ga0068858_100004227 3300005842 Bacteria 14135
60 Ga0068858_100010457 3300005842 Bacteria 8791
61 Ga0068860_100098362 3300005843 Bacteria 2790
62 Ga0097621_100019275 3300006237 Bacteria 5233
63 Ga0097621_100025234 3300006237 Unclassified 4648
64 Ga0097621_100027360 3300006237 Unclassified 4483
65 Ga0097621_100048989 3300006237 Bacteria 3430
66 Ga0097621_100085220 3300006237 Bacteria 2635
67 Ga0097621_100089666 3300006237 Bacteria 2571
68 Ga0068871_100001072 3300006358 Bacteria 18335
69 Ga0068871_100001819 3300006358 Bacteria 14395
70 Ga0068871_100003612 3300006358 Bacteria 10624
71 Ga0068871_100067236 3300006358 Bacteria 2939
72 Ga0068871_100070509 3300006358 Bacteria 2872
73 Ga0075428_100022453 3300006844 Bacteria 6987
74 Ga0075428_100121583 3300006844 Unclassified 2843
75 Ga0075430_100006645 3300006846 Bacteria 9749
76 Ga0075431_100004033 3300006847 Bacteria 14304
77 Ga0075433_10000518 3300006852 Bacteria 25186
78 Ga0075433_10015748 3300006852 Bacteria 6213
79 Ga0075433_10062638 3300006852 Bacteria 3257
80 Ga0075434_100000050 3300006871 Bacteria 57279
81 Ga0075434_100010445 3300006871 Bacteria 8704
82 Ga0075434_100025735 3300006871 Bacteria 5759
83 Ga0075434_100042785 3300006871 Bacteria 4491
84 Ga0075436_100000097 3300006914 Bacteria 51842
85 Ga0097620_100006552 3300006931 Bacteria 11819
86 Ga0075435_100000005 3300007076 Bacteria 121698
87 Ga0075435_100003353 3300007076 Bacteria 10855
88 Ga0105240_10007198 3300009093 Bacteria 16204
89 Ga0105240_10015331 3300009093 Bacteria 10425
90 Ga0111539_10001202 3300009094 Bacteria 34464
91 Ga0111539_10001398 3300009094 Bacteria 32123
92 Ga0111539_10004695 3300009094 Bacteria 17858
93 Ga0111539_10021927 3300009094 Bacteria 7851
94 Ga0105245_10000192 3300009098 Bacteria 57750
95 Ga0105245_10003115 3300009098 Bacteria 14832
96 Ga0105245_10074893 3300009098 Bacteria 3081
97 Ga0105247_10018000 3300009101 Bacteria 4238
98 Ga0114129_10000202 3300009147 Bacteria 66203
99 Ga0114129_10001832 3300009147 Bacteria 28940
100 Ga0114129_10007610 3300009147 Bacteria 15415
101 Ga0114129_10011000 3300009147 Bacteria 12892
102 Ga0114129_10024950 3300009147 Bacteria 8475
103 Ga0114129_10035470 3300009147 Bacteria 7045
104 Ga0114129_10114140 3300009147 Bacteria 3724
105 Ga0114129_10124720 3300009147 Bacteria 3541
106 Ga0114129_10201082 3300009147 Bacteria 2698
107 Ga0105241_10002747 3300009174 Bacteria 13196
108 Ga0105242_10007762 3300009176 Bacteria 8255
109 Ga0105242_10025338 3300009176 Unclassified 4693
110 Ga0105248_10001742 3300009177 Bacteria 24193
111 Ga0105248_10002253 3300009177 Bacteria 21371
112 Ga0105248_10003628 3300009177 Bacteria 17122
113 Ga0105248_10022386 3300009177 Bacteria 7010
114 Ga0105248_10042135 3300009177 Bacteria 5120
115 Ga0105237_10001090 3300009545 Bacteria 36343
116 Ga0105237_10002070 3300009545 Bacteria 25422
117 Ga0105238_10006643 3300009551 Bacteria 11532
118 Ga0105238_10009391 3300009551 Bacteria 9789
119 Ga0105238_10043637 3300009551 Unclassified 4537
120 Ga0105238_10050178 3300009551 Bacteria 4200
121 Ga0105239_10002379 3300010375 Bacteria 23988
122 Ga0157370_10011635 3300013104 Bacteria 9185
123 Ga0157370_10020793 3300013104 Bacteria 6549
124 Ga0157369_10014695 3300013105 Bacteria 8833
125 Ga0157369_10021399 3300013105 Bacteria 7234
126 Ga0157378_10007551 3300013297 Bacteria 9493
127 Ga0157378_10083558 3300013297 Bacteria 2890
128 Ga0163162_10002499 3300013306 Bacteria 17379
129 Ga0163162_10039877 3300013306 Bacteria 4694
130 Ga0157372_10109976 3300013307 Bacteria 3156
131 Ga0157375_10001431 3300013308 Bacteria 20540
132 Ga0157375_10004194 3300013308 Bacteria 12512
133 Ga0157375_10009979 3300013308 Bacteria 8348
134 Ga0163163_10005398 3300014325 Bacteria 11048
135 Ga0163163_10011171 3300014325 Bacteria 8132
136 Ga0163163_10012766 3300014325 Bacteria 7664
137 Ga0163163_10014941 3300014325 Bacteria 7155
138 Ga0163163_10023713 3300014325 Bacteria 5828
139 Ga0163163_10119172 3300014325 Bacteria 2672
140 Ga0157380_10006926 3300014326 Bacteria 8020
141 Ga0157377_10006892 3300014745 Bacteria 5450
142 Ga0157379_10058895 3300014968 Bacteria 3435
143 Ga0157376_10028773 3300014969 Bacteria 4421
144 Ga0163161_10025374 3300017792 Bacteria 4194
145 Ga0197907_10812394 3300020069 Unclassified 4926
146 Ga0206352_10143095 3300020078 Bacteria 3106
147 Ga0213875_10003980 3300021388 Bacteria 8240
148 Ga0207680_10009288 3300025903 Bacteria 4872
149 Ga0207645_10034011 3300025907 Bacteria 3275
150 Ga0207643_10005620 3300025908 Bacteria 6702
151 Ga0207654_10007257 3300025911 Bacteria 5585
152 Ga0207707_10003218 3300025912 Bacteria 14505
153 Ga0207695_10000470 3300025913 Bacteria 87551
154 Ga0207695_10013492 3300025913 Bacteria 9740
155 Ga0207671_10009476 3300025914 Bacteria 8133
156 Ga0207671_10012216 3300025914 Bacteria 6923
157 Ga0207671_10032738 3300025914 Unclassified 3867
158 Ga0207652_10007454 3300025921 Bacteria 8818
159 Ga0207694_10000818 3300025924 Bacteria 27805
160 Ga0207694_10030921 3300025924 Bacteria 4088
161 Ga0207694_10052882 3300025924 Bacteria 3148
162 Ga0207650_10001019 3300025925 Bacteria 21032
163 Ga0207650_10004733 3300025925 Bacteria 9297
164 Ga0207650_10006251 3300025925 Bacteria 8116
165 Ga0207659_10000983 3300025926 Bacteria 16975
166 Ga0207659_10005565 3300025926 Bacteria 7647
167 Ga0207687_10002264 3300025927 Bacteria 13113
168 Ga0207700_10001152 3300025928 Bacteria 15186
169 Ga0207700_10023138 3300025928 Unclassified 4278
170 Ga0207644_10021478 3300025931 Unclassified 4399
171 Ga0207686_10013062 3300025934 Bacteria 4585
172 Ga0207686_10014440 3300025934 Bacteria 4397
173 Ga0207670_10015808 3300025936 Bacteria 4519
174 Ga0207704_10002081 3300025938 Bacteria 8961
175 Ga0207691_10005131 3300025940 Bacteria 12639
176 Ga0207691_10016325 3300025940 Bacteria 7049
177 Ga0207691_10017117 3300025940 Bacteria 6877
178 Ga0207711_10001094 3300025941 Bacteria 25858
179 Ga0207711_10015927 3300025941 Bacteria 6236
180 Ga0207689_10003931 3300025942 Bacteria 13530
181 Ga0207679_10004003 3300025945 Bacteria 9153
182 Ga0207679_10010766 3300025945 Bacteria 5897
183 Ga0207667_10000145 3300025949 Bacteria 107389
184 Ga0207667_10007064 3300025949 Bacteria 13569
185 Ga0207667_10013508 3300025949 Bacteria 9337
186 Ga0207658_10005857 3300025986 Bacteria 8406
187 Ga0207658_10008910 3300025986 Bacteria 6806
188 Ga0207677_10003190 3300026023 Bacteria 8647
189 Ga0207677_10035605 3300026023 Bacteria 3235
190 Ga0207703_10016436 3300026035 Bacteria 5770
191 Ga0207639_10006620 3300026041 Bacteria 7878
192 Ga0207678_10034122 3300026067 Bacteria 4432
193 Ga0207702_10002090 3300026078 Bacteria 19275
194 Ga0207641_10006903 3300026088 Bacteria 9499
195 Ga0207648_10021720 3300026089 Bacteria 5767
196 Ga0207648_10022934 3300026089 Bacteria 5598
197 Ga0207648_10041039 3300026089 Bacteria 4064
198 Ga0207676_10006861 3300026095 Bacteria 8065
199 Ga0207676_10014676 3300026095 Bacteria 5642
200 Ga0207674_10005855 3300026116 Bacteria 14577
201 Ga0207674_10016274 3300026116 Bacteria 8145
202 Ga0207675_100084507 3300026118 Bacteria 2978
203 Ga0207675_100104333 3300026118 Bacteria 2672
204 Ga0207683_10046531 3300026121 Bacteria 3797
205 Ga0207698_10009500 3300026142 Bacteria 6205
206 Ga0207428_10000329 3300027907 Bacteria 61608
207 Ga0207428_10009006 3300027907 Bacteria 8986
208 Ga0268264_10028788 3300028381 Unclassified 4547
209 Ga0265313_10002536 3300031595 Bacteria 15664
210 Ga0265314_10018408 3300031711 Bacteria 5445
211 Ga0307405_10000364 3300031731 Bacteria 16934
212 Ga0307410_10003604 3300031852 Bacteria 7803
213 Ga0307407_10001557 3300031903 Bacteria 8434
214 Ga0307412_10008479 3300031911 Bacteria 5871
215 Ga0307409_100001236 3300031995 Bacteria 12305
216 Ga0307416_100000657 3300032002 Bacteria 17910
217 Ga0307416_100009753 3300032002 Bacteria 6309
218 Ga0307411_10009542 3300032005 Bacteria 5111
219 Ga0373923_0004899 3300035111 Bacteria 4494
220 Ga0373954_0001846 3300035118 Bacteria 8744
221 Ga0373954_0015711 3300035118 Unclassified 3385
222 Ga0373927_0024825 3300035695 Unclassified 3917
223 Ga0373927_0037698 3300035695 Bacteria 3141
224 Ga0373933_0004638 3300035724 Bacteria 7527
225 Ga0373947_0010083 3300035725 Bacteria 5424
226 Ga0373937_0002466 3300036401 Bacteria 15384
227 Ga0373937_0023396 3300036401 Bacteria 5562
228 Ga0373937_0028197 3300036401 Bacteria 5080
229 Ga0373925_0006824 3300037068 Bacteria 8362
230 Ga0373925_0025152 3300037068 Bacteria 4347
231 Ga0436364_0781776 3300037853 Bacteria 13335
232 Ga0436364_1276028 3300037853 Bacteria 29443
233 Ga0495639_0013942 3300046475 Bacteria 3477
234 Ga0495664_0019288 3300046477 Unclassified 3920
235 Ga0495630_0013227 3300046517 Bacteria 6001
236 Ga0495652_0060653 3300046529 Bacteria 3196
237 Ga0495586_0029681 3300046535 Unclassified 2927
238 Ga0495586_0042457 3300046535 Bacteria 2449
239 Ga0495587_0010336 3300046536 Bacteria 5945
240 Ga0495587_0042023 3300046536 Bacteria 2727
241 Ga0495645_0028781 3300046543 Bacteria 4037
242 Ga0495667_0002106 3300046559 Bacteria 13225
243 Ga0495667_0027424 3300046559 Unclassified 3838
244 Ga0495613_0044611 3300046689 Unclassified 3279
245 Ga0495684_0001728 3300047471 Bacteria 17575
246 Ga0495602_0035526 3300048088 Bacteria 4648
247 Ga0501033_0043456 3300049570 Bacteria 3347
248 Ga0501040_0001339 3300049576 Bacteria 15578
249 Ga0501040_0034356 3300049576 Bacteria 3435
250 Ga0501041_0001470 3300049577 Bacteria 13024
251 Ga0501042_0006459 3300049578 Bacteria 7612
252 Ga0501046_0008625 3300049580 Bacteria 8866
253 Ga0501048_0013347 3300049582 Bacteria 6097
254 Ga0501071_0011358 3300049587 Bacteria 5999
255 Ga0501072_0002972 3300049588 Bacteria 12773
256 Ga0501075_0002653 3300049591 Bacteria 11955
257 Ga0501075_0004068 3300049591 Bacteria 9873
258 Ga0501076_0004478 3300049592 Bacteria 9948
259 Ga0501076_0040029 3300049592 Bacteria 3682
260 Ga0501079_0000842 3300049741 Bacteria 20901
261 Ga0501081_0003264 3300049743 Bacteria 10325
262 Ga0501035_0054566 3300049822 Bacteria 3571
263 Ga0501045_0088257 3300049824 Bacteria 2291
264 nmdc:mga05p37_16609_c1 3300050507 Bacteria 8867
265 nmdc:mga05p37_66133_c1 3300050507 Bacteria 4447
266 nmdc:mga05p37_8811_c1 3300050507 Bacteria 11922
267 nmdc:mga09592_41045_c1 3300050508 Bacteria 3889
268 nmdc:mga09592_62417_c1 3300050508 Bacteria 3153
269 nmdc:mga0qj67_3558_c1 3300050509 Bacteria 11250
270 nmdc:mga0qj67_6843_c1 3300050509 Bacteria 8381
271 nmdc:mga08y16_16208_c1 3300050511 Bacteria 7835
272 nmdc:mga08y16_16627_c1 3300050511 Bacteria 7737
273 nmdc:mga08y16_6368_c1 3300050511 Bacteria 12379
274 nmdc:mga0n895_17_c1 3300050512 Bacteria 97721
275 nmdc:mga0n895_22282_c1 3300050512 Bacteria 5939
276 nmdc:mga0n895_51604_c1 3300050512 Bacteria 4035
277 nmdc:mga0n895_5914_c1 3300050512 Bacteria 10285
278 nmdc:mga0rr50_24864_c1 3300050513 Bacteria 4156
279 nmdc:mga0rr50_24_c1 3300050513 Bacteria 115213
280 nmdc:mga08x19_164_c1 3300050514 Bacteria 48608
281 nmdc:mga0a205_1369_c1 3300050515 Bacteria 20578
282 nmdc:mga0a205_30264_c1 3300050515 Bacteria 5182
283 nmdc:mga0a205_36392_c1 3300050515 Bacteria 4729
284 Ga0500568_0006475 3300053139 Bacteria 5871
285 Ga0501084_0007729 3300054114 Bacteria 8854
286 Ga0501084_0054535 3300054114 Bacteria 3344
287 Ga0501082_0000598 3300060353 Bacteria 31815
288 Ga0530510_0002490 3300061734 Bacteria 12643
289 Ga0501039_0007520
290 Ga0058862_12772827
291 Ga0065712_10074085
292 Ga0070683_100003267
293 Ga0070690_100009087
294 Ga0070670_100001248
295 Ga0070670_100004490
296 Ga0070670_100004593
297 Ga0070670_100035458
298 Ga0070677_10011299
299 Ga0070666_10000509
300 Ga0070666_10007081
301 Ga0070680_100025858
302 Ga0068868_100004131
303 Ga0070689_100014543
304 Ga0070691_10000499
305 Ga0070661_100034338
306 Ga0070675_100000668
307 Ga0070675_100001599
308 Ga0070675_100013818
309 Ga0070671_100012402
310 Ga0070673_100006750
311 Ga0070667_100001600
312 Ga0070667_100006223
313 Ga0070714_100001826
314 Ga0070713_100000935
315 Ga0070713_100003116
316 Ga0070713_100012227
317 Ga0070681_10014491
318 Ga0070681_10097324
319 Ga0068867_100033399
320 Ga0070685_10016570
321 Ga0070707_100002149
322 Ga0070679_100001946
323 Ga0070684_100019094
324 Ga0070684_100023829
325 Ga0070684_100039163
326 Ga0070697_100023038
327 Ga0068853_100012196
328 Ga0070672_100024759
329 Ga0070672_100027035
330 Ga0070665_100075066
331 Ga0070665_100105700
332 Ga0068855_100014204
333 Ga0070664_100002614
334 Ga0070664_100004059
335 Ga0070664_100004462
336 Ga0070664_100007111
337 Ga0070664_100018428
338 Ga0068857_100021578
339 Ga0068857_100098811
340 Ga0068856_100004659
341 Ga0068856_100031776
342 Ga0068859_100006552
343 Ga0068864_100004037
344 Ga0068864_100017400
345 Ga0068863_100001234
346 Ga0068863_100030948
347 Ga0068858_100004227
348 Ga0068858_100010457
349 Ga0068860_100098362
350 Ga0097621_100019275
351 Ga0097621_100025234
352 Ga0097621_100027360
353 Ga0097621_100048989
354 Ga0097621_100085220
355 Ga0097621_100089666
356 Ga0068871_100001072
357 Ga0068871_100001819
358 Ga0068871_100003612
359 Ga0068871_100067236
360 Ga0068871_100070509
361 Ga0075428_100022453
362 Ga0075428_100121583
363 Ga0075430_100006645
364 Ga0075431_100004033
365 Ga0075433_10000518
366 Ga0075433_10015748
367 Ga0075433_10062638
368 Ga0075434_100000050
369 Ga0075434_100010445
370 Ga0075434_100025735
371 Ga0075434_100042785
372 Ga0075436_100000097
373 Ga0097620_100006552
374 Ga0075435_100000005
375 Ga0075435_100003353
376 Ga0105240_10007198
377 Ga0105240_10015331
378 Ga0111539_10001202
379 Ga0111539_10001398
380 Ga0111539_10004695
381 Ga0111539_10021927
382 Ga0105245_10000192
383 Ga0105245_10003115
384 Ga0105245_10074893
385 Ga0105247_10018000
386 Ga0114129_10000202
387 Ga0114129_10001832
388 Ga0114129_10007610
389 Ga0114129_10011000
390 Ga0114129_10024950
391 Ga0114129_10035470
392 Ga0114129_10114140
393 Ga0114129_10124720
394 Ga0114129_10201082
395 Ga0105241_10002747
396 Ga0105242_10007762
397 Ga0105242_10025338
398 Ga0105248_10001742
399 Ga0105248_10002253
400 Ga0105248_10003628
401 Ga0105248_10022386
402 Ga0105248_10042135
403 Ga0105237_10001090
404 Ga0105237_10002070
405 Ga0105238_10006643
406 Ga0105238_10009391
407 Ga0105238_10043637
408 Ga0105238_10050178
409 Ga0105239_10002379
410 Ga0157370_10011635
411 Ga0157370_10020793
412 Ga0157369_10014695
413 Ga0157369_10021399
414 Ga0157378_10007551
415 Ga0157378_10083558
416 Ga0163162_10002499
417 Ga0163162_10039877
418 Ga0157372_10109976
419 Ga0157375_10001431
420 Ga0157375_10004194
421 Ga0157375_10009979
422 Ga0163163_10005398
423 Ga0163163_10011171
424 Ga0163163_10012766
425 Ga0163163_10014941
426 Ga0163163_10023713
427 Ga0163163_10119172
428 Ga0157380_10006926
429 Ga0157377_10006892
430 Ga0157379_10058895
431 Ga0157376_10028773
432 Ga0163161_10025374
433 Ga0197907_10812394
434 Ga0206352_10143095
435 Ga0213875_10003980
436 Ga0207680_10009288
437 Ga0207645_10034011
438 Ga0207643_10005620
439 Ga0207654_10007257
440 Ga0207707_10003218
441 Ga0207695_10000470
442 Ga0207695_10013492
443 Ga0207671_10009476
444 Ga0207671_10012216
445 Ga0207671_10032738
446 Ga0207652_10007454
447 Ga0207694_10000818
448 Ga0207694_10030921
449 Ga0207694_10052882
450 Ga0207650_10001019
451 Ga0207650_10004733
452 Ga0207650_10006251
453 Ga0207659_10000983
454 Ga0207659_10005565
455 Ga0207687_10002264
456 Ga0207700_10001152
457 Ga0207700_10023138
458 Ga0207644_10021478
459 Ga0207686_10013062
460 Ga0207686_10014440
461 Ga0207670_10015808
462 Ga0207704_10002081
463 Ga0207691_10005131
464 Ga0207691_10016325
465 Ga0207691_10017117
466 Ga0207711_10001094
467 Ga0207711_10015927
468 Ga0207689_10003931
469 Ga0207679_10004003
470 Ga0207679_10010766
471 Ga0207667_10000145
472 Ga0207667_10007064
473 Ga0207667_10013508
474 Ga0207658_10005857
475 Ga0207658_10008910
476 Ga0207677_10003190
477 Ga0207677_10035605
478 Ga0207703_10016436
479 Ga0207639_10006620
480 Ga0207678_10034122
481 Ga0207702_10002090
482 Ga0207641_10006903
483 Ga0207648_10021720
484 Ga0207648_10022934
485 Ga0207648_10041039
486 Ga0207676_10006861
487 Ga0207676_10014676
488 Ga0207674_10005855
489 Ga0207674_10016274
490 Ga0207675_100084507
491 Ga0207675_100104333
492 Ga0207683_10046531
493 Ga0207698_10009500
494 Ga0207428_10000329
495 Ga0207428_10009006
496 Ga0268264_10028788
497 Ga0265313_10002536
498 Ga0265314_10018408
499 Ga0307405_10000364
500 Ga0307410_10003604
501 Ga0307407_10001557
502 Ga0307412_10008479
503 Ga0307409_100001236
504 Ga0307416_100000657
505 Ga0307416_100009753
506 Ga0307411_10009542
507 Ga0373923_0004899
508 Ga0373954_0001846
509 Ga0373954_0015711
510 Ga0373927_0024825
511 Ga0373927_0037698
512 Ga0373933_0004638
513 Ga0373947_0010083
514 Ga0373937_0002466
515 Ga0373937_0023396
516 Ga0373937_0028197
517 Ga0373925_0006824
518 Ga0373925_0025152
519 Ga0436364_0781776
520 Ga0436364_1276028
521 Ga0495639_0013942
522 Ga0495664_0019288
523 Ga0495630_0013227
524 Ga0495652_0060653
525 Ga0495586_0029681
526 Ga0495586_0042457
527 Ga0495587_0010336
528 Ga0495587_0042023
529 Ga0495645_0028781
530 Ga0495667_0002106
531 Ga0495667_0027424
532 Ga0495613_0044611
533 Ga0495684_0001728
534 Ga0495602_0035526
535 Ga0501033_0043456
536 Ga0501040_0001339
537 Ga0501040_0034356
538 Ga0501041_0001470
539 Ga0501042_0006459
540 Ga0501046_0008625
541 Ga0501048_0013347
542 Ga0501071_0011358
543 Ga0501072_0002972
544 Ga0501075_0002653
545 Ga0501075_0004068
546 Ga0501076_0004478
547 Ga0501076_0040029
548 Ga0501079_0000842
549 Ga0501081_0003264
550 Ga0501035_0054566
551 Ga0501045_0088257
552 nmdc:mga05p37_16609_c1
553 nmdc:mga05p37_66133_c1
554 nmdc:mga05p37_8811_c1
555 nmdc:mga09592_41045_c1
556 nmdc:mga09592_62417_c1
557 nmdc:mga0qj67_3558_c1
558 nmdc:mga0qj67_6843_c1
559 nmdc:mga08y16_16208_c1
560 nmdc:mga08y16_16627_c1
561 nmdc:mga08y16_6368_c1
562 nmdc:mga0n895_17_c1
563 nmdc:mga0n895_22282_c1
564 nmdc:mga0n895_51604_c1
565 nmdc:mga0n895_5914_c1
566 nmdc:mga0rr50_24864_c1
567 nmdc:mga0rr50_24_c1
568 nmdc:mga08x19_164_c1
569 nmdc:mga0a205_1369_c1
570 nmdc:mga0a205_30264_c1
571 nmdc:mga0a205_36392_c1
572 Ga0500568_0006475
573 Ga0501084_0007729
574 Ga0501084_0054535
575 Ga0501082_0000598
576 Ga0530510_0002490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07624

PSD2

Protein of unknown function (DUF1585)

737

810

0.99

PF07631

PSD4

Protein of unknown function (DUF1592)

473

600

0.99

PF07626

PSD3

Protein of unknown function (DUF1587)

152

216

0.98

PF07637

PSD5

Protein of unknown function (DUF1595)

398

458

0.98

PF07635

PSCyt1

Planctomycete cytochrome C

70

116

0.94

PF07627

PSCyt3

Protein of unknown function (DUF1588)

620

721

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2dcj-assembly1.cif.gz_B a two-domain structure of alkaliphilic xynj from bacillus sp. 41m-1 0.6464 213 357
5wug-assembly1.cif.gz_A expression, characterization and crystal structure of a novel beta-glucosidase from paenibacillus barengoltzii 0.6203 213 357
3afg-assembly2.cif.gz_B crystal structure of pron-tk-sp from thermococcus kodakaraensis 0.6183 213 366
4qaw-assembly5.cif.gz_E structure of modular xyn30d from paenibacillus barcinonensis 0.6066 213 364
2w1w-assembly1.cif.gz_A native structure of a family 35 carbohydrate binding module from clostridium thermocellum 0.6035 210 357
ID Description Score Start End Superfamily
5ak1A02 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7442 239 359 2.60.120.260
5la2B02 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.7165 239 359 2.60.120.260
3a21A03 Mainly Beta;Sandwich;Jelly Rolls;Galactose-binding domain-like 0.6297 213 367 2.60.120.260
3afgB03 Mainly Beta;Sandwich;Jelly Rolls; 0.6183 213 366 2.60.120.380
3afgB03 Mainly Beta;Sandwich;Jelly Rolls; 0.6086 213 366 2.60.120.380
ID Description Score Start End GO Terms
AF-A0A432HZ14-F1-model_v4 DUF1592 domain-containing protein 0.9072 378 807
AF-A0A2V8BYM9-F1-model_v4 DUF1595 domain-containing protein 0.9069 358 471
AF-A0A2V8ENY1-F1-model_v4 DUF1592 domain-containing protein 0.9056 386 810
AF-A0A353DXZ8-F1-model_v4 DUF1592 domain-containing protein 0.9034 399 810
AF-A0A3D3QJE8-F1-model_v4 DUF1592 domain-containing protein 0.9028 359 809

Map