F388824

General Info

Members Datasets Scaffolds Average Seq Length
288 153 576 145

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_1122620|Ga0496112_1122620_145_615
Length 156
Sequence MPLIPRPLPPTPFGQDVIEQIIPHRPPFLLVDRIVELEPGERVVGEKTVRADEWYLRGHFPGRPIMPGVLMVEALAQAGAVGVLSHPDYEGRFVVFAGLDDVRFRRIVTPGDVLTLEVSVDRLRRSIGRGTAQARVGTEVAVDAQLTFGFLDQAPA

Samples

Sample ID Description Type Environment
1 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
43 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
55 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
56 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
57 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
58 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
59 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
60 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
61 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
62 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
63 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
65 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
66 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
70 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
71 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
72 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
73 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
74 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
75 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
76 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
83 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
84 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
85 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
86 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
87 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
88 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
91 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
92 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
93 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
94 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
95 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
96 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
99 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
100 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
101 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
102 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
103 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
104 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
105 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
110 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
114 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
126 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
127 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
134 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
141 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
144 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
148 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
149 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
150 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.74
Nodule 0
Rhizoplane 2.78
Rhizosphere 94.1
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496112_1122620 3300048915 Bacteria 704
2 JGI25407J50210_10001062 3300003373 Bacteria 6033
3 Ga0070680_100527741 3300005336 Bacteria 1011
4 Ga0070675_100026384 3300005354 Bacteria 4662
5 Ga0070674_100672623 3300005356 Bacteria 882
6 Ga0070688_100779707 3300005365 Bacteria 746
7 Ga0070703_10094688 3300005406 Bacteria 1042
8 Ga0070709_10493242 3300005434 Bacteria 929
9 Ga0070713_101000294 3300005436 Unclassified 807
10 Ga0070713_101904401 3300005436 Bacteria 577
11 Ga0070708_100003030 3300005445 Bacteria 13042
12 Ga0070706_100009012 3300005467 Bacteria 9288
13 Ga0070707_100388901 3300005468 Bacteria 1354
14 Ga0070707_100494658 3300005468 Bacteria 1184
15 Ga0070698_100008504 3300005471 Bacteria 11079
16 Ga0070698_100226547 3300005471 Bacteria 1802
17 Ga0070699_100415957 3300005518 Unclassified 1217
18 Ga0070684_101054889 3300005535 Bacteria 763
19 Ga0070684_101258268 3300005535 Unclassified 696
20 Ga0070697_100055703 3300005536 Bacteria 3215
21 Ga0070672_100174096 3300005543 Bacteria 1791
22 Ga0070696_101120277 3300005546 Unclassified 662
23 Ga0068854_100194798 3300005578 Bacteria 1590
24 Ga0068861_101562287 3300005719 Bacteria 649
25 Ga0081455_10004038 3300005937 Bacteria 16631
26 Ga0081455_10024676 3300005937 Bacteria 5563
27 Ga0081455_10121050 3300005937 Bacteria 2062
28 Ga0081455_10160700 3300005937 Bacteria 1722
29 Ga0081455_10193833 3300005937 Bacteria 1528
30 Ga0081455_10209731 3300005937 Bacteria 1452
31 Ga0081455_10237233 3300005937 Bacteria 1342
32 Ga0081538_10001259 3300005981 Bacteria 26435
33 Ga0081538_10002703 3300005981 Bacteria 17055
34 Ga0081538_10096453 3300005981 Bacteria 1506
35 Ga0081538_10292133 3300005981 Bacteria 602
36 Ga0070717_10533112 3300006028 Bacteria 1063
37 Ga0075363_100003589 3300006048 Bacteria 6637
38 Ga0075364_10254705 3300006051 Unclassified 1193
39 Ga0075370_10447546 3300006353 Bacteria 777
40 Ga0075428_100000050 3300006844 Bacteria 93539
41 Ga0075428_100012012 3300006844 Bacteria 9635
42 Ga0075428_100014230 3300006844 Bacteria 8851
43 Ga0075428_100014417 3300006844 Bacteria 8782
44 Ga0075428_100275296 3300006844 Bacteria 1811
45 Ga0075428_100282617 3300006844 Bacteria 1785
46 Ga0075428_100298015 3300006844 Bacteria 1734
47 Ga0075428_100319518 3300006844 Bacteria 1668
48 Ga0075428_100445249 3300006844 Bacteria 1387
49 Ga0075430_100001317 3300006846 Bacteria 20049
50 Ga0075430_100056154 3300006846 Bacteria 3310
51 Ga0075430_100099975 3300006846 Bacteria 2422
52 Ga0075430_100110772 3300006846 Bacteria 2289
53 Ga0075430_100165253 3300006846 Unclassified 1842
54 Ga0075430_100401006 3300006846 Bacteria 1132
55 Ga0075431_100001056 3300006847 Bacteria 24643
56 Ga0075431_100003920 3300006847 Bacteria 14486
57 Ga0075431_100014309 3300006847 Bacteria 8024
58 Ga0075431_100023904 3300006847 Bacteria 6255
59 Ga0075431_100065978 3300006847 Bacteria 3737
60 Ga0075431_100187905 3300006847 Bacteria 2118
61 Ga0075431_100256812 3300006847 Bacteria 1774
62 Ga0075431_100298044 3300006847 Bacteria 1629
63 Ga0075431_100553102 3300006847 Bacteria 1138
64 Ga0075431_100676416 3300006847 Bacteria 1011
65 Ga0075431_100985852 3300006847 Bacteria 810
66 Ga0075431_101144175 3300006847 Bacteria 742
67 Ga0075433_10003298 3300006852 Bacteria 12463
68 Ga0075434_100005166 3300006871 Bacteria 11856
69 Ga0075434_100449304 3300006871 Bacteria 1310
70 Ga0075429_100003616 3300006880 Bacteria 13177
71 Ga0075429_100006865 3300006880 Bacteria 9880
72 Ga0075429_100030054 3300006880 Bacteria 4719
73 Ga0075429_100330866 3300006880 Bacteria 1333
74 Ga0075429_100551907 3300006880 Bacteria 1010
75 Ga0075429_100569504 3300006880 Bacteria 992
76 Ga0075436_100011145 3300006914 Bacteria 6165
77 Ga0075435_100001522 3300007076 Bacteria 14923
78 Ga0111539_10003726 3300009094 Bacteria 20059
79 Ga0111539_10258900 3300009094 Bacteria 2026
80 Ga0111539_10546271 3300009094 Bacteria 1350
81 Ga0111539_11468428 3300009094 Bacteria 791
82 Ga0105245_10799138 3300009098 Bacteria 981
83 Ga0105245_10807694 3300009098 Unclassified 976
84 Ga0105247_10736694 3300009101 Unclassified 746
85 Ga0114129_10003459 3300009147 Bacteria 22205
86 Ga0114129_10103932 3300009147 Bacteria 3926
87 Ga0114129_10110939 3300009147 Bacteria 3786
88 Ga0114129_10163583 3300009147 Bacteria 3038
89 Ga0114129_10182504 3300009147 Bacteria 2854
90 Ga0114129_10320979 3300009147 Bacteria 2059
91 Ga0114129_10661596 3300009147 Bacteria 1347
92 Ga0114129_10880126 3300009147 Bacteria 1136
93 Ga0105243_10276452 3300009148 Bacteria 1510
94 Ga0105242_10620491 3300009176 Bacteria 1047
95 Ga0105249_10749995 3300009553 Bacteria 1038
96 Ga0157375_11297704 3300013308 Unclassified 856
97 Ga0213876_10151297 3300021384 Bacteria 1234
98 Ga0207684_10034308 3300025910 Bacteria 4312
99 Ga0207646_10022761 3300025922 Bacteria 5763
100 Ga0207687_10581123 3300025927 Unclassified 942
101 Ga0207700_10357631 3300025928 Bacteria 1272
102 Ga0207706_10847149 3300025933 Bacteria 774
103 Ga0207709_10226327 3300025935 Bacteria 1352
104 Ga0207669_10166987 3300025937 Bacteria 1562
105 Ga0207704_10857241 3300025938 Bacteria 762
106 Ga0207676_10913791 3300026095 Bacteria 862
107 Ga0207428_10083394 3300027907 Bacteria 2493
108 Ga0207428_10281671 3300027907 Bacteria 1234
109 Ga0265327_10007753 3300031251 Bacteria 8197
110 Ga0316578_10029878 3300031728 Bacteria 3096
111 Ga0373944_0260193 3300035089 Unclassified 643
112 Ga0373923_0622282 3300035111 Bacteria 533
113 Ga0373939_0511246 3300035114 Unclassified 514
114 Ga0373945_0172994 3300035116 Bacteria 886
115 Ga0373953_0088461 3300035117 Bacteria 1294
116 Ga0373946_0172155 3300035171 Bacteria 1023
117 Ga0316574_0026411 3300035398 Bacteria 3491
118 Ga0373924_0259412 3300035410 Unclassified 770
119 Ga0373924_0537286 3300035410 Bacteria 526
120 Ga0373927_0497088 3300035695 Bacteria 806
121 Ga0373933_0590404 3300035724 Bacteria 729
122 Ga0373947_0160918 3300035725 Bacteria 1452
123 Ga0373937_0021762 3300036401 Bacteria 5756
124 Ga0373925_0122982 3300037068 Bacteria 2016
125 Ga0436365_0369512 3300039437 Bacteria 1400
126 Ga0436365_1222466 3300039437 Bacteria 5376
127 Ga0436365_1622799 3300039437 Bacteria 5354
128 Ga0436362_0064723 3300039453 Bacteria 1198
129 Ga0436362_0703469 3300039453 Bacteria 6434
130 Ga0439450_002265 3300042008 Bacteria 3000
131 Ga0439454_006121 3300042011 Bacteria 1467
132 Ga0439463_027309 3300042016 Bacteria 1436
133 Ga0439444_0031301 3300042437 Bacteria 1000
134 Ga0439464_0001218 3300042439 Bacteria 5980
135 Ga0466967_0398386 3300045976 Bacteria 1339
136 Ga0495592_0246603 3300046454 Bacteria 1183
137 Ga0495592_0601511 3300046454 Unclassified 670
138 Ga0495603_0627954 3300046455 Unclassified 615
139 Ga0495629_0941937 3300046459 Bacteria 564
140 Ga0495651_0064773 3300046462 Unclassified 2793
141 Ga0495651_0100510 3300046462 Bacteria 2154
142 Ga0495653_0121854 3300046463 Bacteria 1857
143 Ga0495653_0239009 3300046463 Unclassified 1212
144 Ga0495653_0242909 3300046463 Bacteria 1199
145 Ga0495653_0272164 3300046463 Bacteria 1115
146 Ga0495582_0365102 3300046473 Bacteria 832
147 Ga0495582_0582824 3300046473 Unclassified 647
148 Ga0495594_0107698 3300046499 Bacteria 1570
149 Ga0495608_0154098 3300046511 Bacteria 1463
150 Ga0495618_0465486 3300046514 Unclassified 766
151 Ga0495628_0061164 3300046516 Bacteria 2954
152 Ga0495628_0062300 3300046516 Bacteria 2924
153 Ga0495628_0075386 3300046516 Bacteria 2627
154 Ga0495628_0333703 3300046516 Unclassified 1117
155 Ga0495630_0029718 3300046517 Bacteria 4063
156 Ga0495630_0080160 3300046517 Bacteria 2462
157 Ga0495631_0120787 3300046518 Bacteria 1127
158 Ga0495666_0214652 3300046526 Bacteria 882
159 Ga0495586_0286260 3300046535 Bacteria 943
160 Ga0495587_0142038 3300046536 Bacteria 1370
161 Ga0495622_0061348 3300046557 Bacteria 1741
162 Ga0495667_0044801 3300046559 Bacteria 2929
163 Ga0495634_0079450 3300046642 Bacteria 2148
164 Ga0495634_0295769 3300046642 Unclassified 980
165 Ga0495635_0339829 3300046663 Bacteria 1003
166 Ga0495657_0033281 3300046675 Bacteria 3590
167 Ga0495657_0055831 3300046675 Bacteria 2634
168 Ga0495623_0029681 3300046679 Bacteria 3519
169 Ga0495646_0038033 3300046680 Bacteria 2973
170 Ga0495646_0297731 3300046680 Bacteria 854
171 Ga0495647_0112945 3300046681 Bacteria 1135
172 Ga0495658_0013815 3300046683 Unclassified 4115
173 Ga0495613_0166444 3300046689 Unclassified 1566
174 Ga0495624_0627185 3300046690 Unclassified 640
175 Ga0495600_0009483 3300046809 Bacteria 6017
176 Ga0495600_0261924 3300046809 Unclassified 1098
177 Ga0495581_0493947 3300047315 Bacteria 712
178 Ga0495604_0078902 3300047317 Bacteria 2470
179 Ga0495604_0209310 3300047317 Bacteria 1348
180 Ga0495604_0659675 3300047317 Bacteria 667
181 Ga0495674_0127004 3300047319 Unclassified 2151
182 Ga0495674_0182172 3300047319 Bacteria 1749
183 Ga0495680_0013063 3300047322 Bacteria 7264
184 Ga0495680_0020247 3300047322 Bacteria 5601
185 Ga0495680_0938282 3300047322 Archaea 557
186 Ga0495684_0003659 3300047471 Bacteria 11978
187 Ga0495684_0345390 3300047471 Unclassified 1058
188 Ga0495684_0694327 3300047471 Bacteria 676
189 Ga0495602_0421680 3300048088 Bacteria 947
190 Ga0495602_0725800 3300048088 Unclassified 672
191 Ga0496103_0587353 3300048906 Unclassified 710
192 Ga0496108_0203528 3300048911 Bacteria 1718
193 Ga0496109_0342102 3300048912 Bacteria 1413
194 Ga0496111_0095110 3300048914 Bacteria 2186
195 Ga0496111_0145045 3300048914 Bacteria 1760
196 Ga0496112_1064785 3300048915 Bacteria 727
197 Ga0496113_1455780 3300048916 Bacteria 529
198 Ga0501031_0009320 3300049568 Bacteria 6382
199 Ga0501036_0021820 3300049572 Bacteria 5383
200 Ga0501036_1017824 3300049572 Bacteria 678
201 Ga0501038_0179821 3300049574 Bacteria 1707
202 Ga0501039_0013186 3300049575 Bacteria 6317
203 Ga0501040_0010050 3300049576 Bacteria 6179
204 Ga0501040_0161756 3300049576 Bacteria 1583
205 Ga0501040_1052654 3300049576 Unclassified 590
206 Ga0501041_0016966 3300049577 Bacteria 4332
207 Ga0501041_0068259 3300049577 Bacteria 2179
208 Ga0501042_0021206 3300049578 Bacteria 4524
209 Ga0501043_0540306 3300049579 Bacteria 867
210 Ga0501046_0021464 3300049580 Bacteria 5328
211 Ga0501048_0016374 3300049582 Bacteria 5463
212 Ga0501070_0178640 3300049586 Bacteria 1747
213 Ga0501071_0032285 3300049587 Bacteria 3717
214 Ga0501072_0005311 3300049588 Bacteria 9811
215 Ga0501072_0178821 3300049588 Bacteria 1692
216 Ga0501072_0537478 3300049588 Bacteria 924
217 Ga0501074_0153389 3300049590 Bacteria 1646
218 Ga0501074_0336977 3300049590 Bacteria 1071
219 Ga0501075_0001753 3300049591 Bacteria 14269
220 Ga0501075_0045246 3300049591 Bacteria 3303
221 Ga0501076_0001646 3300049592 Bacteria 15081
222 Ga0501077_0003337 3300049593 Bacteria 9658
223 Ga0501077_0176460 3300049593 Bacteria 1358
224 Ga0501077_0802887 3300049593 Bacteria 605
225 Ga0501079_0020524 3300049741 Bacteria 5052
226 Ga0501079_0060379 3300049741 Bacteria 2924
227 Ga0501079_0518571 3300049741 Bacteria 937
228 Ga0501081_0018839 3300049743 Bacteria 4585
229 Ga0501081_0063288 3300049743 Bacteria 2567
230 Ga0501035_0062756 3300049822 Bacteria 3306
231 Ga0501045_0006923 3300049824 Bacteria 7857
232 nmdc:mga03n38_277397_c1 3300050490 Bacteria 894
233 nmdc:mga07m45_257877_c1 3300050496 Unclassified 1014
234 nmdc:mga05p37_1157_c1 3300050507 Bacteria 10574
235 nmdc:mga05p37_1166428_c1 3300050507 Bacteria 800
236 nmdc:mga05p37_144935_c1 3300050507 Bacteria 2909
237 nmdc:mga05p37_1522188_c1 3300050507 Bacteria 665
238 nmdc:mga05p37_173715_c1 3300050507 Bacteria 2626
239 nmdc:mga05p37_208667_c1 3300050507 Bacteria 2362
240 nmdc:mga05p37_274837_c1 3300050507 Bacteria 2012
241 nmdc:mga05p37_37369_c1 3300050507 Bacteria 5954
242 nmdc:mga09592_3186_c1 3300050508 Bacteria 13307
243 nmdc:mga09592_391452_c1 3300050508 Bacteria 1201
244 nmdc:mga09592_54114_c1 3300050508 Bacteria 3391
245 nmdc:mga09592_785453_c1 3300050508 Bacteria 806
246 nmdc:mga09592_796576_c1 3300050508 Bacteria 800
247 nmdc:mga09592_81437_c1 3300050508 Bacteria 2758
248 nmdc:mga0qj67_1186_c1 3300050509 Bacteria 17798
249 nmdc:mga0qj67_1231199_c1 3300050509 Unclassified 582
250 nmdc:mga0qj67_1245862_c1 3300050509 Bacteria 578
251 nmdc:mga0qj67_130927_c1 3300050509 Bacteria 2032
252 nmdc:mga0qj67_215923_c1 3300050509 Bacteria 1557
253 nmdc:mga0qj67_801004_c1 3300050509 Bacteria 746
254 nmdc:mga06r32_135259_c1 3300050510 Bacteria 2440
255 nmdc:mga06r32_1427348_c1 3300050510 Bacteria 633
256 nmdc:mga06r32_143624_c1 3300050510 Bacteria 2364
257 nmdc:mga06r32_1753285_c1 3300050510 Bacteria 557
258 nmdc:mga06r32_17609_c1 3300050510 Bacteria 6526
259 nmdc:mga06r32_192084_c1 3300050510 Bacteria 2029
260 nmdc:mga06r32_3572_c1 3300050510 Bacteria 13880
261 nmdc:mga06r32_58254_c1 3300050510 Bacteria 3713
262 nmdc:mga06r32_7536_c1 3300050510 Bacteria 9788
263 nmdc:mga06r32_854523_c1 3300050510 Bacteria 868
264 nmdc:mga06r32_856065_c1 3300050510 Bacteria 867
265 nmdc:mga08y16_64862_c1 3300050511 Bacteria 3813
266 nmdc:mga08y16_842729_c1 3300050511 Unclassified 907
267 nmdc:mga0n895_216817_c1 3300050512 Bacteria 1943
268 nmdc:mga0n895_7941_c1 3300050512 Bacteria 9151
269 nmdc:mga0rr50_5529_c1 3300050513 Bacteria 7554
270 nmdc:mga0rr50_986924_c1 3300050513 Unclassified 718
271 nmdc:mga08x19_12014_c1 3300050514 Bacteria 5211
272 nmdc:mga0a205_1358739_c1 3300050515 Bacteria 558
273 nmdc:mga0a205_8020_c1 3300050515 Bacteria 9599
274 Ga0495601_0039439 3300053077 Bacteria 2958
275 Ga0495601_0600017 3300053077 Unclassified 707
276 Ga0495612_0271381 3300053078 Bacteria 757
277 Ga0495595_0013171 3300053084 Bacteria 3489
278 Ga0495595_0441043 3300053084 Bacteria 661
279 Ga0495619_0008138 3300053085 Bacteria 6635
280 Ga0495619_0009401 3300053085 Bacteria 6167
281 Ga0501084_0003595 3300054114 Bacteria 12588
282 Ga0501084_0011189 3300054114 Bacteria 7433
283 Ga0501082_0066738 3300060353 Bacteria 3098
284 Ga0501082_0118735 3300060353 Bacteria 2291
285 Ga0501082_0134293 3300060353 Bacteria 2147
286 Ga0530510_0025848 3300061734 Bacteria 4199
287 Ga0530510_0841583 3300061734 Bacteria 700
288 Ga0530510_1413411 3300061734 Unclassified 534
289 Ga0496112_1122620
290 JGI25407J50210_10001062
291 Ga0070680_100527741
292 Ga0070675_100026384
293 Ga0070674_100672623
294 Ga0070688_100779707
295 Ga0070703_10094688
296 Ga0070709_10493242
297 Ga0070713_101000294
298 Ga0070713_101904401
299 Ga0070708_100003030
300 Ga0070706_100009012
301 Ga0070707_100388901
302 Ga0070707_100494658
303 Ga0070698_100008504
304 Ga0070698_100226547
305 Ga0070699_100415957
306 Ga0070684_101054889
307 Ga0070684_101258268
308 Ga0070697_100055703
309 Ga0070672_100174096
310 Ga0070696_101120277
311 Ga0068854_100194798
312 Ga0068861_101562287
313 Ga0081455_10004038
314 Ga0081455_10024676
315 Ga0081455_10121050
316 Ga0081455_10160700
317 Ga0081455_10193833
318 Ga0081455_10209731
319 Ga0081455_10237233
320 Ga0081538_10001259
321 Ga0081538_10002703
322 Ga0081538_10096453
323 Ga0081538_10292133
324 Ga0070717_10533112
325 Ga0075363_100003589
326 Ga0075364_10254705
327 Ga0075370_10447546
328 Ga0075428_100000050
329 Ga0075428_100012012
330 Ga0075428_100014230
331 Ga0075428_100014417
332 Ga0075428_100275296
333 Ga0075428_100282617
334 Ga0075428_100298015
335 Ga0075428_100319518
336 Ga0075428_100445249
337 Ga0075430_100001317
338 Ga0075430_100056154
339 Ga0075430_100099975
340 Ga0075430_100110772
341 Ga0075430_100165253
342 Ga0075430_100401006
343 Ga0075431_100001056
344 Ga0075431_100003920
345 Ga0075431_100014309
346 Ga0075431_100023904
347 Ga0075431_100065978
348 Ga0075431_100187905
349 Ga0075431_100256812
350 Ga0075431_100298044
351 Ga0075431_100553102
352 Ga0075431_100676416
353 Ga0075431_100985852
354 Ga0075431_101144175
355 Ga0075433_10003298
356 Ga0075434_100005166
357 Ga0075434_100449304
358 Ga0075429_100003616
359 Ga0075429_100006865
360 Ga0075429_100030054
361 Ga0075429_100330866
362 Ga0075429_100551907
363 Ga0075429_100569504
364 Ga0075436_100011145
365 Ga0075435_100001522
366 Ga0111539_10003726
367 Ga0111539_10258900
368 Ga0111539_10546271
369 Ga0111539_11468428
370 Ga0105245_10799138
371 Ga0105245_10807694
372 Ga0105247_10736694
373 Ga0114129_10003459
374 Ga0114129_10103932
375 Ga0114129_10110939
376 Ga0114129_10163583
377 Ga0114129_10182504
378 Ga0114129_10320979
379 Ga0114129_10661596
380 Ga0114129_10880126
381 Ga0105243_10276452
382 Ga0105242_10620491
383 Ga0105249_10749995
384 Ga0157375_11297704
385 Ga0213876_10151297
386 Ga0207684_10034308
387 Ga0207646_10022761
388 Ga0207687_10581123
389 Ga0207700_10357631
390 Ga0207706_10847149
391 Ga0207709_10226327
392 Ga0207669_10166987
393 Ga0207704_10857241
394 Ga0207676_10913791
395 Ga0207428_10083394
396 Ga0207428_10281671
397 Ga0265327_10007753
398 Ga0316578_10029878
399 Ga0373944_0260193
400 Ga0373923_0622282
401 Ga0373939_0511246
402 Ga0373945_0172994
403 Ga0373953_0088461
404 Ga0373946_0172155
405 Ga0316574_0026411
406 Ga0373924_0259412
407 Ga0373924_0537286
408 Ga0373927_0497088
409 Ga0373933_0590404
410 Ga0373947_0160918
411 Ga0373937_0021762
412 Ga0373925_0122982
413 Ga0436365_0369512
414 Ga0436365_1222466
415 Ga0436365_1622799
416 Ga0436362_0064723
417 Ga0436362_0703469
418 Ga0439450_002265
419 Ga0439454_006121
420 Ga0439463_027309
421 Ga0439444_0031301
422 Ga0439464_0001218
423 Ga0466967_0398386
424 Ga0495592_0246603
425 Ga0495592_0601511
426 Ga0495603_0627954
427 Ga0495629_0941937
428 Ga0495651_0064773
429 Ga0495651_0100510
430 Ga0495653_0121854
431 Ga0495653_0239009
432 Ga0495653_0242909
433 Ga0495653_0272164
434 Ga0495582_0365102
435 Ga0495582_0582824
436 Ga0495594_0107698
437 Ga0495608_0154098
438 Ga0495618_0465486
439 Ga0495628_0061164
440 Ga0495628_0062300
441 Ga0495628_0075386
442 Ga0495628_0333703
443 Ga0495630_0029718
444 Ga0495630_0080160
445 Ga0495631_0120787
446 Ga0495666_0214652
447 Ga0495586_0286260
448 Ga0495587_0142038
449 Ga0495622_0061348
450 Ga0495667_0044801
451 Ga0495634_0079450
452 Ga0495634_0295769
453 Ga0495635_0339829
454 Ga0495657_0033281
455 Ga0495657_0055831
456 Ga0495623_0029681
457 Ga0495646_0038033
458 Ga0495646_0297731
459 Ga0495647_0112945
460 Ga0495658_0013815
461 Ga0495613_0166444
462 Ga0495624_0627185
463 Ga0495600_0009483
464 Ga0495600_0261924
465 Ga0495581_0493947
466 Ga0495604_0078902
467 Ga0495604_0209310
468 Ga0495604_0659675
469 Ga0495674_0127004
470 Ga0495674_0182172
471 Ga0495680_0013063
472 Ga0495680_0020247
473 Ga0495680_0938282
474 Ga0495684_0003659
475 Ga0495684_0345390
476 Ga0495684_0694327
477 Ga0495602_0421680
478 Ga0495602_0725800
479 Ga0496103_0587353
480 Ga0496108_0203528
481 Ga0496109_0342102
482 Ga0496111_0095110
483 Ga0496111_0145045
484 Ga0496112_1064785
485 Ga0496113_1455780
486 Ga0501031_0009320
487 Ga0501036_0021820
488 Ga0501036_1017824
489 Ga0501038_0179821
490 Ga0501039_0013186
491 Ga0501040_0010050
492 Ga0501040_0161756
493 Ga0501040_1052654
494 Ga0501041_0016966
495 Ga0501041_0068259
496 Ga0501042_0021206
497 Ga0501043_0540306
498 Ga0501046_0021464
499 Ga0501048_0016374
500 Ga0501070_0178640
501 Ga0501071_0032285
502 Ga0501072_0005311
503 Ga0501072_0178821
504 Ga0501072_0537478
505 Ga0501074_0153389
506 Ga0501074_0336977
507 Ga0501075_0001753
508 Ga0501075_0045246
509 Ga0501076_0001646
510 Ga0501077_0003337
511 Ga0501077_0176460
512 Ga0501077_0802887
513 Ga0501079_0020524
514 Ga0501079_0060379
515 Ga0501079_0518571
516 Ga0501081_0018839
517 Ga0501081_0063288
518 Ga0501035_0062756
519 Ga0501045_0006923
520 nmdc:mga03n38_277397_c1
521 nmdc:mga07m45_257877_c1
522 nmdc:mga05p37_1157_c1
523 nmdc:mga05p37_1166428_c1
524 nmdc:mga05p37_144935_c1
525 nmdc:mga05p37_1522188_c1
526 nmdc:mga05p37_173715_c1
527 nmdc:mga05p37_208667_c1
528 nmdc:mga05p37_274837_c1
529 nmdc:mga05p37_37369_c1
530 nmdc:mga09592_3186_c1
531 nmdc:mga09592_391452_c1
532 nmdc:mga09592_54114_c1
533 nmdc:mga09592_785453_c1
534 nmdc:mga09592_796576_c1
535 nmdc:mga09592_81437_c1
536 nmdc:mga0qj67_1186_c1
537 nmdc:mga0qj67_1231199_c1
538 nmdc:mga0qj67_1245862_c1
539 nmdc:mga0qj67_130927_c1
540 nmdc:mga0qj67_215923_c1
541 nmdc:mga0qj67_801004_c1
542 nmdc:mga06r32_135259_c1
543 nmdc:mga06r32_1427348_c1
544 nmdc:mga06r32_143624_c1
545 nmdc:mga06r32_1753285_c1
546 nmdc:mga06r32_17609_c1
547 nmdc:mga06r32_192084_c1
548 nmdc:mga06r32_3572_c1
549 nmdc:mga06r32_58254_c1
550 nmdc:mga06r32_7536_c1
551 nmdc:mga06r32_854523_c1
552 nmdc:mga06r32_856065_c1
553 nmdc:mga08y16_64862_c1
554 nmdc:mga08y16_842729_c1
555 nmdc:mga0n895_216817_c1
556 nmdc:mga0n895_7941_c1
557 nmdc:mga0rr50_5529_c1
558 nmdc:mga0rr50_986924_c1
559 nmdc:mga08x19_12014_c1
560 nmdc:mga0a205_1358739_c1
561 nmdc:mga0a205_8020_c1
562 Ga0495601_0039439
563 Ga0495601_0600017
564 Ga0495612_0271381
565 Ga0495595_0013171
566 Ga0495595_0441043
567 Ga0495619_0008138
568 Ga0495619_0009401
569 Ga0501084_0003595
570 Ga0501084_0011189
571 Ga0501082_0066738
572 Ga0501082_0118735
573 Ga0501082_0134293
574 Ga0530510_0025848
575 Ga0530510_0841583
576 Ga0530510_1413411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

22

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ayd-assembly1.cif.gz_CA-2 anammox-specific fabz from the annamox bacterium kuenenia stuttgartiensis 0.9664 11 138
8ayc-assembly1.cif.gz_A scalindua brodae amxfabz, i69g mutant 0.9625 9 140
8ayb-assembly1.cif.gz_A anammox-specific fabz from scalindua brodae 0.962 9 140
8ayd-assembly1.cif.gz_AA-2 anammox-specific fabz from the annamox bacterium kuenenia stuttgartiensis 0.9582 9 143
3az8-assembly1.cif.gz_E beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from plasmodium falciparum in complex with nas21 0.9564 7 138
ID Description Score Start End Superfamily
af_Q2FWF5_1_146_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9835 8 141 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9469 7 138 3.10.129.10
af_K7L5F2_57_205_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9238 7 138 3.10.129.10
2gllA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9206 7 140 3.10.129.10
5buyF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9144 7 138 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A1D7TTF2-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.9907 18 140 GO:0016829
AF-A0A2A2X4S7-F1-model_v4 deleted 0.9907 18 140
AF-A0A0F7PRT1-F1-model_v4 (3R)-hydroxymyristoyl-ACP dehydratase 0.9904 18 140 GO:0016829
AF-F7QUV8-F1-model_v4 (3R)-hydroxymyristoyl-ACP dehydratase 0.9902 18 140 GO:0016829
AF-A0A257REL1-F1-model_v4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ 0.99 25 141 GO:0016829

Map